2DC6A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca073 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
total genus 74
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc6A00
1U9QX 4QRGA 2OULA 2PREA 1NQCA 4OELA 3K9MA 2YJ2A 2AVWA 1SP4B 1CQDA 3P5VA 2E00A 2P0RA 3OF8A 1QDQA 1AECA 2AUZA 2BDLA 3H8BA 3N4CA 1STFE 2G8JA 1F2AA 1U9XA 1ME3A 1AU3A 3QJ3A 4W5BA 1MHWA 3KSEA 3O1GA 4CDEB 2AUXA 1PCIA 3MTNA 1KFXL 1EWPA 2JQFR 1BY8A 2P7UA 4W5CA 4DMYA 2BDZA 3OISA 1ITOA 4XUIA 5JH3A 3F5VA 4ZUXU 3KKUA 1MDWA 4BS6A 2HHNA 3B79A 1CS8A 3C9EA 4PADA 1NL6A 1AU4A 4X6JA 1XKGA 2E01A 2FT2A 4MSXA 3IUTA 1Y08A 3HD3A 3KW9A 1AIMA 1A6RA 3PDFA 2XU3A 2HH5A 1AU0A 2CIOA 2OP3A 3K24A 1NLJA 2NQDB 3S3RA 2DZZA 4MZOA 1KFUL 3BWKA 2DCBA 4CDCB 3I06A 3HHAA 3KWBX 1HUCB 2Y5BA 4DMXA 1NB5A 2WBFX 4Q8HA 1CJLA 1U9VA 1ICFA 2DC6A 3RVWA 2YJCA 3H7DA 3LXSA 2FRAA 5PADA 1VSNA 4CDDB 3CBKA 4BPVA 1ATKA 5CVMA 2FYEA 1PADA 1THEA 3PW3A 2OZ2A 1SNKA 1KHPA 1YK8A 2FTDA 2XU5A 4HWYA 2G8EA 3P5XA 1JQPA 1PXVA 3GCBA 4YVAA 1QXPA 1PPOA 4OEMA 3ERVA 2FO5A 3NHEA 4X6HA 2IPPB 3USVA 1BP4A 3AI8A 2DC9A 3MHHA 4I07A 1NB3A 3V6CA 9PAPA 2DCAA 4YYQA 2XU1A 3QT4A 3HWNA 3N3GA 1DF0A 1TL9A 3KWZA 3K8UA 3QSDA 2DCCA 1GMYA 2NQAA 3PNRA 1PPPA 5CHTA 3BOWA 1MIRA 1F2CA 4BQVA 1CB5A 2NQIA 3CH3X 6PADA 2ATOA 3M99A 3PBHA 4PI3A 5CVNB 4YYUA 2FQ9A 2ARYA 5EGWA 3IMAA 4P6EA 3OF9A 2G7YA 1TU6A 4YYRA 3O0UA 4QRXA 1GECE 1MEGA 2R9FA 2R9CA 3P5UA 3RVXA 3BCNA 1YK7A 2F7DA 2F1GA 2DJFB 5CHVA 3F75A 4PP1A 2PADA 2O6XA 4QBBA 1POPA 1YALA 1YT7A 3MORA 3IV2A 4FJCA 1CSBB 3H6SA 2R9OA 3DF0A 2C0YA 2PBHA 2AYNA 3TNXA 2GHUA 2R9NA 4P6GA 1M6DA 5A24A 5JA7A 2AU1A 3MHSA 1DEUA 4BSQA 3CBJA 2FUDA 2DC7A 5J94A 2DCDA 3CH2X 3V6EA 4I04A 1MEMA 1F2BA 3OVXA 1VJVA 3KX1A 5FPWA 4YYSA 2CB5A 2E02A 2IBIA 2B1NA 1GLOA 3WXFA 1ME4A 1AYVA 4I05A 3ZUAA 2P86A 3IEJA 3OVZA 4N79A 1PE6A 1EWOA 1EWLA 1MS6A 1Y4HA 1AYWA 1U5IA 2GFOA 1PBHA 4X6IA 1BGOA 1CVZA 4Q8GA 3BPMA 4YYWA 1F29A 2YJ9A 1PPNA 5CVOB 5K16A 3D6SA 4G54A 3BC3A 7PCKA 3HHIA 2DC8A 3IHPA 4CDFB 4RY2A 4CZWA 3U8EA 3N3KA 4WA6A 4N8WA 4YYVA 3IOQA 1AYUA 2HD5A 3LFYA 3E1ZB 2VHFA 1GCBA 2YJBA 1Q6KA 1CPJA 4W4UA 1S4VA 2NQGA 5F02A 3WXEA 1BQIA 4K7CA 1KHQA 2R6NA 1CTEA 1U9WA 2AS8A 2G6DA 2AYOA 8PCHA 1PIPA 2XU4A 1NPZA 3H8CA 1ZIVA 1EWMA 2YJ8A 4QRVA 1K3BB 3KFQA 2DJGB 1ZCMA 1YVBA 1PPDA 2H7JA 2B1MA 3P5WA 4XR7A 4YV8A 4FK5A 3S3QA 3I3TA 1AU2A 1CV8A 4FIPA 1QOLA 1O0EA 2VHSA 3RVVA 3BPFA 2JQGR 4AXLA 2R9MA 2FRQA 4BS5A 2AIMA 3H89A 3WXGA 1FH0A 4QH6A 2DZYA 1IWDA 2ACTA 5EF4A 2E03A 1TLOA 4MZSA 2HXZA 4AXMA 4PP2E 4KLBA 2PNSA 2Y6EA 1KXRA 1QMYA 1X9YA 1EF7A 4N4ZA
chains in the Genus database with same CATH superfamily
1U9QX 4QRGA 2OULA 2PREA 1NQCA 4OELA 3K9MA 2YJ2A 2AVWA 1SP4B 1CQDA 3P5VA 2E00A 2P0RA 3OF8A 1QDQA 1AECA 2AUZA 5E6JA 2BDLA 3H8BA 3N4CA 1STFE 2G8JA 1F2AA 1U9XA 4RF0A 1ME3A 1AU3A 3QJ3A 4W5BA 1MHWA 3KSEA 3MTVA 3O1GA 4CDEB 2AUXA 1PCIA 4OVZB 3MTNA 1KFXL 1EWPA 2JQFR 1BY8A 2AGAA 5JZEA 2P7UA 4W5CA 1UKFA 4DMYA 2BDZA 3OISA 1ITOA 4XUIA 5JH3A 3F5VA 4IP3A 2J7QC 4ZUXU 3KKUA 3IFUA 1MDWA 4BS6A 2HHNA 1PVJA 3B79A 1CS8A 3C9EA 4PADA 1NL6A 4BOUA 3TMPA 1AU4A 3TRKA 4X6JA 1XKGA 3PSEA 2E01A 2FT2A 4MSXA 3IUTA 1Y08A 3HD3A 3KW9A 1AIMA 1A6RA 3PDFA 2XU3A 2HH5A 1AU0A 2CIOA 2OP3A 3K24A 1NLJA 2NQDB 3S3RA 2DZZA 4MZOA 1KFUL 3BWKA 5KO3A 2DCBA 4CDCB 3I06A 3HHAA 3KWBX 1HUCB 2BTWA 2Y5BA 4DMXA 1NB5A 2WBFX 4Q8HA 1CJLA 1U9VA 1ICFA 2DC6A 3RVWA 2YJCA 3H7DA 3LXSA 2JRIA 2FRAA 5PADA 1VSNA 4CDDB 3CBKA 4BPVA 1ATKA 5CVMA 2FYEA 1PADA 1THEA 3PW3A 2OZ2A 1SNKA 1KHPA 1YK8A 3PT2A 2FTDA 2XU5A 4WURA 4HWYA 2G8EA 3P5XA 1JQPA 1PXVA 3GCBA 4YVAA 4BOZA 1QXPA 4BOPA 4OW0A 1PPOA 4OEMA 3ERVA 2FO5A 3NHEA 4X6HA 2IPPB 3USVA 1BP4A 3AI8A 2DC9A 3MHHA 4M0WA 4I07A 1NB3A 2UZJA 3V6CA 2JTCA 9PAPA 2DCAA 4YYQA 2XU1A 3QT4A 4BOQA 3HWNA 3BB7A 3N3GA 4A5UA 1DF0A 2BU3A 1TL9A 3KWZA 3K8UA 2HWKA 3QSDA 2DCCA 1GMYA 2NQAA 3PHUA 3PNRA 1PPPA 5CHTA 3BOWA 1MIRA 1F2CA 4BQVA 3PHXA 1CB5A 2NQIA 3CH3X 6PADA 2ATOA 3M99A 3PBHA 4PI3A 5CVNB 4YYUA 4IUMA 2FQ9A 2ARYA 5EGWA 3IMAA 4P6EA 3O65A 3OF9A 2DOSA 2G7YA 1TU6A 4YYRA 3O0UA 4QRXA 1GECE 1MEGA 2R9FA 2R9CA 3P5UA 3RVXA 3BCNA 3E9SA 1YK7A 2F7DA 2F1GA 3PRMA 2FE8A 2DJFB 5CHVA 3F75A 4PP1A 2PADA 2O6XA 4QBBA 1POPA 1YALA 1YT7A 3MORA 3IV2A 4FJCA 1CSBB 3H6SA 4RNAA 2R9OA 3DF0A 2C0YA 2PBHA 2AYNA 3TNXA 2GHUA 2R9NA 3C0RA 4P6GA 1M6DA 5A24A 5JA7A 4BOSA 2AU1A 4RF1A 4ZTBA 3MHSA 1DEUA 4BSQA 3CBJA 2FUDA 2DC7A 5J94A 2DCDA 3CH2X 3V6EA 4REZA 4I04A 1MEMA 4MI7A 1F2BA 3OVXA 1VJVA 3KX1A 5FPWA 4YYSA 2CB5A 2E02A 2IBIA 2B1NA 1GLOA 3WXFA 1ME4A 1AYVA 4I05A 3ZUAA 4MM3B 2P86A 3IEJA 3OVZA 4N79A 1PE6A 1EWOA 1EWLA 1MS6A 1Y4HA 1AYWA 1U5IA 2GFOA 3OQCA 1PBHA 4X6IA 1BGOA 1CVZA 4Q8GA 3W31A 1YZBA 3BPMA 4YYWA 1F29A 2YJ9A 1PPNA 5CVOB 5K16A 3D6SA 4G54A 3ZNHA 4OVZA 3BC3A 7PCKA 3HHIA 4RKXA 2DC8A 3IHPA 4CDFB 4RY2A 4CZWA 4HXDB 3MJ5A 3U8EA 3N3KA 3MP2A 4WA6A 4P16A 4N8WA 4YYVA 1DKIA 3IOQA 1AYUA 2HD5A 3LFYA 3BBAA 3E1ZB 2VHFA 1GCBA 2YJBA 1Q6KA 1CPJA 4W4UA 1S4VA 2NQGA 5F02A 3BY4A 1BQIA 4K7CA 3WXEA 1KHQA 2R6NA 1CTEA 1U9WA 2AS8A 2G6DA 2AYOA 4PT5A 1PIPA 8PCHA 2XU4A 1NPZA 3H8CA 1ZIVA 1EWMA 2YJ8A 4QRVA 1K3BB 3KFQA 2DJGB 1ZCMA 1YVBA 1PPDA 4R3DA 2H7JA 2B1MA 3P5WA 4XR7A 4YV8A 4FK5A 3S3QA 3I3TA 1AU2A 1CV8A 4FIPA 1QOLA 1O0EA 2VHSA 3RVVA 3W30A 3BPFA 2JQGR 4AXLA 2R9MA 2BTWB 2FRQA 4D8BA 5EZSA 4BS5A 5EZQA 4D8IA 3RNVA 2AIMA 3H89A 3WXGA 1FH0A 4QH6A 2DZYA 1IWDA 2ACTA 3PRPA 2J7QA 5EF4A 4D8EA 2E03A 1TLOA 4MZSA 2HXZA 3B21A 4AXMA 4PP2E 4KLBA 2PNSA 2Y6EA 2Z84A 1KXRA 1QMYA 1X9YA 1EF7A 4N4ZA 3PHWA 4GUAA 4XZXA
chains in the Genus database with same CATH topology
1U9QX 4QRGA 2OULA 2PREA 1NQCA 4OELA 3K9MA 2YJ2A 2AVWA 1SP4B 1CQDA 3P5VA 2E00A 2P0RA 3OF8A 1QDQA 1AECA 2AUZA 2BDLA 3H8BA 3N4CA 1STFE 2G8JA 1F2AA 1U9XA 1ME3A 1AU3A 3QJ3A 4W5BA 1MHWA 3KSEA 3O1GA 4CDEB 2AUXA 1PCIA 3MTNA 1KFXL 1EWPA 2JQFR 1BY8A 2P7UA 4W5CA 2BSZA 4DMYA 2BDZA 3OISA 2VFCA 1ITOA 4XUIA 5JH3A 3F5VA 4ZUXU 3KKUA 1MDWA 4BS6A 2HHNA 3B79A 1CS8A 3C9EA 4PADA 1NL6A 4GUZA 1AU4A 4X6JA 1XKGA 2E01A 2FT2A 4MSXA 3IUTA 1Y08A 3HD3A 3KW9A 1AIMA 1A6RA 4C5PA 3PDFA 2XU3A 2HH5A 1AU0A 2CIOA 2OP3A 3K24A 1NLJA 2NQDB 3S3RA 2DZZA 4MZOA 1KFUL 3BWKA 2DCBA 4CDCB 3I06A 3HHAA 3KWBX 1HUCB 2Y5BA 4DMXA 1NB5A 2WBFX 4Q8HA 1CJLA 1U9VA 1ICFA 2DC6A 3RVWA 1W5RA 2YJCA 3H7DA 3LXSA 2FRAA 5PADA 1VSNA 4CDDB 3CBKA 4BPVA 1ATKA 5CVMA 2FYEA 1PADA 1THEA 3PW3A 2OZ2A 1SNKA 1KHPA 1YK8A 2FTDA 2XU5A 4HWYA 2G8EA 3P5XA 1JQPA 1PXVA 3GCBA 4YVAA 3D9WA 1QXPA 1PPOA 4OEMA 3ERVA 2FO5A 3NHEA 4X6HA 2IPPB 3USVA 1BP4A 3AI8A 2DC9A 3MHHA 4I07A 1NB3A 3LTWA 3V6CA 9PAPA 2DCAA 4YYQA 2XU1A 3QT4A 3HWNA 3N3GA 1DF0A 2VFBA 1TL9A 3KWZA 3K8UA 3QSDA 2DCCA 1GMYA 2NQAA 3PNRA 1PPPA 5CHTA 3BOWA 1MIRA 1F2CA 4BQVA 1GX3A 1CB5A 2NQIA 3CH3X 6PADA 2ATOA 3M99A 3PBHA 4PI3A 5CVNB 4YYUA 2FQ9A 2ARYA 5EGWA 3IMAA 4P6EA 3OF9A 2G7YA 1TU6A 4YYRA 3O0UA 4QRXA 1GECE 1MEGA 2R9FA 2R9CA 3P5UA 3RVXA 3BCNA 1YK7A 2F7DA 2F1GA 2DJFB 5CHVA 3F75A 4PP1A 2PADA 2O6XA 4QBBA 1POPA 1YALA 1YT7A 3MORA 3IV2A 4FJCA 1CSBB 3H6SA 2R9OA 3DF0A 2C0YA 2PBHA 2AYNA 3TNXA 2GHUA 2R9NA 4P6GA 1M6DA 5A24A 5JA7A 2AU1A 3MHSA 1DEUA 4BSQA 4B55A 3CBJA 2FUDA 2DC7A 5J94A 2DCDA 3CH2X 3V6EA 4I04A 1MEMA 1F2BA 3OVXA 1VJVA 3KX1A 5FPWA 4YYSA 2CB5A 2E02A 2IBIA 2B1NA 1GLOA 3WXFA 1ME4A 1AYVA 4I05A 3ZUAA 2P86A 3IEJA 3OVZA 4N79A 1PE6A 1EWOA 1EWLA 1MS6A 1Y4HA 1AYWA 1U5IA 2GFOA 1PBHA 4X6IA 1BGOA 1CVZA 4Q8GA 3BPMA 4YYWA 1F29A 2YJ9A 1PPNA 5CVOB 1W6FA 5K16A 3D6SA 4G54A 3BC3A 7PCKA 3HHIA 2DC8A 3IHPA 4CDFB 4RY2A 4CZWA 1E2TA 3U8EA 4BGFA 3N3KA 4WA6A 4N8WA 4YYVA 3IOQA 4NV7A 1AYUA 4NV8A 2HD5A 3LFYA 3E1ZB 2VHFA 1GCBA 2YJBA 1Q6KA 1CPJA 4W4UA 1S4VA 2NQGA 5F02A 3WXEA 1BQIA 4K7CA 1KHQA 2R6NA 1CTEA 1U9WA 2AS8A 2G6DA 2AYOA 8PCHA 1PIPA 2XU4A 1NPZA 3H8CA 1ZIVA 1EWMA 2YJ8A 4QRVA 1K3BB 3KFQA 2DJGB 1ZCMA 1YVBA 1PPDA 2H7JA 2B1MA 3P5WA 4XR7A 4YV8A 4FK5A 3S3QA 3I3TA 1AU2A 1CV8A 4FIPA 1QOLA 1O0EA 2VHSA 3RVVA 3BPFA 2JQGR 4AXLA 2R9MA 2FRQA 4BS5A 2AIMA 1W4TA 3H89A 3WXGA 1FH0A 4QH6A 2DZYA 1IWDA 2ACTA 5EF4A 2E03A 1TLOA 4MZSA 2HXZA 4AXMA 4PP2E 4KLBA 2PNSA 2Y6EA 1KXRA 1QMYA 1X9YA 1EF7A 4N4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9Q X;  4QRG A;  2OUL A;  2PRE A;  1NQC A;  4OEL A;  3K9M A;  2YJ2 A;  2AVW A;  1SP4 B;  1CQD A;  3P5V A;  2E00 A;  2P0R A;  3OF8 A;  1QDQ A;  1AEC A;  2AUZ A;  2BDL A;  3H8B A;  3N4C A;  1STF E;  2G8J A;  1F2A A;  1U9X A;  1ME3 A;  1AU3 A;  3QJ3 A;  4W5B A;  1MHW A;  3KSE A;  3O1G A;  4CDE B;  2AUX A;  1PCI A;  3MTN A;  1KFX L;  1EWP A;  2JQF R;  1BY8 A;  2P7U A;  4W5C A;  4DMY A;  2BDZ A;  3OIS A;  1ITO A;  4XUI A;  5JH3 A;  3F5V A;  4ZUX U;  3KKU A;  1MDW A;  4BS6 A;  2HHN A;  3B79 A;  1CS8 A;  3C9E A;  4PAD A;  1NL6 A;  1AU4 A;  4X6J A;  1XKG A;  2E01 A;  2FT2 A;  4MSX A;  3IUT A;  1Y08 A;  3HD3 A;  3KW9 A;  1AIM A;  1A6R A;  3PDF A;  2XU3 A;  2HH5 A;  1AU0 A;  2CIO A;  2OP3 A;  3K24 A;  1NLJ A;  2NQD B;  3S3R A;  2DZZ A;  4MZO A;  1KFU L;  3BWK A;  2DCB A;  4CDC B;  3I06 A;  3HHA A;  3KWB X;  1HUC B;  2Y5B A;  4DMX A;  1NB5 A;  2WBF X;  4Q8H A;  1CJL A;  1U9V A;  1ICF A;  2DC6 A;  3RVW A;  2YJC A;  3H7D A;  3LXS A;  2FRA A;  5PAD A;  1VSN A;  4CDD B;  3CBK A;  4BPV A;  1ATK A;  5CVM A;  2FYE A;  1PAD A;  1THE A;  3PW3 A;  2OZ2 A;  1SNK A;  1KHP A;  1YK8 A;  2FTD A;  2XU5 A;  4HWY A;  2G8E A;  3P5X A;  1JQP A;  1PXV A;  3GCB A;  4YVA A;  1QXP A;  1PPO A;  4OEM A;  3ERV A;  2FO5 A;  3NHE A;  4X6H A;  2IPP B;  3USV A;  1BP4 A;  3AI8 A;  2DC9 A;  3MHH A;  4I07 A;  1NB3 A;  3V6C A;  9PAP A;  2DCA A;  4YYQ A;  2XU1 A;  3QT4 A;  3HWN A;  3N3G A;  1DF0 A;  1TL9 A;  3KWZ A;  3K8U A;  3QSD A;  2DCC A;  1GMY A;  2NQA A;  3PNR A;  1PPP A;  5CHT A;  3BOW A;  1MIR A;  1F2C A;  4BQV A;  1CB5 A;  2NQI A;  3CH3 X;  6PAD A;  2ATO A;  3M99 A;  3PBH A;  4PI3 A;  5CVN B;  4YYU A;  2FQ9 A;  2ARY A;  5EGW A;  3IMA A;  4P6E A;  3OF9 A;  2G7Y A;  1TU6 A;  4YYR A;  3O0U A;  4QRX A;  1GEC E;  1MEG A;  2R9F A;  2R9C A;  3P5U A;  3RVX A;  3BCN A;  1YK7 A;  2F7D A;  2F1G A;  2DJF B;  5CHV A;  3F75 A;  4PP1 A;  2PAD A;  2O6X A;  4QBB A;  1POP A;  1YAL A;  1YT7 A;  3MOR A;  3IV2 A;  4FJC A;  1CSB B;  3H6S A;  2R9O A;  3DF0 A;  2C0Y A;  2PBH A;  2AYN A;  3TNX A;  2GHU A;  2R9N A;  4P6G A;  1M6D A;  5A24 A;  5JA7 A;  2AU1 A;  3MHS A;  1DEU A;  4BSQ A;  3CBJ A;  2FUD A;  2DC7 A;  5J94 A;  2DCD A;  3CH2 X;  3V6E A;  4I04 A;  1MEM A;  1F2B A;  3OVX A;  1VJV A;  3KX1 A;  5FPW A;  4YYS A;  2CB5 A;  2E02 A;  2IBI A;  2B1N A;  1GLO A;  3WXF A;  1ME4 A;  1AYV A;  4I05 A;  3ZUA A;  2P86 A;  3IEJ A;  3OVZ A;  4N79 A;  1PE6 A;  1EWO A;  1EWL A;  1MS6 A;  1Y4H A;  1AYW A;  1U5I A;  2GFO A;  1PBH A;  4X6I A;  1BGO A;  1CVZ A;  4Q8G A;  3BPM A;  4YYW A;  1F29 A;  2YJ9 A;  1PPN A;  5CVO B;  5K16 A;  3D6S A;  4G54 A;  3BC3 A;  7PCK A;  3HHI A;  2DC8 A;  3IHP A;  4CDF B;  4RY2 A;  4CZW A;  3U8E A;  3N3K A;  4WA6 A;  4N8W A;  4YYV A;  3IOQ A;  1AYU A;  2HD5 A;  3LFY A;  3E1Z B;  2VHF A;  1GCB A;  2YJB A;  1Q6K A;  1CPJ A;  4W4U A;  1S4V A;  2NQG A;  5F02 A;  3WXE A;  1BQI A;  4K7C A;  1KHQ A;  2R6N A;  1CTE A;  1U9W A;  2AS8 A;  2G6D A;  2AYO A;  8PCH A;  1PIP A;  2XU4 A;  1NPZ A;  3H8C A;  1ZIV A;  1EWM A;  2YJ8 A;  4QRV A;  1K3B B;  3KFQ A;  2DJG B;  1ZCM A;  1YVB A;  1PPD A;  2H7J A;  2B1M A;  3P5W A;  4XR7 A;  4YV8 A;  4FK5 A;  3S3Q A;  3I3T A;  1AU2 A;  1CV8 A;  4FIP A;  1QOL A;  1O0E A;  2VHS A;  3RVV A;  3BPF A;  2JQG R;  4AXL A;  2R9M A;  2FRQ A;  4BS5 A;  2AIM A;  3H89 A;  3WXG A;  1FH0 A;  4QH6 A;  2DZY A;  1IWD A;  2ACT A;  5EF4 A;  2E03 A;  1TLO A;  4MZS A;  2HXZ A;  4AXM A;  4PP2 E;  4KLB A;  2PNS A;  2Y6E A;  1KXR A;  1QMY A;  1X9Y A;  1EF7 A;  4N4Z A; 
#chains in the Genus database with same CATH topology
 1U9Q X;  4QRG A;  2OUL A;  2PRE A;  1NQC A;  4OEL A;  3K9M A;  2YJ2 A;  2AVW A;  1SP4 B;  1CQD A;  3P5V A;  2E00 A;  2P0R A;  3OF8 A;  1QDQ A;  1AEC A;  2AUZ A;  5E6J A;  2BDL A;  3H8B A;  3N4C A;  1STF E;  2G8J A;  1F2A A;  1U9X A;  4RF0 A;  1ME3 A;  1AU3 A;  3QJ3 A;  4W5B A;  1MHW A;  3KSE A;  3MTV A;  3O1G A;  4CDE B;  2AUX A;  1PCI A;  4OVZ B;  3MTN A;  1KFX L;  1EWP A;  2JQF R;  1BY8 A;  2AGA A;  5JZE A;  2P7U A;  4W5C A;  1UKF A;  4DMY A;  2BDZ A;  3OIS A;  1ITO A;  4XUI A;  5JH3 A;  3F5V A;  4IP3 A;  2J7Q C;  4ZUX U;  3KKU A;  3IFU A;  1MDW A;  4BS6 A;  2HHN A;  1PVJ A;  3B79 A;  1CS8 A;  3C9E A;  4PAD A;  1NL6 A;  4BOU A;  3TMP A;  1AU4 A;  3TRK A;  4X6J A;  1XKG A;  3PSE A;  2E01 A;  2FT2 A;  4MSX A;  3IUT A;  1Y08 A;  3HD3 A;  3KW9 A;  1AIM A;  1A6R A;  3PDF A;  2XU3 A;  2HH5 A;  1AU0 A;  2CIO A;  2OP3 A;  3K24 A;  1NLJ A;  2NQD B;  3S3R A;  2DZZ A;  4MZO A;  1KFU L;  3BWK A;  5KO3 A;  2DCB A;  4CDC B;  3I06 A;  3HHA A;  3KWB X;  1HUC B;  2BTW A;  2Y5B A;  4DMX A;  1NB5 A;  2WBF X;  4Q8H A;  1CJL A;  1U9V A;  1ICF A;  2DC6 A;  3RVW A;  2YJC A;  3H7D A;  3LXS A;  2JRI A;  2FRA A;  5PAD A;  1VSN A;  4CDD B;  3CBK A;  4BPV A;  1ATK A;  5CVM A;  2FYE A;  1PAD A;  1THE A;  3PW3 A;  2OZ2 A;  1SNK A;  1KHP A;  1YK8 A;  3PT2 A;  2FTD A;  2XU5 A;  4WUR A;  4HWY A;  2G8E A;  3P5X A;  1JQP A;  1PXV A;  3GCB A;  4YVA A;  4BOZ A;  1QXP A;  4BOP A;  4OW0 A;  1PPO A;  4OEM A;  3ERV A;  2FO5 A;  3NHE A;  4X6H A;  2IPP B;  3USV A;  1BP4 A;  3AI8 A;  2DC9 A;  3MHH A;  4M0W A;  4I07 A;  1NB3 A;  2UZJ A;  3V6C A;  2JTC A;  9PAP A;  2DCA A;  4YYQ A;  2XU1 A;  3QT4 A;  4BOQ A;  3HWN A;  3BB7 A;  3N3G A;  4A5U A;  1DF0 A;  2BU3 A;  1TL9 A;  3KWZ A;  3K8U A;  2HWK A;  3QSD A;  2DCC A;  1GMY A;  2NQA A;  3PHU A;  3PNR A;  1PPP A;  5CHT A;  3BOW A;  1MIR A;  1F2C A;  4BQV A;  3PHX A;  1CB5 A;  2NQI A;  3CH3 X;  6PAD A;  2ATO A;  3M99 A;  3PBH A;  4PI3 A;  5CVN B;  4YYU A;  4IUM A;  2FQ9 A;  2ARY A;  5EGW A;  3IMA A;  4P6E A;  3O65 A;  3OF9 A;  2DOS A;  2G7Y A;  1TU6 A;  4YYR A;  3O0U A;  4QRX A;  1GEC E;  1MEG A;  2R9F A;  2R9C A;  3P5U A;  3RVX A;  3BCN A;  3E9S A;  1YK7 A;  2F7D A;  2F1G A;  3PRM A;  2FE8 A;  2DJF B;  5CHV A;  3F75 A;  4PP1 A;  2PAD A;  2O6X A;  4QBB A;  1POP A;  1YAL A;  1YT7 A;  3MOR A;  3IV2 A;  4FJC A;  1CSB B;  3H6S A;  4RNA A;  2R9O A;  3DF0 A;  2C0Y A;  2PBH A;  2AYN A;  3TNX A;  2GHU A;  2R9N A;  3C0R A;  4P6G A;  1M6D A;  5A24 A;  5JA7 A;  4BOS A;  2AU1 A;  4RF1 A;  4ZTB A;  3MHS A;  1DEU A;  4BSQ A;  3CBJ A;  2FUD A;  2DC7 A;  5J94 A;  2DCD A;  3CH2 X;  3V6E A;  4REZ A;  4I04 A;  1MEM A;  4MI7 A;  1F2B A;  3OVX A;  1VJV A;  3KX1 A;  5FPW A;  4YYS A;  2CB5 A;  2E02 A;  2IBI A;  2B1N A;  1GLO A;  3WXF A;  1ME4 A;  1AYV A;  4I05 A;  3ZUA A;  4MM3 B;  2P86 A;  3IEJ A;  3OVZ A;  4N79 A;  1PE6 A;  1EWO A;  1EWL A;  1MS6 A;  1Y4H A;  1AYW A;  1U5I A;  2GFO A;  3OQC A;  1PBH A;  4X6I A;  1BGO A;  1CVZ A;  4Q8G A;  3W31 A;  1YZB A;  3BPM A;  4YYW A;  1F29 A;  2YJ9 A;  1PPN A;  5CVO B;  5K16 A;  3D6S A;  4G54 A;  3ZNH A;  4OVZ A;  3BC3 A;  7PCK A;  3HHI A;  4RKX A;  2DC8 A;  3IHP A;  4CDF B;  4RY2 A;  4CZW A;  4HXD B;  3MJ5 A;  3U8E A;  3N3K A;  3MP2 A;  4WA6 A;  4P16 A;  4N8W A;  4YYV A;  1DKI A;  3IOQ A;  1AYU A;  2HD5 A;  3LFY A;  3BBA A;  3E1Z B;  2VHF A;  1GCB A;  2YJB A;  1Q6K A;  1CPJ A;  4W4U A;  1S4V A;  2NQG A;  5F02 A;  3BY4 A;  1BQI A;  4K7C A;  3WXE A;  1KHQ A;  2R6N A;  1CTE A;  1U9W A;  2AS8 A;  2G6D A;  2AYO A;  4PT5 A;  1PIP A;  8PCH A;  2XU4 A;  1NPZ A;  3H8C A;  1ZIV A;  1EWM A;  2YJ8 A;  4QRV A;  1K3B B;  3KFQ A;  2DJG B;  1ZCM A;  1YVB A;  1PPD A;  4R3D A;  2H7J A;  2B1M A;  3P5W A;  4XR7 A;  4YV8 A;  4FK5 A;  3S3Q A;  3I3T A;  1AU2 A;  1CV8 A;  4FIP A;  1QOL A;  1O0E A;  2VHS A;  3RVV A;  3W30 A;  3BPF A;  2JQG R;  4AXL A;  2R9M A;  2BTW B;  2FRQ A;  4D8B A;  5EZS A;  4BS5 A;  5EZQ A;  4D8I A;  3RNV A;  2AIM A;  3H89 A;  3WXG A;  1FH0 A;  4QH6 A;  2DZY A;  1IWD A;  2ACT A;  3PRP A;  2J7Q A;  5EF4 A;  4D8E A;  2E03 A;  1TLO A;  4MZS A;  2HXZ A;  3B21 A;  4AXM A;  4PP2 E;  4KLB A;  2PNS A;  2Y6E A;  2Z84 A;  1KXR A;  1QMY A;  1X9Y A;  1EF7 A;  4N4Z A;  3PHW A;  4GUA A;  4XZX A; 
#chains in the Genus database with same CATH homology
 1U9Q X;  4QRG A;  2OUL A;  2PRE A;  1NQC A;  4OEL A;  3K9M A;  2YJ2 A;  2AVW A;  1SP4 B;  1CQD A;  3P5V A;  2E00 A;  2P0R A;  3OF8 A;  1QDQ A;  1AEC A;  2AUZ A;  2BDL A;  3H8B A;  3N4C A;  1STF E;  2G8J A;  1F2A A;  1U9X A;  1ME3 A;  1AU3 A;  3QJ3 A;  4W5B A;  1MHW A;  3KSE A;  3O1G A;  4CDE B;  2AUX A;  1PCI A;  3MTN A;  1KFX L;  1EWP A;  2JQF R;  1BY8 A;  2P7U A;  4W5C A;  2BSZ A;  4DMY A;  2BDZ A;  3OIS A;  2VFC A;  1ITO A;  4XUI A;  5JH3 A;  3F5V A;  4ZUX U;  3KKU A;  1MDW A;  4BS6 A;  2HHN A;  3B79 A;  1CS8 A;  3C9E A;  4PAD A;  1NL6 A;  4GUZ A;  1AU4 A;  4X6J A;  1XKG A;  2E01 A;  2FT2 A;  4MSX A;  3IUT A;  1Y08 A;  3HD3 A;  3KW9 A;  1AIM A;  1A6R A;  4C5P A;  3PDF A;  2XU3 A;  2HH5 A;  1AU0 A;  2CIO A;  2OP3 A;  3K24 A;  1NLJ A;  2NQD B;  3S3R A;  2DZZ A;  4MZO A;  1KFU L;  3BWK A;  2DCB A;  4CDC B;  3I06 A;  3HHA A;  3KWB X;  1HUC B;  2Y5B A;  4DMX A;  1NB5 A;  2WBF X;  4Q8H A;  1CJL A;  1U9V A;  1ICF A;  2DC6 A;  3RVW A;  1W5R A;  2YJC A;  3H7D A;  3LXS A;  2FRA A;  5PAD A;  1VSN A;  4CDD B;  3CBK A;  4BPV A;  1ATK A;  5CVM A;  2FYE A;  1PAD A;  1THE A;  3PW3 A;  2OZ2 A;  1SNK A;  1KHP A;  1YK8 A;  2FTD A;  2XU5 A;  4HWY A;  2G8E A;  3P5X A;  1JQP A;  1PXV A;  3GCB A;  4YVA A;  3D9W A;  1QXP A;  1PPO A;  4OEM A;  3ERV A;  2FO5 A;  3NHE A;  4X6H A;  2IPP B;  3USV A;  1BP4 A;  3AI8 A;  2DC9 A;  3MHH A;  4I07 A;  1NB3 A;  3LTW A;  3V6C A;  9PAP A;  2DCA A;  4YYQ A;  2XU1 A;  3QT4 A;  3HWN A;  3N3G A;  1DF0 A;  2VFB A;  1TL9 A;  3KWZ A;  3K8U A;  3QSD A;  2DCC A;  1GMY A;  2NQA A;  3PNR A;  1PPP A;  5CHT A;  3BOW A;  1MIR A;  1F2C A;  4BQV A;  1GX3 A;  1CB5 A;  2NQI A;  3CH3 X;  6PAD A;  2ATO A;  3M99 A;  3PBH A;  4PI3 A;  5CVN B;  4YYU A;  2FQ9 A;  2ARY A;  5EGW A;  3IMA A;  4P6E A;  3OF9 A;  2G7Y A;  1TU6 A;  4YYR A;  3O0U A;  4QRX A;  1GEC E;  1MEG A;  2R9F A;  2R9C A;  3P5U A;  3RVX A;  3BCN A;  1YK7 A;  2F7D A;  2F1G A;  2DJF B;  5CHV A;  3F75 A;  4PP1 A;  2PAD A;  2O6X A;  4QBB A;  1POP A;  1YAL A;  1YT7 A;  3MOR A;  3IV2 A;  4FJC A;  1CSB B;  3H6S A;  2R9O A;  3DF0 A;  2C0Y A;  2PBH A;  2AYN A;  3TNX A;  2GHU A;  2R9N A;  4P6G A;  1M6D A;  5A24 A;  5JA7 A;  2AU1 A;  3MHS A;  1DEU A;  4BSQ A;  4B55 A;  3CBJ A;  2FUD A;  2DC7 A;  5J94 A;  2DCD A;  3CH2 X;  3V6E A;  4I04 A;  1MEM A;  1F2B A;  3OVX A;  1VJV A;  3KX1 A;  5FPW A;  4YYS A;  2CB5 A;  2E02 A;  2IBI A;  2B1N A;  1GLO A;  3WXF A;  1ME4 A;  1AYV A;  4I05 A;  3ZUA A;  2P86 A;  3IEJ A;  3OVZ A;  4N79 A;  1PE6 A;  1EWO A;  1EWL A;  1MS6 A;  1Y4H A;  1AYW A;  1U5I A;  2GFO A;  1PBH A;  4X6I A;  1BGO A;  1CVZ A;  4Q8G A;  3BPM A;  4YYW A;  1F29 A;  2YJ9 A;  1PPN A;  5CVO B;  1W6F A;  5K16 A;  3D6S A;  4G54 A;  3BC3 A;  7PCK A;  3HHI A;  2DC8 A;  3IHP A;  4CDF B;  4RY2 A;  4CZW A;  1E2T A;  3U8E A;  4BGF A;  3N3K A;  4WA6 A;  4N8W A;  4YYV A;  3IOQ A;  4NV7 A;  1AYU A;  4NV8 A;  2HD5 A;  3LFY A;  3E1Z B;  2VHF A;  1GCB A;  2YJB A;  1Q6K A;  1CPJ A;  4W4U A;  1S4V A;  2NQG A;  5F02 A;  3WXE A;  1BQI A;  4K7C A;  1KHQ A;  2R6N A;  1CTE A;  1U9W A;  2AS8 A;  2G6D A;  2AYO A;  8PCH A;  1PIP A;  2XU4 A;  1NPZ A;  3H8C A;  1ZIV A;  1EWM A;  2YJ8 A;  4QRV A;  1K3B B;  3KFQ A;  2DJG B;  1ZCM A;  1YVB A;  1PPD A;  2H7J A;  2B1M A;  3P5W A;  4XR7 A;  4YV8 A;  4FK5 A;  3S3Q A;  3I3T A;  1AU2 A;  1CV8 A;  4FIP A;  1QOL A;  1O0E A;  2VHS A;  3RVV A;  3BPF A;  2JQG R;  4AXL A;  2R9M A;  2FRQ A;  4BS5 A;  2AIM A;  1W4T A;  3H89 A;  3WXG A;  1FH0 A;  4QH6 A;  2DZY A;  1IWD A;  2ACT A;  5EF4 A;  2E03 A;  1TLO A;  4MZS A;  2HXZ A;  4AXM A;  4PP2 E;  4KLB A;  2PNS A;  2Y6E A;  1KXR A;  1QMY A;  1X9Y A;  1EF7 A;  4N4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...