2DJGB

Re-determination of the native structure of human dipeptidyl peptidase i (cathepsin c)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dipeptidyl-peptidase 1
total genus 44
structure length 161
sequence length 161
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2djgB01
3OISA 1MEGA 4QRGA 1F29A 1PE6A 1KFUL 3S3RA 4W5BA 1TLOA 4KLBA 1F2AA 3OVZA 3KW9A 3QJ3A 2NQIA 4YYSA 1STFE 1IWDA 1BP4A 3I06A 1ATKA 3KWZA 2IBIA 2E01A 3CBJA 1CPJA 4FJCA 1YALA 2XU5A 2NQAA 4YYWA 4CZWA 2AYOA 3E1ZB 4WA6A 2DC9A 1XKGA 1AU4A 3HWNA 2JQGR 3WXFA 1MDWA 1AIMA 2PNSA 3RVVA 1AYUA 3PDFA 5J94A 2B1NA 3O1GA 1AU0A 1MIRA 5EGWA 1F2BA 4CDEB 2P0RA 1NQCA 3GCBA 2XU4A 3CBKA 6PADA 2IPPB 2F1GA 3HHAA 3ZUAA 3H89A 4CDFB 3P5UA 1AU2A 5K16A 2GHUA 7PCKA 2DC8A 3V6EA 1POPA 4K7CA 3CH2X 2E00A 3LXSA 3TNXA 1PPNA 4YYRA 4PP1A 3MHSA 8PCHA 5CVNB 2FRAA 4I05A 4P6EA 1CB5A 1CS8A 2FTDA 1DEUA 3NHEA 4YYUA 3BC3A 2PREA 1HUCB 4PP2E 1M6DA 1MHWA 2NQGA 2WBFX 4RY2A 2FRQA 2DCAA 4QRXA 1PIPA 1EWOA 4YV8A 1EWPA 4ZUXU 2PBHA 1O0EA 1PPDA 1U9XA 1AU3A 3H8CA 1MEMA 3I3TA 1NB3A 2CIOA 2DC6A 5FPWA 2NQDB 3BWKA 2VHFA 3QT4A 2C0YA 2AUZA 9PAPA 2HHNA 2G6DA 3MORA 4PADA 3HHIA 4N79A 2AYNA 2HXZA 3RVWA 3BCNA 3H6SA 1Q6KA 1CSBB 1U5IA 1DF0A 2FYEA 4X6IA 1GCBA 4X6JA 2R9MA 1NPZA 3KFQA 3PNRA 3MTNA 1KXRA 2YJCA 1BY8A 3DF0A 1QMYA 2PADA 4MZSA 3HD3A 4QBBA 1ME4A 2OULA 1BGOA 4DMYA 4N4ZA 3N4CA 1YK7A 2FT2A 4BSQA 3IHPA 2AU1A 2DZYA 1TL9A 3ERVA 3S3QA 3BPMA 1GLOA 2AVWA 4I04A 4AXMA 1ZIVA 3V6CA 3LFYA 4W4UA 2G8JA 2Y5BA 1YT7A 1EF7A 1MS6A 1U9WA 1PPOA 2YJ9A 3C9EA 2P7UA 3IV2A 1KFXL 1PADA 4PI3A 4BS6A 1NLJA 1U9VA 3H7DA 3OF8A 3N3GA 4MZOA 3B79A 4I07A 1CQDA 3IEJA 4YYQA 4OELA 4G54A 1K3BB 2E02A 2VHSA 3MHHA 1SP4B 2CB5A 2R9CA 3QSDA 3BPFA 5A24A 2R9NA 1BQIA 2AUXA 3CH3X 3RVXA 2XU1A 2DCCA 2DZZA 3WXGA 4XUIA 2AIMA 5CHTA 3KSEA 2ATOA 1CV8A 1PXVA 2OZ2A 4DMXA 1JQPA 3OVXA 1QDQA 4Q8GA 5CVMA 5F02A 1THEA 2FQ9A 1EWLA 2B1MA 1ZCMA 4BS5A 4XR7A 1VJVA 2R6NA 3P5VA 3IMAA 1PPPA 2FO5A 3P5WA 4QH6A 3PW3A 3KKUA 2HD5A 4OEMA 2R9FA 3PBHA 1GECE 2AS8A 1YK8A 3K9MA 3O0UA 1NB5A 4YVAA 1AYVA 4FIPA 3F5VA 4BQVA 1X9YA 1F2CA 3U8EA 3KX1A 1Y4HA 4YYVA 4HWYA 1TU6A 5JA7A 2P86A 2OP3A 4N8WA 2XU3A 4CDCB 2HH5A 1KHQA 2H7JA 4AXLA 5CHVA 4BPVA 2DJFB 4P6GA 4MSXA 1CVZA 2GFOA 3H8BA 2G7YA 2YJ8A 1PBHA 3KWBX 2G8EA 2YJ2A 2DJGB 3D6SA 1YVBA 1KHPA 2E03A 1ITOA 3M99A 4QRVA 2R9OA 2DCBA 3K24A 2O6XA 2F7DA 1A6RA 2BDLA 1CTEA 1CJLA 3P5XA 4W5CA 5EF4A 5CVOB 1QXPA 4CDDB 3WXEA 1AYWA 1GMYA 3N3KA 2BDZA 4X6HA 3USVA 1AECA 1ICFA 3IOQA 2FUDA 5JH3A 2DCDA 1PCIA 3F75A 4FK5A 1QOLA 1EWMA 2DC7A 1S4VA 3IUTA 1FH0A 2ARYA 3AI8A 2ACTA 2YJBA 1VSNA 1Y08A 3BOWA 2Y6EA 2JQFR 3K8UA 1NL6A 4Q8HA 3OF9A 1SNKA 1ME3A 1U9QX 5PADA
chains in the Genus database with same CATH superfamily
3OISA 1MEGA 4QRGA 1F29A 1PE6A 1KFUL 3S3RA 4W5BA 1TLOA 4KLBA 1F2AA 5KO3A 3OVZA 3O65A 3KW9A 3PRMA 2NQIA 3QJ3A 4YYSA 1PVJA 1STFE 2FE8A 1IWDA 1BP4A 3I06A 1ATKA 3KWZA 2IBIA 2E01A 3CBJA 1CPJA 4FJCA 1YALA 2XU5A 2NQAA 4BOUA 4YYWA 4CZWA 2AYOA 3E1ZB 4WA6A 2DC9A 1XKGA 1AU4A 3HWNA 2JQGR 3B21A 3WXFA 1MDWA 1AIMA 2PNSA 3RVVA 1AYUA 3PDFA 3W31A 5J94A 4MI7A 2B1NA 5JZEA 3O1GA 1AU0A 1MIRA 5EGWA 1F2BA 4CDEB 2P0RA 1NQCA 2AGAA 2Z84A 4R3DA 3GCBA 2XU4A 3ZNHA 3CBKA 6PADA 2IPPB 2F1GA 3HHAA 3ZUAA 3H89A 4CDFB 3P5UA 1AU2A 5K16A 2GHUA 3BY4A 4OVZB 3TMPA 7PCKA 2DC8A 4OW0A 3V6EA 4A5UA 1POPA 4K7CA 4OVZA 3CH2X 1UKFA 2E00A 3LXSA 3TNXA 3PT2A 1PPNA 4YYRA 4PP1A 3MHSA 8PCHA 2FRAA 4I05A 5CVNB 4P6EA 1CB5A 1CS8A 2FTDA 1DEUA 3NHEA 3MP2A 4YYUA 3BC3A 4RNAA 2PREA 1HUCB 4PP2E 1M6DA 1MHWA 2NQGA 2WBFX 4RY2A 2FRQA 5EZSA 2DCAA 4QRXA 1PIPA 1EWOA 4YV8A 1EWPA 3PHUA 4ZUXU 2PBHA 1O0EA 1PPDA 1U9XA 1AU3A 3H8CA 1MEMA 3I3TA 1NB3A 2CIOA 4MM3B 2DC6A 4REZA 5FPWA 2NQDB 2J7QC 3BWKA 2VHFA 3QT4A 4RF1A 2C0YA 3RNVA 2AUZA 3IFUA 2BTWA 3E9SA 9PAPA 2HHNA 2G6DA 3MORA 4PADA 3OQCA 4BOZA 2DOSA 3HHIA 4N79A 2AYNA 2HXZA 3TRKA 3MTVA 3RVWA 4PT5A 3BCNA 3H6SA 1Q6KA 1CSBB 1U5IA 1DF0A 2FYEA 3W30A 3PHWA 4X6IA 3BBAA 1GCBA 4X6JA 2R9MA 1NPZA 1YZBA 3KFQA 3PNRA 3MTNA 1KXRA 2YJCA 1BY8A 3DF0A 4RKXA 1QMYA 2PADA 4MZSA 3HD3A 4QBBA 1ME4A 2UZJA 2OULA 1BGOA 4DMYA 4N4ZA 3N4CA 1YK7A 2FT2A 4BSQA 3IHPA 3C0RA 2AU1A 2DZYA 1TL9A 3ERVA 3S3QA 3BPMA 1GLOA 2AVWA 4I04A 4AXMA 1ZIVA 3V6CA 3LFYA 5E6JA 4W4UA 4IUMA 2G8JA 2Y5BA 1YT7A 1EF7A 1MS6A 1U9WA 1PPOA 2YJ9A 3C9EA 2P7UA 3PSEA 4D8BA 3IV2A 1KFXL 1PADA 4PI3A 4BS6A 2JRIA 1NLJA 1U9VA 3H7DA 3PRPA 3OF8A 3N3GA 4MZOA 3B79A 4I07A 1CQDA 3IEJA 4WURA 4YYQA 4OELA 4G54A 1K3BB 4D8IA 2E02A 4RF0A 2VHSA 3MHHA 1SP4B 2CB5A 2R9CA 3QSDA 3BPFA 5A24A 2R9NA 3PHXA 1BQIA 2AUXA 3CH3X 3RVXA 2XU1A 2DCCA 2DZZA 3WXGA 4XUIA 2AIMA 4XZXA 5CHTA 3KSEA 2ATOA 1CV8A 4P16A 1PXVA 2OZ2A 4ZTBA 5EZQA 4DMXA 1JQPA 3OVXA 1QDQA 4Q8GA 5CVMA 5F02A 1THEA 2FQ9A 1EWLA 2B1MA 1ZCMA 4BS5A 4XR7A 1VJVA 2R6NA 3P5VA 3IMAA 1PPPA 2FO5A 3P5WA 4IP3A 4QH6A 3PW3A 3KKUA 2HD5A 4OEMA 2R9FA 3PBHA 1GECE 2AS8A 1YK8A 3K9MA 3O0UA 1NB5A 4YVAA 1AYVA 4BOQA 4FIPA 3F5VA 4BQVA 1DKIA 1X9YA 1F2CA 2BU3A 3U8EA 3KX1A 1Y4HA 4YYVA 4HWYA 1TU6A 5JA7A 2P86A 2OP3A 4N8WA 2BTWB 2XU3A 4CDCB 2HH5A 4BOSA 1KHQA 2H7JA 4M0WA 4AXLA 5CHVA 4BPVA 2DJFB 4P6GA 4MSXA 1CVZA 2GFOA 3H8BA 2G7YA 2YJ8A 1PBHA 3KWBX 2G8EA 2YJ2A 2DJGB 3D6SA 1YVBA 3MJ5A 1KHPA 2E03A 1ITOA 3M99A 4QRVA 2R9OA 2DCBA 3K24A 2O6XA 2F7DA 1A6RA 2BDLA 1CTEA 1CJLA 3P5XA 4D8EA 4W5CA 3BB7A 5EF4A 5CVOB 1QXPA 4CDDB 3WXEA 1AYWA 1GMYA 3N3KA 2BDZA 4X6HA 3USVA 4BOPA 1AECA 1ICFA 3IOQA 2FUDA 5JH3A 2DCDA 1PCIA 3F75A 4FK5A 4GUAA 1QOLA 1EWMA 2JTCA 2DC7A 1S4VA 3IUTA 1FH0A 2ARYA 2J7QA 3AI8A 2ACTA 2YJBA 1VSNA 1Y08A 3BOWA 2Y6EA 2JQFR 4HXDB 3K8UA 1NL6A 4Q8HA 3OF9A 2HWKA 1SNKA 1ME3A 1U9QX 5PADA
chains in the Genus database with same CATH topology
3OISA 1MEGA 4QRGA 1F29A 1PE6A 1KFUL 3S3RA 4W5BA 1TLOA 4KLBA 1F2AA 3OVZA 3KW9A 3QJ3A 2NQIA 4YYSA 4B55A 1STFE 1IWDA 1BP4A 3I06A 1ATKA 3KWZA 2IBIA 2E01A 3CBJA 1CPJA 4FJCA 1YALA 2XU5A 2NQAA 4YYWA 4CZWA 2AYOA 3E1ZB 4WA6A 2DC9A 1XKGA 1AU4A 3HWNA 2JQGR 3WXFA 1MDWA 1AIMA 2PNSA 3RVVA 1AYUA 3PDFA 2BSZA 5J94A 2B1NA 3O1GA 1AU0A 1MIRA 5EGWA 1F2BA 4CDEB 2P0RA 1NQCA 3GCBA 2XU4A 3CBKA 6PADA 2IPPB 2F1GA 3HHAA 3ZUAA 3H89A 4CDFB 3P5UA 1AU2A 5K16A 2GHUA 7PCKA 2DC8A 3V6EA 1POPA 4K7CA 3CH2X 2E00A 3LXSA 3TNXA 1PPNA 4YYRA 4PP1A 3MHSA 8PCHA 5CVNB 2FRAA 4I05A 4P6EA 1CB5A 1CS8A 2FTDA 1DEUA 3NHEA 4YYUA 3BC3A 2PREA 1HUCB 4PP2E 1M6DA 1MHWA 2NQGA 2WBFX 4RY2A 2FRQA 2DCAA 4QRXA 1PIPA 1EWOA 4YV8A 1EWPA 4ZUXU 2PBHA 1O0EA 1PPDA 1U9XA 1AU3A 3H8CA 1MEMA 3I3TA 1NB3A 2CIOA 2DC6A 5FPWA 2NQDB 3BWKA 2VHFA 3QT4A 2C0YA 2AUZA 9PAPA 2HHNA 2G6DA 3MORA 4PADA 3HHIA 4N79A 2AYNA 2HXZA 3RVWA 3BCNA 3H6SA 1Q6KA 1CSBB 1U5IA 1DF0A 2FYEA 4X6IA 1GCBA 4X6JA 2R9MA 1NPZA 3KFQA 3PNRA 3MTNA 1KXRA 2YJCA 2VFBA 1BY8A 4NV7A 3DF0A 1QMYA 2PADA 4MZSA 3HD3A 4QBBA 1ME4A 2OULA 1BGOA 4DMYA 4N4ZA 3N4CA 1YK7A 2FT2A 4BSQA 3IHPA 3LTWA 2AU1A 2DZYA 1TL9A 3ERVA 3S3QA 3BPMA 1GLOA 3D9WA 2AVWA 4I04A 2VFCA 4AXMA 1ZIVA 3V6CA 3LFYA 4W4UA 2G8JA 2Y5BA 1YT7A 1EF7A 1MS6A 1U9WA 1PPOA 2YJ9A 3C9EA 2P7UA 1GX3A 3IV2A 1KFXL 1PADA 4PI3A 4BS6A 1NLJA 1U9VA 3H7DA 3OF8A 3N3GA 4MZOA 3B79A 4I07A 1CQDA 3IEJA 4YYQA 4OELA 4G54A 1K3BB 2E02A 2VHSA 3MHHA 1SP4B 2CB5A 2R9CA 3QSDA 3BPFA 5A24A 2R9NA 1BQIA 2AUXA 3CH3X 3RVXA 2XU1A 2DCCA 2DZZA 3WXGA 4XUIA 2AIMA 5CHTA 3KSEA 2ATOA 1CV8A 1PXVA 2OZ2A 4DMXA 1JQPA 3OVXA 1QDQA 4Q8GA 5CVMA 5F02A 1THEA 2FQ9A 1EWLA 2B1MA 1ZCMA 4BS5A 4XR7A 1VJVA 2R6NA 3P5VA 3IMAA 1PPPA 1W6FA 2FO5A 3P5WA 4QH6A 3PW3A 3KKUA 2HD5A 4OEMA 2R9FA 3PBHA 1GECE 2AS8A 1YK8A 4NV8A 3K9MA 3O0UA 1NB5A 4YVAA 1AYVA 4FIPA 3F5VA 4BQVA 1X9YA 4C5PA 1F2CA 3U8EA 3KX1A 1Y4HA 4YYVA 4HWYA 1TU6A 5JA7A 2P86A 2OP3A 4N8WA 2XU3A 4CDCB 2HH5A 1KHQA 2H7JA 4AXLA 5CHVA 4BPVA 2DJFB 4P6GA 4MSXA 1CVZA 2GFOA 3H8BA 2G7YA 2YJ8A 1PBHA 3KWBX 2G8EA 2YJ2A 2DJGB 3D6SA 1YVBA 1KHPA 2E03A 1ITOA 3M99A 4QRVA 2R9OA 2DCBA 3K24A 2O6XA 2F7DA 1A6RA 2BDLA 1CTEA 1CJLA 3P5XA 4W5CA 5EF4A 5CVOB 1QXPA 4CDDB 3WXEA 1AYWA 1GMYA 3N3KA 4GUZA 2BDZA 4X6HA 4BGFA 3USVA 1E2TA 1AECA 1ICFA 3IOQA 2FUDA 5JH3A 2DCDA 1PCIA 3F75A 4FK5A 1QOLA 1EWMA 1W4TA 2DC7A 1S4VA 3IUTA 1FH0A 2ARYA 3AI8A 2ACTA 2YJBA 1VSNA 1Y08A 3BOWA 2Y6EA 2JQFR 3K8UA 1NL6A 4Q8HA 3OF9A 1SNKA 1ME3A 1U9QX 5PADA 1W5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIS A;  1MEG A;  4QRG A;  1F29 A;  1PE6 A;  1KFU L;  3S3R A;  4W5B A;  1TLO A;  4KLB A;  1F2A A;  3OVZ A;  3KW9 A;  3QJ3 A;  2NQI A;  4YYS A;  1STF E;  1IWD A;  1BP4 A;  3I06 A;  1ATK A;  3KWZ A;  2IBI A;  2E01 A;  3CBJ A;  1CPJ A;  4FJC A;  1YAL A;  2XU5 A;  2NQA A;  4YYW A;  4CZW A;  2AYO A;  3E1Z B;  4WA6 A;  2DC9 A;  1XKG A;  1AU4 A;  3HWN A;  2JQG R;  3WXF A;  1MDW A;  1AIM A;  2PNS A;  3RVV A;  1AYU A;  3PDF A;  5J94 A;  2B1N A;  3O1G A;  1AU0 A;  1MIR A;  5EGW A;  1F2B A;  4CDE B;  2P0R A;  1NQC A;  3GCB A;  2XU4 A;  3CBK A;  6PAD A;  2IPP B;  2F1G A;  3HHA A;  3ZUA A;  3H89 A;  4CDF B;  3P5U A;  1AU2 A;  5K16 A;  2GHU A;  7PCK A;  2DC8 A;  3V6E A;  1POP A;  4K7C A;  3CH2 X;  2E00 A;  3LXS A;  3TNX A;  1PPN A;  4YYR A;  4PP1 A;  3MHS A;  8PCH A;  5CVN B;  2FRA A;  4I05 A;  4P6E A;  1CB5 A;  1CS8 A;  2FTD A;  1DEU A;  3NHE A;  4YYU A;  3BC3 A;  2PRE A;  1HUC B;  4PP2 E;  1M6D A;  1MHW A;  2NQG A;  2WBF X;  4RY2 A;  2FRQ A;  2DCA A;  4QRX A;  1PIP A;  1EWO A;  4YV8 A;  1EWP A;  4ZUX U;  2PBH A;  1O0E A;  1PPD A;  1U9X A;  1AU3 A;  3H8C A;  1MEM A;  3I3T A;  1NB3 A;  2CIO A;  2DC6 A;  5FPW A;  2NQD B;  3BWK A;  2VHF A;  3QT4 A;  2C0Y A;  2AUZ A;  9PAP A;  2HHN A;  2G6D A;  3MOR A;  4PAD A;  3HHI A;  4N79 A;  2AYN A;  2HXZ A;  3RVW A;  3BCN A;  3H6S A;  1Q6K A;  1CSB B;  1U5I A;  1DF0 A;  2FYE A;  4X6I A;  1GCB A;  4X6J A;  2R9M A;  1NPZ A;  3KFQ A;  3PNR A;  3MTN A;  1KXR A;  2YJC A;  1BY8 A;  3DF0 A;  1QMY A;  2PAD A;  4MZS A;  3HD3 A;  4QBB A;  1ME4 A;  2OUL A;  1BGO A;  4DMY A;  4N4Z A;  3N4C A;  1YK7 A;  2FT2 A;  4BSQ A;  3IHP A;  2AU1 A;  2DZY A;  1TL9 A;  3ERV A;  3S3Q A;  3BPM A;  1GLO A;  2AVW A;  4I04 A;  4AXM A;  1ZIV A;  3V6C A;  3LFY A;  4W4U A;  2G8J A;  2Y5B A;  1YT7 A;  1EF7 A;  1MS6 A;  1U9W A;  1PPO A;  2YJ9 A;  3C9E A;  2P7U A;  3IV2 A;  1KFX L;  1PAD A;  4PI3 A;  4BS6 A;  1NLJ A;  1U9V A;  3H7D A;  3OF8 A;  3N3G A;  4MZO A;  3B79 A;  4I07 A;  1CQD A;  3IEJ A;  4YYQ A;  4OEL A;  4G54 A;  1K3B B;  2E02 A;  2VHS A;  3MHH A;  1SP4 B;  2CB5 A;  2R9C A;  3QSD A;  3BPF A;  5A24 A;  2R9N A;  1BQI A;  2AUX A;  3CH3 X;  3RVX A;  2XU1 A;  2DCC A;  2DZZ A;  3WXG A;  4XUI A;  2AIM A;  5CHT A;  3KSE A;  2ATO A;  1CV8 A;  1PXV A;  2OZ2 A;  4DMX A;  1JQP A;  3OVX A;  1QDQ A;  4Q8G A;  5CVM A;  5F02 A;  1THE A;  2FQ9 A;  1EWL A;  2B1M A;  1ZCM A;  4BS5 A;  4XR7 A;  1VJV A;  2R6N A;  3P5V A;  3IMA A;  1PPP A;  2FO5 A;  3P5W A;  4QH6 A;  3PW3 A;  3KKU A;  2HD5 A;  4OEM A;  2R9F A;  3PBH A;  1GEC E;  2AS8 A;  1YK8 A;  3K9M A;  3O0U A;  1NB5 A;  4YVA A;  1AYV A;  4FIP A;  3F5V A;  4BQV A;  1X9Y A;  1F2C A;  3U8E A;  3KX1 A;  1Y4H A;  4YYV A;  4HWY A;  1TU6 A;  5JA7 A;  2P86 A;  2OP3 A;  4N8W A;  2XU3 A;  4CDC B;  2HH5 A;  1KHQ A;  2H7J A;  4AXL A;  5CHV A;  4BPV A;  2DJF B;  4P6G A;  4MSX A;  1CVZ A;  2GFO A;  3H8B A;  2G7Y A;  2YJ8 A;  1PBH A;  3KWB X;  2G8E A;  2YJ2 A;  2DJG B;  3D6S A;  1YVB A;  1KHP A;  2E03 A;  1ITO A;  3M99 A;  4QRV A;  2R9O A;  2DCB A;  3K24 A;  2O6X A;  2F7D A;  1A6R A;  2BDL A;  1CTE A;  1CJL A;  3P5X A;  4W5C A;  5EF4 A;  5CVO B;  1QXP A;  4CDD B;  3WXE A;  1AYW A;  1GMY A;  3N3K A;  2BDZ A;  4X6H A;  3USV A;  1AEC A;  1ICF A;  3IOQ A;  2FUD A;  5JH3 A;  2DCD A;  1PCI A;  3F75 A;  4FK5 A;  1QOL A;  1EWM A;  2DC7 A;  1S4V A;  3IUT A;  1FH0 A;  2ARY A;  3AI8 A;  2ACT A;  2YJB A;  1VSN A;  1Y08 A;  3BOW A;  2Y6E A;  2JQF R;  3K8U A;  1NL6 A;  4Q8H A;  3OF9 A;  1SNK A;  1ME3 A;  1U9Q X;  5PAD A; 
#chains in the Genus database with same CATH topology
 3OIS A;  1MEG A;  4QRG A;  1F29 A;  1PE6 A;  1KFU L;  3S3R A;  4W5B A;  1TLO A;  4KLB A;  1F2A A;  5KO3 A;  3OVZ A;  3O65 A;  3KW9 A;  3PRM A;  2NQI A;  3QJ3 A;  4YYS A;  1PVJ A;  1STF E;  2FE8 A;  1IWD A;  1BP4 A;  3I06 A;  1ATK A;  3KWZ A;  2IBI A;  2E01 A;  3CBJ A;  1CPJ A;  4FJC A;  1YAL A;  2XU5 A;  2NQA A;  4BOU A;  4YYW A;  4CZW A;  2AYO A;  3E1Z B;  4WA6 A;  2DC9 A;  1XKG A;  1AU4 A;  3HWN A;  2JQG R;  3B21 A;  3WXF A;  1MDW A;  1AIM A;  2PNS A;  3RVV A;  1AYU A;  3PDF A;  3W31 A;  5J94 A;  4MI7 A;  2B1N A;  5JZE A;  3O1G A;  1AU0 A;  1MIR A;  5EGW A;  1F2B A;  4CDE B;  2P0R A;  1NQC A;  2AGA A;  2Z84 A;  4R3D A;  3GCB A;  2XU4 A;  3ZNH A;  3CBK A;  6PAD A;  2IPP B;  2F1G A;  3HHA A;  3ZUA A;  3H89 A;  4CDF B;  3P5U A;  1AU2 A;  5K16 A;  2GHU A;  3BY4 A;  4OVZ B;  3TMP A;  7PCK A;  2DC8 A;  4OW0 A;  3V6E A;  4A5U A;  1POP A;  4K7C A;  4OVZ A;  3CH2 X;  1UKF A;  2E00 A;  3LXS A;  3TNX A;  3PT2 A;  1PPN A;  4YYR A;  4PP1 A;  3MHS A;  8PCH A;  2FRA A;  4I05 A;  5CVN B;  4P6E A;  1CB5 A;  1CS8 A;  2FTD A;  1DEU A;  3NHE A;  3MP2 A;  4YYU A;  3BC3 A;  4RNA A;  2PRE A;  1HUC B;  4PP2 E;  1M6D A;  1MHW A;  2NQG A;  2WBF X;  4RY2 A;  2FRQ A;  5EZS A;  2DCA A;  4QRX A;  1PIP A;  1EWO A;  4YV8 A;  1EWP A;  3PHU A;  4ZUX U;  2PBH A;  1O0E A;  1PPD A;  1U9X A;  1AU3 A;  3H8C A;  1MEM A;  3I3T A;  1NB3 A;  2CIO A;  4MM3 B;  2DC6 A;  4REZ A;  5FPW A;  2NQD B;  2J7Q C;  3BWK A;  2VHF A;  3QT4 A;  4RF1 A;  2C0Y A;  3RNV A;  2AUZ A;  3IFU A;  2BTW A;  3E9S A;  9PAP A;  2HHN A;  2G6D A;  3MOR A;  4PAD A;  3OQC A;  4BOZ A;  2DOS A;  3HHI A;  4N79 A;  2AYN A;  2HXZ A;  3TRK A;  3MTV A;  3RVW A;  4PT5 A;  3BCN A;  3H6S A;  1Q6K A;  1CSB B;  1U5I A;  1DF0 A;  2FYE A;  3W30 A;  3PHW A;  4X6I A;  3BBA A;  1GCB A;  4X6J A;  2R9M A;  1NPZ A;  1YZB A;  3KFQ A;  3PNR A;  3MTN A;  1KXR A;  2YJC A;  1BY8 A;  3DF0 A;  4RKX A;  1QMY A;  2PAD A;  4MZS A;  3HD3 A;  4QBB A;  1ME4 A;  2UZJ A;  2OUL A;  1BGO A;  4DMY A;  4N4Z A;  3N4C A;  1YK7 A;  2FT2 A;  4BSQ A;  3IHP A;  3C0R A;  2AU1 A;  2DZY A;  1TL9 A;  3ERV A;  3S3Q A;  3BPM A;  1GLO A;  2AVW A;  4I04 A;  4AXM A;  1ZIV A;  3V6C A;  3LFY A;  5E6J A;  4W4U A;  4IUM A;  2G8J A;  2Y5B A;  1YT7 A;  1EF7 A;  1MS6 A;  1U9W A;  1PPO A;  2YJ9 A;  3C9E A;  2P7U A;  3PSE A;  4D8B A;  3IV2 A;  1KFX L;  1PAD A;  4PI3 A;  4BS6 A;  2JRI A;  1NLJ A;  1U9V A;  3H7D A;  3PRP A;  3OF8 A;  3N3G A;  4MZO A;  3B79 A;  4I07 A;  1CQD A;  3IEJ A;  4WUR A;  4YYQ A;  4OEL A;  4G54 A;  1K3B B;  4D8I A;  2E02 A;  4RF0 A;  2VHS A;  3MHH A;  1SP4 B;  2CB5 A;  2R9C A;  3QSD A;  3BPF A;  5A24 A;  2R9N A;  3PHX A;  1BQI A;  2AUX A;  3CH3 X;  3RVX A;  2XU1 A;  2DCC A;  2DZZ A;  3WXG A;  4XUI A;  2AIM A;  4XZX A;  5CHT A;  3KSE A;  2ATO A;  1CV8 A;  4P16 A;  1PXV A;  2OZ2 A;  4ZTB A;  5EZQ A;  4DMX A;  1JQP A;  3OVX A;  1QDQ A;  4Q8G A;  5CVM A;  5F02 A;  1THE A;  2FQ9 A;  1EWL A;  2B1M A;  1ZCM A;  4BS5 A;  4XR7 A;  1VJV A;  2R6N A;  3P5V A;  3IMA A;  1PPP A;  2FO5 A;  3P5W A;  4IP3 A;  4QH6 A;  3PW3 A;  3KKU A;  2HD5 A;  4OEM A;  2R9F A;  3PBH A;  1GEC E;  2AS8 A;  1YK8 A;  3K9M A;  3O0U A;  1NB5 A;  4YVA A;  1AYV A;  4BOQ A;  4FIP A;  3F5V A;  4BQV A;  1DKI A;  1X9Y A;  1F2C A;  2BU3 A;  3U8E A;  3KX1 A;  1Y4H A;  4YYV A;  4HWY A;  1TU6 A;  5JA7 A;  2P86 A;  2OP3 A;  4N8W A;  2BTW B;  2XU3 A;  4CDC B;  2HH5 A;  4BOS A;  1KHQ A;  2H7J A;  4M0W A;  4AXL A;  5CHV A;  4BPV A;  2DJF B;  4P6G A;  4MSX A;  1CVZ A;  2GFO A;  3H8B A;  2G7Y A;  2YJ8 A;  1PBH A;  3KWB X;  2G8E A;  2YJ2 A;  2DJG B;  3D6S A;  1YVB A;  3MJ5 A;  1KHP A;  2E03 A;  1ITO A;  3M99 A;  4QRV A;  2R9O A;  2DCB A;  3K24 A;  2O6X A;  2F7D A;  1A6R A;  2BDL A;  1CTE A;  1CJL A;  3P5X A;  4D8E A;  4W5C A;  3BB7 A;  5EF4 A;  5CVO B;  1QXP A;  4CDD B;  3WXE A;  1AYW A;  1GMY A;  3N3K A;  2BDZ A;  4X6H A;  3USV A;  4BOP A;  1AEC A;  1ICF A;  3IOQ A;  2FUD A;  5JH3 A;  2DCD A;  1PCI A;  3F75 A;  4FK5 A;  4GUA A;  1QOL A;  1EWM A;  2JTC A;  2DC7 A;  1S4V A;  3IUT A;  1FH0 A;  2ARY A;  2J7Q A;  3AI8 A;  2ACT A;  2YJB A;  1VSN A;  1Y08 A;  3BOW A;  2Y6E A;  2JQF R;  4HXD B;  3K8U A;  1NL6 A;  4Q8H A;  3OF9 A;  2HWK A;  1SNK A;  1ME3 A;  1U9Q X;  5PAD A; 
#chains in the Genus database with same CATH homology
 3OIS A;  1MEG A;  4QRG A;  1F29 A;  1PE6 A;  1KFU L;  3S3R A;  4W5B A;  1TLO A;  4KLB A;  1F2A A;  3OVZ A;  3KW9 A;  3QJ3 A;  2NQI A;  4YYS A;  4B55 A;  1STF E;  1IWD A;  1BP4 A;  3I06 A;  1ATK A;  3KWZ A;  2IBI A;  2E01 A;  3CBJ A;  1CPJ A;  4FJC A;  1YAL A;  2XU5 A;  2NQA A;  4YYW A;  4CZW A;  2AYO A;  3E1Z B;  4WA6 A;  2DC9 A;  1XKG A;  1AU4 A;  3HWN A;  2JQG R;  3WXF A;  1MDW A;  1AIM A;  2PNS A;  3RVV A;  1AYU A;  3PDF A;  2BSZ A;  5J94 A;  2B1N A;  3O1G A;  1AU0 A;  1MIR A;  5EGW A;  1F2B A;  4CDE B;  2P0R A;  1NQC A;  3GCB A;  2XU4 A;  3CBK A;  6PAD A;  2IPP B;  2F1G A;  3HHA A;  3ZUA A;  3H89 A;  4CDF B;  3P5U A;  1AU2 A;  5K16 A;  2GHU A;  7PCK A;  2DC8 A;  3V6E A;  1POP A;  4K7C A;  3CH2 X;  2E00 A;  3LXS A;  3TNX A;  1PPN A;  4YYR A;  4PP1 A;  3MHS A;  8PCH A;  5CVN B;  2FRA A;  4I05 A;  4P6E A;  1CB5 A;  1CS8 A;  2FTD A;  1DEU A;  3NHE A;  4YYU A;  3BC3 A;  2PRE A;  1HUC B;  4PP2 E;  1M6D A;  1MHW A;  2NQG A;  2WBF X;  4RY2 A;  2FRQ A;  2DCA A;  4QRX A;  1PIP A;  1EWO A;  4YV8 A;  1EWP A;  4ZUX U;  2PBH A;  1O0E A;  1PPD A;  1U9X A;  1AU3 A;  3H8C A;  1MEM A;  3I3T A;  1NB3 A;  2CIO A;  2DC6 A;  5FPW A;  2NQD B;  3BWK A;  2VHF A;  3QT4 A;  2C0Y A;  2AUZ A;  9PAP A;  2HHN A;  2G6D A;  3MOR A;  4PAD A;  3HHI A;  4N79 A;  2AYN A;  2HXZ A;  3RVW A;  3BCN A;  3H6S A;  1Q6K A;  1CSB B;  1U5I A;  1DF0 A;  2FYE A;  4X6I A;  1GCB A;  4X6J A;  2R9M A;  1NPZ A;  3KFQ A;  3PNR A;  3MTN A;  1KXR A;  2YJC A;  2VFB A;  1BY8 A;  4NV7 A;  3DF0 A;  1QMY A;  2PAD A;  4MZS A;  3HD3 A;  4QBB A;  1ME4 A;  2OUL A;  1BGO A;  4DMY A;  4N4Z A;  3N4C A;  1YK7 A;  2FT2 A;  4BSQ A;  3IHP A;  3LTW A;  2AU1 A;  2DZY A;  1TL9 A;  3ERV A;  3S3Q A;  3BPM A;  1GLO A;  3D9W A;  2AVW A;  4I04 A;  2VFC A;  4AXM A;  1ZIV A;  3V6C A;  3LFY A;  4W4U A;  2G8J A;  2Y5B A;  1YT7 A;  1EF7 A;  1MS6 A;  1U9W A;  1PPO A;  2YJ9 A;  3C9E A;  2P7U A;  1GX3 A;  3IV2 A;  1KFX L;  1PAD A;  4PI3 A;  4BS6 A;  1NLJ A;  1U9V A;  3H7D A;  3OF8 A;  3N3G A;  4MZO A;  3B79 A;  4I07 A;  1CQD A;  3IEJ A;  4YYQ A;  4OEL A;  4G54 A;  1K3B B;  2E02 A;  2VHS A;  3MHH A;  1SP4 B;  2CB5 A;  2R9C A;  3QSD A;  3BPF A;  5A24 A;  2R9N A;  1BQI A;  2AUX A;  3CH3 X;  3RVX A;  2XU1 A;  2DCC A;  2DZZ A;  3WXG A;  4XUI A;  2AIM A;  5CHT A;  3KSE A;  2ATO A;  1CV8 A;  1PXV A;  2OZ2 A;  4DMX A;  1JQP A;  3OVX A;  1QDQ A;  4Q8G A;  5CVM A;  5F02 A;  1THE A;  2FQ9 A;  1EWL A;  2B1M A;  1ZCM A;  4BS5 A;  4XR7 A;  1VJV A;  2R6N A;  3P5V A;  3IMA A;  1PPP A;  1W6F A;  2FO5 A;  3P5W A;  4QH6 A;  3PW3 A;  3KKU A;  2HD5 A;  4OEM A;  2R9F A;  3PBH A;  1GEC E;  2AS8 A;  1YK8 A;  4NV8 A;  3K9M A;  3O0U A;  1NB5 A;  4YVA A;  1AYV A;  4FIP A;  3F5V A;  4BQV A;  1X9Y A;  4C5P A;  1F2C A;  3U8E A;  3KX1 A;  1Y4H A;  4YYV A;  4HWY A;  1TU6 A;  5JA7 A;  2P86 A;  2OP3 A;  4N8W A;  2XU3 A;  4CDC B;  2HH5 A;  1KHQ A;  2H7J A;  4AXL A;  5CHV A;  4BPV A;  2DJF B;  4P6G A;  4MSX A;  1CVZ A;  2GFO A;  3H8B A;  2G7Y A;  2YJ8 A;  1PBH A;  3KWB X;  2G8E A;  2YJ2 A;  2DJG B;  3D6S A;  1YVB A;  1KHP A;  2E03 A;  1ITO A;  3M99 A;  4QRV A;  2R9O A;  2DCB A;  3K24 A;  2O6X A;  2F7D A;  1A6R A;  2BDL A;  1CTE A;  1CJL A;  3P5X A;  4W5C A;  5EF4 A;  5CVO B;  1QXP A;  4CDD B;  3WXE A;  1AYW A;  1GMY A;  3N3K A;  4GUZ A;  2BDZ A;  4X6H A;  4BGF A;  3USV A;  1E2T A;  1AEC A;  1ICF A;  3IOQ A;  2FUD A;  5JH3 A;  2DCD A;  1PCI A;  3F75 A;  4FK5 A;  1QOL A;  1EWM A;  1W4T A;  2DC7 A;  1S4V A;  3IUT A;  1FH0 A;  2ARY A;  3AI8 A;  2ACT A;  2YJB A;  1VSN A;  1Y08 A;  3BOW A;  2Y6E A;  2JQF R;  3K8U A;  1NL6 A;  4Q8H A;  3OF9 A;  1SNK A;  1ME3 A;  1U9Q X;  5PAD A;  1W5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...