2DJGB

Re-determination of the native structure of human dipeptidyl peptidase i (cathepsin c)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
b'LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl-peptidase 1
publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 161
sequence length 161
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2djgB01
2FYEA 3K8UA 1GECE 2FQ9A 1PE6A 5CVMA 3QSDA 1F2AA 3F5VA 2DC8A 4OEMA 1MHWA 1PXVA 2Y6EA 4X6JA 3S3RA 1QDQA 4HWYA 1XKGA 3O0UA 4WA6A 1DF0A 3IMAA 1AIMA 3CBJA 1CS8A 3BWKA 2FRAA 2DJGB 1EF7A 3MORA 2R9FA 4FIPA 2R9NA 2OP3A 1JQPA 2DC7A 2DCCA 1PADA 2HH5A 3GCBA 1PBHA 4Q8HA 4OELA 2AUZA 1YVBA 3M99A 1QOLA 1TU6A 4W5CA 3MHSA 5JH3A 3OVZA 1SP4B 4PI3A 4QRXA 3KX1A 2PNSA 2Y5BA 3C9EA 4YV8A 1PPNA 4CZWA 2OULA 1X9YA 2PBHA 1GCBA 3BOWA 4XUIA 2CB5A 3I06A 1U5IA 2FUDA 2GHUA 4DMYA 3ERVA 1Y08A 2AIMA 4MZSA 1PPOA 2CIOA 2FTDA 1CQDA 3E1ZB 4QRGA 2NQGA 4DMXA 4BS5A 3AI8A 1NLJA 2C0YA 3MTNA 1A6RA 3K9MA 2XU4A 2E03A 1EWLA 2AVWA 4PP2E 5CVNB 1ATKA 2E02A 3U8EA 3BC3A 3DF0A 1BY8A 3N4CA 1Q6KA 1MDWA 1PPDA 2VHSA 2BDZA 3HHIA 2YJ2A 4QH6A 2OZ2A 2YJ9A 2ARYA 5PADA 1KHPA 3WXEA 5JA7A 1MEMA 4PP1A 3TNXA 2PADA 1Y4HA 2H7JA 1CTEA 2E00A 1ME4A 1PPPA 2FRQA 3V6EA 3OVXA 1U9XA 1NB5A 4X6HA 4CDFB 3RVXA 4I07A 4P6GA 2G8JA 1KXRA 3B79A 3RVVA 1GLOA 3LXSA 1KFXL 3O1GA 1U9QX 3P5WA 4KLBA 8PCHA 2FO5A 3MHHA 1CV8A 2DCDA 1NQCA 2ACTA 1U9VA 3QT4A 1MEGA 3H8CA 2G8EA 3ZUAA 1QMYA 3BPFA 1POPA 2IBIA 1ZIVA 2DC9A 4YYQA 3BPMA 1KHQA 4K7CA 2FT2A 2JQGR 4N79A 3OF9A 5CHVA 4BS6A 2R9MA 2WBFX 4AXMA 4G54A 1ITOA 1F2CA 3V6CA 3H7DA 2NQDB 4MSXA 2DC6A 2DZZA 1EWPA 3QJ3A 4N4ZA 5K16A 5CVOB 5FPWA 2BDLA 1THEA 3OF8A 2ATOA 2HHNA 2HXZA 1S4VA 1AECA 3PNRA 9PAPA 1U9WA 2VHFA 3P5UA 3KSEA 3PBHA 1PCIA 4CDEB 1SNKA 4RY2A 1HUCB 1TL9A 2P7UA 1KFUL 1YK7A 1YT7A 4W4UA 4FK5A 3P5VA 3HD3A 2AU1A 4I04A 4W5BA 4CDCB 3BCNA 3LFYA 2O6XA 2IPPB 1AU4A 4AXLA 1EWOA 1BGOA 3KWZA 1F29A 2AS8A 1NL6A 2B1NA 3IHPA 2XU5A 2GFOA 1PIPA 1EWMA 2R9OA 1CJLA 3H89A 3KKUA 3IEJA 1MIRA 3F75A 2P86A 1VSNA 2DJFB 2XU1A 3PW3A 3I3TA 4I05A 1IWDA 1AU0A 3H8BA 2F7DA 2XU3A 3CH2X 3CBKA 3WXFA 4BPVA 3CH3X 2G6DA 1AYWA 4Q8GA 5A24A 7PCKA 3IUTA 1AYUA 2F1GA 2DZYA 1AU2A 1CVZA 5F02A 1ZCMA 4MZOA 4YYWA 3RVWA 2AUXA 2R6NA 3KWBX 3PDFA 6PADA 2HD5A 1NB3A 2AYNA 4N8WA 1STFE 2P0RA 1MS6A 1DEUA 3IV2A 5CHTA 4YYVA 3HWNA 2E01A 3P5XA 4ZUXU 1FH0A 3D6SA 3KFQA 1AYVA 4YYRA 4CDDB 1BP4A 5EF4A 2PREA 4QBBA 3S3QA 3N3KA 1VJVA 2NQIA 2B1MA 3OISA 1F2BA 4FJCA 3K24A 4QRVA 3KW9A 4YVAA 4XR7A 2YJ8A 2R9CA 3N3GA 3WXGA 1CB5A 1M6DA 3USVA 1YALA 4X6IA 4BSQA 2AYOA 1O0EA 3HHAA 4PADA 1NPZA 1BQIA 5J94A 4BQVA 1CPJA 1GMYA 3H6SA 2DCAA 1CSBB 2JQFR 4P6EA 1ME3A 1TLOA 1AU3A 1K3BB 3NHEA 4YYUA 2YJCA 2G7YA 4YYSA 2YJBA 2NQAA 3IOQA 1ICFA 2DCBA 5EGWA 1QXPA 1YK8A
chains in the Genus database with same CATH superfamily
2FYEA 3K8UA 1GECE 2FQ9A 1PE6A 4M0WA 5CVMA 3QSDA 3PHXA 4BOSA 1F2AA 3F5VA 2DC8A 4OEMA 1MHWA 1PXVA 2Z84A 2Y6EA 4R3DA 4X6JA 3S3RA 1QDQA 4HWYA 1XKGA 3O0UA 4WA6A 1DF0A 3IMAA 3BB7A 5E6JA 4D8BA 1AIMA 3CBJA 1CS8A 3BWKA 2FRAA 2DJGB 1EF7A 3MORA 2R9FA 4FIPA 2R9NA 4OVZA 4RNAA 2OP3A 1JQPA 2DC7A 2DCCA 1PADA 2HH5A 3GCBA 1PBHA 1PVJA 3B21A 4Q8HA 4OELA 2AUZA 1YVBA 2JRIA 3M99A 1QOLA 1TU6A 4W5CA 3MHSA 5JH3A 3OVZA 1SP4B 4PI3A 4QRXA 3KX1A 2PNSA 2Y5BA 5EZQA 2HWKA 3C9EA 4YV8A 1PPNA 3E9SA 2OULA 4CZWA 1X9YA 2PBHA 1GCBA 3BOWA 4XUIA 2CB5A 3I06A 1U5IA 4BOQA 2FUDA 2GHUA 4RF0A 4DMYA 3ERVA 1Y08A 2AIMA 4MZSA 1PPOA 2CIOA 2FTDA 1CQDA 2J7QA 3E1ZB 4QRGA 2NQGA 4DMXA 4BS5A 3AI8A 1NLJA 2C0YA 3MTNA 1A6RA 3K9MA 2XU4A 2E03A 1EWLA 4BOUA 2AVWA 4PP2E 4PT5A 5CVNB 1ATKA 2E02A 3U8EA 3BY4A 3BC3A 3DF0A 1BY8A 1YZBA 1Q6KA 3N4CA 2FE8A 1MDWA 1PPDA 3W31A 2VHSA 2BDZA 3HHIA 2YJ2A 1DKIA 4QH6A 2OZ2A 3W30A 2YJ9A 2ARYA 5PADA 1KHPA 3WXEA 5JA7A 1MEMA 3MTVA 4PP1A 3TNXA 2PADA 1Y4HA 2H7JA 3MP2A 1CTEA 2E00A 1ME4A 1PPPA 2FRQA 3V6EA 4IP3A 3OVXA 1U9XA 1NB5A 4X6HA 4CDFB 3PSEA 3RVXA 4I07A 4P6GA 2G8JA 1KXRA 3B79A 3RVVA 1GLOA 3LXSA 3O1GA 1KFXL 1U9QX 3P5WA 2BU3A 4KLBA 8PCHA 2FO5A 2AGAA 3MHHA 1CV8A 2DCDA 1NQCA 2ACTA 1U9VA 3QT4A 1MEGA 3H8CA 3BBAA 2G8EA 3ZUAA 1QMYA 3BPFA 3O65A 3PRMA 3PHWA 1POPA 2IBIA 1ZIVA 2DC9A 4YYQA 3BPMA 1KHQA 4K7CA 2FT2A 2JQGR 4N79A 3OF9A 4WURA 5CHVA 4BS6A 2R9MA 2WBFX 4RF1A 3OQCA 4AXMA 4IUMA 4G54A 1ITOA 1F2CA 3V6CA 3H7DA 2NQDB 4MSXA 2DC6A 2DZZA 1EWPA 3QJ3A 4REZA 4N4ZA 5K16A 4P16A 5CVOB 5FPWA 2BDLA 1THEA 3OF8A 2ATOA 4ZTBA 2HHNA 3IFUA 2HXZA 1S4VA 1AECA 3PNRA 9PAPA 1U9WA 2VHFA 5KO3A 3P5UA 4D8EA 3RNVA 3KSEA 3PBHA 4MM3B 1PCIA 4CDEB 1SNKA 4MI7A 4RY2A 1HUCB 1TL9A 2P7UA 1KFUL 1YK7A 1YT7A 4W4UA 4FK5A 3P5VA 3HD3A 2AU1A 3PHUA 4I04A 4W5BA 4XZXA 2BTWB 4CDCB 3BCNA 4HXDB 3LFYA 2O6XA 2IPPB 1AU4A 4AXLA 1EWOA 1BGOA 3TMPA 3KWZA 4D8IA 1F29A 2AS8A 1NL6A 2B1NA 3PT2A 5JZEA 3IHPA 2XU5A 2GFOA 1PIPA 4A5UA 1EWMA 2R9OA 1CJLA 3H89A 3KKUA 3IEJA 4BOPA 1MIRA 3F75A 2P86A 1VSNA 5EZSA 4OW0A 2DJFB 2UZJA 2XU1A 3PW3A 3I3TA 4I05A 1IWDA 1AU0A 3H8BA 2F7DA 2XU3A 3CH2X 3CBKA 3WXFA 4BPVA 3CH3X 2G6DA 1AYWA 4Q8GA 2J7QC 5A24A 7PCKA 3IUTA 1AYUA 2F1GA 2DZYA 1AU2A 1CVZA 5F02A 1ZCMA 4RKXA 4MZOA 4YYWA 3RVWA 2AUXA 2R6NA 3KWBX 3PDFA 6PADA 2HD5A 3TRKA 1NB3A 2AYNA 4N8WA 1STFE 2P0RA 3ZNHA 1MS6A 1DEUA 3IV2A 5CHTA 4YYVA 3HWNA 2E01A 4OVZB 3P5XA 4ZUXU 1FH0A 3D6SA 3KFQA 1AYVA 2BTWA 4YYRA 3C0RA 4CDDB 1BP4A 5EF4A 2PREA 4QBBA 3S3QA 3N3KA 1VJVA 2NQIA 2B1MA 3OISA 1F2BA 4FJCA 3K24A 4QRVA 3KW9A 4YVAA 4XR7A 4BOZA 2YJ8A 2R9CA 1UKFA 3N3GA 4GUAA 3WXGA 1CB5A 1M6DA 3USVA 3PRPA 1YALA 4X6IA 4BSQA 2AYOA 1O0EA 3HHAA 4PADA 1NPZA 1BQIA 5J94A 4BQVA 2DOSA 1CPJA 1GMYA 3MJ5A 3H6SA 2DCAA 1CSBB 2JQFR 4P6EA 1ME3A 1TLOA 1AU3A 1K3BB 3NHEA 4YYUA 2YJCA 2G7YA 2JTCA 4YYSA 2YJBA 2NQAA 3IOQA 1ICFA 2DCBA 5EGWA 1QXPA 1YK8A
chains in the Genus database with same CATH topology
2FYEA 3K8UA 1GECE 2FQ9A 1PE6A 5CVMA 3QSDA 4NV7A 1F2AA 3F5VA 2DC8A 4OEMA 1MHWA 1PXVA 2Y6EA 4X6JA 3S3RA 1QDQA 4HWYA 1XKGA 3O0UA 4WA6A 1DF0A 3IMAA 1AIMA 3CBJA 1CS8A 3BWKA 2FRAA 2DJGB 1EF7A 3MORA 2R9FA 4FIPA 2R9NA 2OP3A 1GX3A 1JQPA 2DC7A 4NV8A 2DCCA 1PADA 2HH5A 3GCBA 1PBHA 4Q8HA 4OELA 2AUZA 1YVBA 3M99A 1QOLA 1TU6A 4W5CA 3MHSA 5JH3A 3OVZA 1SP4B 4PI3A 4QRXA 3KX1A 3LTWA 2PNSA 2Y5BA 3C9EA 4YV8A 1PPNA 4CZWA 2OULA 1X9YA 2VFBA 2PBHA 1GCBA 3BOWA 4XUIA 2CB5A 3I06A 1U5IA 2FUDA 2GHUA 4DMYA 3ERVA 1Y08A 2AIMA 4MZSA 1PPOA 2CIOA 2FTDA 1CQDA 3E1ZB 4QRGA 2NQGA 4DMXA 4BS5A 3AI8A 1NLJA 2C0YA 3MTNA 1A6RA 3K9MA 2XU4A 2E03A 1EWLA 2AVWA 4PP2E 5CVNB 1ATKA 2E02A 3U8EA 3BC3A 3DF0A 1BY8A 3N4CA 1Q6KA 1MDWA 1PPDA 2VHSA 2BDZA 3HHIA 2YJ2A 4QH6A 2OZ2A 2YJ9A 2ARYA 2VFCA 5PADA 1KHPA 3WXEA 5JA7A 1MEMA 4PP1A 3TNXA 2PADA 1Y4HA 2H7JA 1CTEA 2E00A 1ME4A 1PPPA 2FRQA 3V6EA 3OVXA 1U9XA 1NB5A 4X6HA 4CDFB 3RVXA 4I07A 4P6GA 2G8JA 1KXRA 3B79A 3RVVA 1GLOA 3LXSA 1KFXL 3O1GA 1U9QX 3P5WA 4KLBA 8PCHA 1W6FA 2FO5A 3MHHA 1CV8A 2DCDA 1NQCA 2ACTA 4BGFA 1U9VA 3QT4A 1MEGA 3H8CA 2G8EA 3ZUAA 1QMYA 3BPFA 1POPA 2BSZA 2IBIA 1ZIVA 2DC9A 4YYQA 3BPMA 1KHQA 4K7CA 2FT2A 2JQGR 4N79A 3OF9A 5CHVA 4BS6A 2R9MA 2WBFX 4AXMA 4G54A 1ITOA 1F2CA 3V6CA 3H7DA 2NQDB 4MSXA 2DC6A 2DZZA 1EWPA 3QJ3A 4N4ZA 5K16A 5CVOB 5FPWA 2BDLA 1THEA 3OF8A 2ATOA 1E2TA 2HHNA 2HXZA 1S4VA 1AECA 3PNRA 9PAPA 1U9WA 2VHFA 3P5UA 3KSEA 3PBHA 1PCIA 4CDEB 1SNKA 4RY2A 1HUCB 1TL9A 2P7UA 1KFUL 1W5RA 1YK7A 1YT7A 4W4UA 4FK5A 3P5VA 3HD3A 2AU1A 4I04A 4W5BA 4CDCB 3BCNA 3LFYA 2O6XA 2IPPB 1AU4A 4AXLA 1EWOA 1BGOA 3KWZA 1W4TA 3D9WA 1F29A 2AS8A 1NL6A 2B1NA 4GUZA 3IHPA 2XU5A 2GFOA 1PIPA 1EWMA 2R9OA 1CJLA 3H89A 3KKUA 3IEJA 1MIRA 3F75A 2P86A 1VSNA 2DJFB 2XU1A 3PW3A 3I3TA 4I05A 1IWDA 1AU0A 3H8BA 2F7DA 2XU3A 3CH2X 3CBKA 3WXFA 4BPVA 3CH3X 2G6DA 1AYWA 4Q8GA 5A24A 7PCKA 3IUTA 1AYUA 2F1GA 2DZYA 1AU2A 1CVZA 5F02A 1ZCMA 4MZOA 4YYWA 3RVWA 2AUXA 2R6NA 3KWBX 3PDFA 6PADA 2HD5A 1NB3A 2AYNA 4N8WA 1STFE 2P0RA 4B55A 1MS6A 4C5PA 1DEUA 3IV2A 5CHTA 4YYVA 3HWNA 2E01A 3P5XA 4ZUXU 1FH0A 3D6SA 3KFQA 1AYVA 4YYRA 4CDDB 1BP4A 5EF4A 2PREA 4QBBA 3S3QA 3N3KA 1VJVA 2NQIA 2B1MA 3OISA 1F2BA 4FJCA 3K24A 4QRVA 3KW9A 4YVAA 4XR7A 2YJ8A 2R9CA 3N3GA 3WXGA 1CB5A 1M6DA 3USVA 1YALA 4X6IA 4BSQA 2AYOA 1O0EA 3HHAA 4PADA 1NPZA 1BQIA 5J94A 4BQVA 1CPJA 1GMYA 3H6SA 2DCAA 1CSBB 2JQFR 4P6EA 1ME3A 1TLOA 1AU3A 1K3BB 3NHEA 4YYUA 2YJCA 2G7YA 4YYSA 2YJBA 2NQAA 3IOQA 1ICFA 2DCBA 5EGWA 1QXPA 1YK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYE A;  3K8U A;  1GEC E;  2FQ9 A;  1PE6 A;  5CVM A;  3QSD A;  1F2A A;  3F5V A;  2DC8 A;  4OEM A;  1MHW A;  1PXV A;  2Y6E A;  4X6J A;  3S3R A;  1QDQ A;  4HWY A;  1XKG A;  3O0U A;  4WA6 A;  1DF0 A;  3IMA A;  1AIM A;  3CBJ A;  1CS8 A;  3BWK A;  2FRA A;  2DJG B;  1EF7 A;  3MOR A;  2R9F A;  4FIP A;  2R9N A;  2OP3 A;  1JQP A;  2DC7 A;  2DCC A;  1PAD A;  2HH5 A;  3GCB A;  1PBH A;  4Q8H A;  4OEL A;  2AUZ A;  1YVB A;  3M99 A;  1QOL A;  1TU6 A;  4W5C A;  3MHS A;  5JH3 A;  3OVZ A;  1SP4 B;  4PI3 A;  4QRX A;  3KX1 A;  2PNS A;  2Y5B A;  3C9E A;  4YV8 A;  1PPN A;  4CZW A;  2OUL A;  1X9Y A;  2PBH A;  1GCB A;  3BOW A;  4XUI A;  2CB5 A;  3I06 A;  1U5I A;  2FUD A;  2GHU A;  4DMY A;  3ERV A;  1Y08 A;  2AIM A;  4MZS A;  1PPO A;  2CIO A;  2FTD A;  1CQD A;  3E1Z B;  4QRG A;  2NQG A;  4DMX A;  4BS5 A;  3AI8 A;  1NLJ A;  2C0Y A;  3MTN A;  1A6R A;  3K9M A;  2XU4 A;  2E03 A;  1EWL A;  2AVW A;  4PP2 E;  5CVN B;  1ATK A;  2E02 A;  3U8E A;  3BC3 A;  3DF0 A;  1BY8 A;  3N4C A;  1Q6K A;  1MDW A;  1PPD A;  2VHS A;  2BDZ A;  3HHI A;  2YJ2 A;  4QH6 A;  2OZ2 A;  2YJ9 A;  2ARY A;  5PAD A;  1KHP A;  3WXE A;  5JA7 A;  1MEM A;  4PP1 A;  3TNX A;  2PAD A;  1Y4H A;  2H7J A;  1CTE A;  2E00 A;  1ME4 A;  1PPP A;  2FRQ A;  3V6E A;  3OVX A;  1U9X A;  1NB5 A;  4X6H A;  4CDF B;  3RVX A;  4I07 A;  4P6G A;  2G8J A;  1KXR A;  3B79 A;  3RVV A;  1GLO A;  3LXS A;  1KFX L;  3O1G A;  1U9Q X;  3P5W A;  4KLB A;  8PCH A;  2FO5 A;  3MHH A;  1CV8 A;  2DCD A;  1NQC A;  2ACT A;  1U9V A;  3QT4 A;  1MEG A;  3H8C A;  2G8E A;  3ZUA A;  1QMY A;  3BPF A;  1POP A;  2IBI A;  1ZIV A;  2DC9 A;  4YYQ A;  3BPM A;  1KHQ A;  4K7C A;  2FT2 A;  2JQG R;  4N79 A;  3OF9 A;  5CHV A;  4BS6 A;  2R9M A;  2WBF X;  4AXM A;  4G54 A;  1ITO A;  1F2C A;  3V6C A;  3H7D A;  2NQD B;  4MSX A;  2DC6 A;  2DZZ A;  1EWP A;  3QJ3 A;  4N4Z A;  5K16 A;  5CVO B;  5FPW A;  2BDL A;  1THE A;  3OF8 A;  2ATO A;  2HHN A;  2HXZ A;  1S4V A;  1AEC A;  3PNR A;  9PAP A;  1U9W A;  2VHF A;  3P5U A;  3KSE A;  3PBH A;  1PCI A;  4CDE B;  1SNK A;  4RY2 A;  1HUC B;  1TL9 A;  2P7U A;  1KFU L;  1YK7 A;  1YT7 A;  4W4U A;  4FK5 A;  3P5V A;  3HD3 A;  2AU1 A;  4I04 A;  4W5B A;  4CDC B;  3BCN A;  3LFY A;  2O6X A;  2IPP B;  1AU4 A;  4AXL A;  1EWO A;  1BGO A;  3KWZ A;  1F29 A;  2AS8 A;  1NL6 A;  2B1N A;  3IHP A;  2XU5 A;  2GFO A;  1PIP A;  1EWM A;  2R9O A;  1CJL A;  3H89 A;  3KKU A;  3IEJ A;  1MIR A;  3F75 A;  2P86 A;  1VSN A;  2DJF B;  2XU1 A;  3PW3 A;  3I3T A;  4I05 A;  1IWD A;  1AU0 A;  3H8B A;  2F7D A;  2XU3 A;  3CH2 X;  3CBK A;  3WXF A;  4BPV A;  3CH3 X;  2G6D A;  1AYW A;  4Q8G A;  5A24 A;  7PCK A;  3IUT A;  1AYU A;  2F1G A;  2DZY A;  1AU2 A;  1CVZ A;  5F02 A;  1ZCM A;  4MZO A;  4YYW A;  3RVW A;  2AUX A;  2R6N A;  3KWB X;  3PDF A;  6PAD A;  2HD5 A;  1NB3 A;  2AYN A;  4N8W A;  1STF E;  2P0R A;  1MS6 A;  1DEU A;  3IV2 A;  5CHT A;  4YYV A;  3HWN A;  2E01 A;  3P5X A;  4ZUX U;  1FH0 A;  3D6S A;  3KFQ A;  1AYV A;  4YYR A;  4CDD B;  1BP4 A;  5EF4 A;  2PRE A;  4QBB A;  3S3Q A;  3N3K A;  1VJV A;  2NQI A;  2B1M A;  3OIS A;  1F2B A;  4FJC A;  3K24 A;  4QRV A;  3KW9 A;  4YVA A;  4XR7 A;  2YJ8 A;  2R9C A;  3N3G A;  3WXG A;  1CB5 A;  1M6D A;  3USV A;  1YAL A;  4X6I A;  4BSQ A;  2AYO A;  1O0E A;  3HHA A;  4PAD A;  1NPZ A;  1BQI A;  5J94 A;  4BQV A;  1CPJ A;  1GMY A;  3H6S A;  2DCA A;  1CSB B;  2JQF R;  4P6E A;  1ME3 A;  1TLO A;  1AU3 A;  1K3B B;  3NHE A;  4YYU A;  2YJC A;  2G7Y A;  4YYS A;  2YJB A;  2NQA A;  3IOQ A;  1ICF A;  2DCB A;  5EGW A;  1QXP A;  1YK8 A; 
#chains in the Genus database with same CATH topology
 2FYE A;  3K8U A;  1GEC E;  2FQ9 A;  1PE6 A;  4M0W A;  5CVM A;  3QSD A;  3PHX A;  4BOS A;  1F2A A;  3F5V A;  2DC8 A;  4OEM A;  1MHW A;  1PXV A;  2Z84 A;  2Y6E A;  4R3D A;  4X6J A;  3S3R A;  1QDQ A;  4HWY A;  1XKG A;  3O0U A;  4WA6 A;  1DF0 A;  3IMA A;  3BB7 A;  5E6J A;  4D8B A;  1AIM A;  3CBJ A;  1CS8 A;  3BWK A;  2FRA A;  2DJG B;  1EF7 A;  3MOR A;  2R9F A;  4FIP A;  2R9N A;  4OVZ A;  4RNA A;  2OP3 A;  1JQP A;  2DC7 A;  2DCC A;  1PAD A;  2HH5 A;  3GCB A;  1PBH A;  1PVJ A;  3B21 A;  4Q8H A;  4OEL A;  2AUZ A;  1YVB A;  2JRI A;  3M99 A;  1QOL A;  1TU6 A;  4W5C A;  3MHS A;  5JH3 A;  3OVZ A;  1SP4 B;  4PI3 A;  4QRX A;  3KX1 A;  2PNS A;  2Y5B A;  5EZQ A;  2HWK A;  3C9E A;  4YV8 A;  1PPN A;  3E9S A;  2OUL A;  4CZW A;  1X9Y A;  2PBH A;  1GCB A;  3BOW A;  4XUI A;  2CB5 A;  3I06 A;  1U5I A;  4BOQ A;  2FUD A;  2GHU A;  4RF0 A;  4DMY A;  3ERV A;  1Y08 A;  2AIM A;  4MZS A;  1PPO A;  2CIO A;  2FTD A;  1CQD A;  2J7Q A;  3E1Z B;  4QRG A;  2NQG A;  4DMX A;  4BS5 A;  3AI8 A;  1NLJ A;  2C0Y A;  3MTN A;  1A6R A;  3K9M A;  2XU4 A;  2E03 A;  1EWL A;  4BOU A;  2AVW A;  4PP2 E;  4PT5 A;  5CVN B;  1ATK A;  2E02 A;  3U8E A;  3BY4 A;  3BC3 A;  3DF0 A;  1BY8 A;  1YZB A;  1Q6K A;  3N4C A;  2FE8 A;  1MDW A;  1PPD A;  3W31 A;  2VHS A;  2BDZ A;  3HHI A;  2YJ2 A;  1DKI A;  4QH6 A;  2OZ2 A;  3W30 A;  2YJ9 A;  2ARY A;  5PAD A;  1KHP A;  3WXE A;  5JA7 A;  1MEM A;  3MTV A;  4PP1 A;  3TNX A;  2PAD A;  1Y4H A;  2H7J A;  3MP2 A;  1CTE A;  2E00 A;  1ME4 A;  1PPP A;  2FRQ A;  3V6E A;  4IP3 A;  3OVX A;  1U9X A;  1NB5 A;  4X6H A;  4CDF B;  3PSE A;  3RVX A;  4I07 A;  4P6G A;  2G8J A;  1KXR A;  3B79 A;  3RVV A;  1GLO A;  3LXS A;  3O1G A;  1KFX L;  1U9Q X;  3P5W A;  2BU3 A;  4KLB A;  8PCH A;  2FO5 A;  2AGA A;  3MHH A;  1CV8 A;  2DCD A;  1NQC A;  2ACT A;  1U9V A;  3QT4 A;  1MEG A;  3H8C A;  3BBA A;  2G8E A;  3ZUA A;  1QMY A;  3BPF A;  3O65 A;  3PRM A;  3PHW A;  1POP A;  2IBI A;  1ZIV A;  2DC9 A;  4YYQ A;  3BPM A;  1KHQ A;  4K7C A;  2FT2 A;  2JQG R;  4N79 A;  3OF9 A;  4WUR A;  5CHV A;  4BS6 A;  2R9M A;  2WBF X;  4RF1 A;  3OQC A;  4AXM A;  4IUM A;  4G54 A;  1ITO A;  1F2C A;  3V6C A;  3H7D A;  2NQD B;  4MSX A;  2DC6 A;  2DZZ A;  1EWP A;  3QJ3 A;  4REZ A;  4N4Z A;  5K16 A;  4P16 A;  5CVO B;  5FPW A;  2BDL A;  1THE A;  3OF8 A;  2ATO A;  4ZTB A;  2HHN A;  3IFU A;  2HXZ A;  1S4V A;  1AEC A;  3PNR A;  9PAP A;  1U9W A;  2VHF A;  5KO3 A;  3P5U A;  4D8E A;  3RNV A;  3KSE A;  3PBH A;  4MM3 B;  1PCI A;  4CDE B;  1SNK A;  4MI7 A;  4RY2 A;  1HUC B;  1TL9 A;  2P7U A;  1KFU L;  1YK7 A;  1YT7 A;  4W4U A;  4FK5 A;  3P5V A;  3HD3 A;  2AU1 A;  3PHU A;  4I04 A;  4W5B A;  4XZX A;  2BTW B;  4CDC B;  3BCN A;  4HXD B;  3LFY A;  2O6X A;  2IPP B;  1AU4 A;  4AXL A;  1EWO A;  1BGO A;  3TMP A;  3KWZ A;  4D8I A;  1F29 A;  2AS8 A;  1NL6 A;  2B1N A;  3PT2 A;  5JZE A;  3IHP A;  2XU5 A;  2GFO A;  1PIP A;  4A5U A;  1EWM A;  2R9O A;  1CJL A;  3H89 A;  3KKU A;  3IEJ A;  4BOP A;  1MIR A;  3F75 A;  2P86 A;  1VSN A;  5EZS A;  4OW0 A;  2DJF B;  2UZJ A;  2XU1 A;  3PW3 A;  3I3T A;  4I05 A;  1IWD A;  1AU0 A;  3H8B A;  2F7D A;  2XU3 A;  3CH2 X;  3CBK A;  3WXF A;  4BPV A;  3CH3 X;  2G6D A;  1AYW A;  4Q8G A;  2J7Q C;  5A24 A;  7PCK A;  3IUT A;  1AYU A;  2F1G A;  2DZY A;  1AU2 A;  1CVZ A;  5F02 A;  1ZCM A;  4RKX A;  4MZO A;  4YYW A;  3RVW A;  2AUX A;  2R6N A;  3KWB X;  3PDF A;  6PAD A;  2HD5 A;  3TRK A;  1NB3 A;  2AYN A;  4N8W A;  1STF E;  2P0R A;  3ZNH A;  1MS6 A;  1DEU A;  3IV2 A;  5CHT A;  4YYV A;  3HWN A;  2E01 A;  4OVZ B;  3P5X A;  4ZUX U;  1FH0 A;  3D6S A;  3KFQ A;  1AYV A;  2BTW A;  4YYR A;  3C0R A;  4CDD B;  1BP4 A;  5EF4 A;  2PRE A;  4QBB A;  3S3Q A;  3N3K A;  1VJV A;  2NQI A;  2B1M A;  3OIS A;  1F2B A;  4FJC A;  3K24 A;  4QRV A;  3KW9 A;  4YVA A;  4XR7 A;  4BOZ A;  2YJ8 A;  2R9C A;  1UKF A;  3N3G A;  4GUA A;  3WXG A;  1CB5 A;  1M6D A;  3USV A;  3PRP A;  1YAL A;  4X6I A;  4BSQ A;  2AYO A;  1O0E A;  3HHA A;  4PAD A;  1NPZ A;  1BQI A;  5J94 A;  4BQV A;  2DOS A;  1CPJ A;  1GMY A;  3MJ5 A;  3H6S A;  2DCA A;  1CSB B;  2JQF R;  4P6E A;  1ME3 A;  1TLO A;  1AU3 A;  1K3B B;  3NHE A;  4YYU A;  2YJC A;  2G7Y A;  2JTC A;  4YYS A;  2YJB A;  2NQA A;  3IOQ A;  1ICF A;  2DCB A;  5EGW A;  1QXP A;  1YK8 A; 
#chains in the Genus database with same CATH homology
 2FYE A;  3K8U A;  1GEC E;  2FQ9 A;  1PE6 A;  5CVM A;  3QSD A;  4NV7 A;  1F2A A;  3F5V A;  2DC8 A;  4OEM A;  1MHW A;  1PXV A;  2Y6E A;  4X6J A;  3S3R A;  1QDQ A;  4HWY A;  1XKG A;  3O0U A;  4WA6 A;  1DF0 A;  3IMA A;  1AIM A;  3CBJ A;  1CS8 A;  3BWK A;  2FRA A;  2DJG B;  1EF7 A;  3MOR A;  2R9F A;  4FIP A;  2R9N A;  2OP3 A;  1GX3 A;  1JQP A;  2DC7 A;  4NV8 A;  2DCC A;  1PAD A;  2HH5 A;  3GCB A;  1PBH A;  4Q8H A;  4OEL A;  2AUZ A;  1YVB A;  3M99 A;  1QOL A;  1TU6 A;  4W5C A;  3MHS A;  5JH3 A;  3OVZ A;  1SP4 B;  4PI3 A;  4QRX A;  3KX1 A;  3LTW A;  2PNS A;  2Y5B A;  3C9E A;  4YV8 A;  1PPN A;  4CZW A;  2OUL A;  1X9Y A;  2VFB A;  2PBH A;  1GCB A;  3BOW A;  4XUI A;  2CB5 A;  3I06 A;  1U5I A;  2FUD A;  2GHU A;  4DMY A;  3ERV A;  1Y08 A;  2AIM A;  4MZS A;  1PPO A;  2CIO A;  2FTD A;  1CQD A;  3E1Z B;  4QRG A;  2NQG A;  4DMX A;  4BS5 A;  3AI8 A;  1NLJ A;  2C0Y A;  3MTN A;  1A6R A;  3K9M A;  2XU4 A;  2E03 A;  1EWL A;  2AVW A;  4PP2 E;  5CVN B;  1ATK A;  2E02 A;  3U8E A;  3BC3 A;  3DF0 A;  1BY8 A;  3N4C A;  1Q6K A;  1MDW A;  1PPD A;  2VHS A;  2BDZ A;  3HHI A;  2YJ2 A;  4QH6 A;  2OZ2 A;  2YJ9 A;  2ARY A;  2VFC A;  5PAD A;  1KHP A;  3WXE A;  5JA7 A;  1MEM A;  4PP1 A;  3TNX A;  2PAD A;  1Y4H A;  2H7J A;  1CTE A;  2E00 A;  1ME4 A;  1PPP A;  2FRQ A;  3V6E A;  3OVX A;  1U9X A;  1NB5 A;  4X6H A;  4CDF B;  3RVX A;  4I07 A;  4P6G A;  2G8J A;  1KXR A;  3B79 A;  3RVV A;  1GLO A;  3LXS A;  1KFX L;  3O1G A;  1U9Q X;  3P5W A;  4KLB A;  8PCH A;  1W6F A;  2FO5 A;  3MHH A;  1CV8 A;  2DCD A;  1NQC A;  2ACT A;  4BGF A;  1U9V A;  3QT4 A;  1MEG A;  3H8C A;  2G8E A;  3ZUA A;  1QMY A;  3BPF A;  1POP A;  2BSZ A;  2IBI A;  1ZIV A;  2DC9 A;  4YYQ A;  3BPM A;  1KHQ A;  4K7C A;  2FT2 A;  2JQG R;  4N79 A;  3OF9 A;  5CHV A;  4BS6 A;  2R9M A;  2WBF X;  4AXM A;  4G54 A;  1ITO A;  1F2C A;  3V6C A;  3H7D A;  2NQD B;  4MSX A;  2DC6 A;  2DZZ A;  1EWP A;  3QJ3 A;  4N4Z A;  5K16 A;  5CVO B;  5FPW A;  2BDL A;  1THE A;  3OF8 A;  2ATO A;  1E2T A;  2HHN A;  2HXZ A;  1S4V A;  1AEC A;  3PNR A;  9PAP A;  1U9W A;  2VHF A;  3P5U A;  3KSE A;  3PBH A;  1PCI A;  4CDE B;  1SNK A;  4RY2 A;  1HUC B;  1TL9 A;  2P7U A;  1KFU L;  1W5R A;  1YK7 A;  1YT7 A;  4W4U A;  4FK5 A;  3P5V A;  3HD3 A;  2AU1 A;  4I04 A;  4W5B A;  4CDC B;  3BCN A;  3LFY A;  2O6X A;  2IPP B;  1AU4 A;  4AXL A;  1EWO A;  1BGO A;  3KWZ A;  1W4T A;  3D9W A;  1F29 A;  2AS8 A;  1NL6 A;  2B1N A;  4GUZ A;  3IHP A;  2XU5 A;  2GFO A;  1PIP A;  1EWM A;  2R9O A;  1CJL A;  3H89 A;  3KKU A;  3IEJ A;  1MIR A;  3F75 A;  2P86 A;  1VSN A;  2DJF B;  2XU1 A;  3PW3 A;  3I3T A;  4I05 A;  1IWD A;  1AU0 A;  3H8B A;  2F7D A;  2XU3 A;  3CH2 X;  3CBK A;  3WXF A;  4BPV A;  3CH3 X;  2G6D A;  1AYW A;  4Q8G A;  5A24 A;  7PCK A;  3IUT A;  1AYU A;  2F1G A;  2DZY A;  1AU2 A;  1CVZ A;  5F02 A;  1ZCM A;  4MZO A;  4YYW A;  3RVW A;  2AUX A;  2R6N A;  3KWB X;  3PDF A;  6PAD A;  2HD5 A;  1NB3 A;  2AYN A;  4N8W A;  1STF E;  2P0R A;  4B55 A;  1MS6 A;  4C5P A;  1DEU A;  3IV2 A;  5CHT A;  4YYV A;  3HWN A;  2E01 A;  3P5X A;  4ZUX U;  1FH0 A;  3D6S A;  3KFQ A;  1AYV A;  4YYR A;  4CDD B;  1BP4 A;  5EF4 A;  2PRE A;  4QBB A;  3S3Q A;  3N3K A;  1VJV A;  2NQI A;  2B1M A;  3OIS A;  1F2B A;  4FJC A;  3K24 A;  4QRV A;  3KW9 A;  4YVA A;  4XR7 A;  2YJ8 A;  2R9C A;  3N3G A;  3WXG A;  1CB5 A;  1M6D A;  3USV A;  1YAL A;  4X6I A;  4BSQ A;  2AYO A;  1O0E A;  3HHA A;  4PAD A;  1NPZ A;  1BQI A;  5J94 A;  4BQV A;  1CPJ A;  1GMY A;  3H6S A;  2DCA A;  1CSB B;  2JQF R;  4P6E A;  1ME3 A;  1TLO A;  1AU3 A;  1K3B B;  3NHE A;  4YYU A;  2YJC A;  2G7Y A;  4YYS A;  2YJB A;  2NQA A;  3IOQ A;  1ICF A;  2DCB A;  5EGW A;  1QXP A;  1YK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...