4BOPA

Structure of otud1 otu domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
149
structure length
149
Chain Sequence
KLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTU DOMAIN-CONTAINING PROTEIN 1
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4bopA00
3PHUA 5JZEA 4BOSA 3BY4A 3PSEA 3PT2A 4BOQA 3ZNHA 3PHXA 3PHWA 3PRPA 4HXDB 3TMPA 4BOZA 3PRMA 4BOPA 4BOUA 3C0RA
chains in the Genus database with same CATH superfamily
4KLBA 3KSEA 5CHTA 5FPWA 1BY8A 2R6NA 3PT2A 1THEA 2R9NA 1POPA 1SNKA 1QDQA 1EWOA 4REZA 4BS5A 2HD5A 4XZXA 1CB5A 2IPPB 4MI7A 2DCCA 3P5WA 2DJFB 2FT2A 3IEJA 1ATKA 2DOSA 1CJLA 4DMXA 3LFYA 1ICFA 4YYUA 3IFUA 4OVZA 3QT4A 4RF0A 3GCBA 3K9MA 1NB5A 3C0RA 2AGAA 3H6SA 2B1NA 4G54A 1BGOA 1Y08A 2AYOA 4BOPA 1EF7A 2BDZA 3C9EA 3N4CA 1MEMA 2YJ2A 3CBKA 2VHFA 4BS6A 5EZSA 2BU3A 2B1MA 2FE8A 2AYNA 1TL9A 1STFE 2R9FA 4OW0A 5KO3A 2CIOA 1PIPA 4X6HA 5JZEA 1CTEA 1AU2A 1U9QX 2GFOA 4W5BA 3WXFA 4BQVA 1QXPA 2DC8A 2JQFR 2XU4A 4WURA 1AYVA 5A24A 3KKUA 3F5VA 1S4VA 1PADA 1IWDA 1PE6A 1U9WA 3LXSA 2BTWA 3S3QA 3O0UA 5EGWA 3B21A 1F2AA 2DC9A 2ARYA 3BPMA 1NLJA 1U9XA 3DF0A 1PPDA 4OEMA 7PCKA 3HHIA 1YZBA 2HWKA 3N3KA 2G6DA 1F29A 1A6RA 2OP3A 4MM3B 3WXGA 4A5UA 3HHAA 3TNXA 4P16A 2BTWB 4YYQA 4BOSA 5J94A 4XR7A 3ZNHA 3O1GA 2R9OA 1O0EA 3P5VA 3KWZA 2Y5BA 2J7QA 4P6EA 5F02A 2E00A 2PADA 3OF8A 1PVJA 4RNAA 1GECE 4YYSA 3H7DA 3RVXA 3PHUA 1CVZA 4RY2A 1EWPA 4OELA 1NB3A 1VJVA 2OZ2A 4IP3A 2XU3A 4D8BA 1NL6A 3KFQA 1ZCMA 4BOUA 3MJ5A 3S3RA 1CV8A 3RVWA 3IUTA 1NPZA 1DEUA 4X6JA 2Z84A 2FRQA 1GMYA 5EF4A 3PDFA 2P7UA 3RNVA 3OVZA 2AVWA 1ME4A 3PBHA 3E1ZB 1GCBA 2E01A 6PADA 4WA6A 1PPPA 3CH2X 1YVBA 2DZZA 1CPJA 5E6JA 2R9CA 4I05A 3BWKA 2J7QC 2DCAA 4FJCA 1HUCB 2IBIA 3E9SA 4R3DA 4QRXA 3PNRA 2DZYA 5CVMA 3H8CA 1PBHA 2AUZA 4D8EA 2Y6EA 2BDLA 3PW3A 1CSBB 1ZIVA 1FH0A 3CH3X 4PADA 4MZSA 4AXMA 2JTCA 1UKFA 1KHPA 2P86A 4FK5A 2AUXA 2DJGB 4CDFB 4BOZA 4HXDB 3KWBX 3MP2A 2YJ8A 2AIMA 2FTDA 4FIPA 4K7CA 2ATOA 5EZQA 4RKXA 4PP1A 2XU1A 1F2CA 3OF9A 4CDCB 2NQGA 2P0RA 1AU0A 3ERVA 4I07A 4MZOA 1Y4HA 3KW9A 1YK8A 4YYVA 2FO5A 2OULA 2CB5A 3CBJA 4W4UA 5CHVA 2E03A 4QBBA 1Q6KA 5K16A 3I06A 3W31A 2E02A 4CZWA 2UZJA 3PRMA 3MTNA 3U8EA 3D6SA 3BC3A 2FQ9A 8PCHA 4I04A 3V6CA 3OISA 5JA7A 2HHNA 1CQDA 4CDEB 4YVAA 4YYWA 2FYEA 4QRGA 1BQIA 3OQCA 2O6XA 3M99A 4XUIA 4PI3A 3BOWA 4RF1A 1AU3A 3NHEA 1EWLA 1AECA 1ME3A 1KXRA 2PREA 1QOLA 4CDDB 2XU5A 2DCDA 3PHWA 4PT5A 4Q8HA 1ITOA 3IV2A 2ACTA 1GLOA 2G8JA 3IOQA 2DC7A 3ZUAA 3OVXA 2FRAA 3MTVA 3KX1A 4X6IA 3BPFA 3IHPA 2PNSA 3PHXA 3PRPA 2HXZA 4PP2E 1DKIA 2G7YA 3MORA 1PPNA 4QH6A 4GUAA 1CS8A 4D8IA 1MDWA 1TU6A 4N8WA 3MHSA 3MHHA 1AU4A 4QRVA 3P5UA 1YALA 3N3GA 1DF0A 4ZTBA 3K8UA 3P5XA 1U5IA 4BOQA 2AS8A 5JH3A 1AIMA 4BPVA 1NQCA 4ZUXU 1EWMA 3HD3A 1AYUA 3QJ3A 3B79A 3BBAA 3BY4A 1KFXL 1M6DA 2FUDA 3TMPA 1PCIA 1MIRA 3W30A 4MSXA 2GHUA 2NQDB 3AI8A 1JQPA 2H7JA 4HWYA 3BB7A 2R9MA 4N79A 1SP4B 5PADA 4OVZB 2DCBA 2NQIA 1MHWA 1PPOA 1QMYA 3PSEA 1VSNA 4P6GA 3USVA 2G8EA 3O65A 1XKGA 3H8BA 3HWNA 1U9VA 4YYRA 4YV8A 3F75A 1X9YA 3QSDA 1MEGA 3H89A 4IUMA 2NQAA 5CVOB 4N4ZA 1K3BB 4AXLA 2DC6A 2YJBA 2YJCA 4DMYA 3V6EA 1TLOA 2PBHA 3K24A 1PXVA 2YJ9A 2VHSA 1KFUL 2HH5A 1F2BA 5CVNB 1KHQA 3IMAA 1BP4A 1YK7A 2F1GA 2JQGR 2WBFX 4M0WA 9PAPA 4BSQA 1YT7A 3I3TA 3TRKA 2C0YA 2AU1A 3WXEA 1AYWA 2JRIA 3BCNA 2F7DA 4Q8GA 3RVVA 1MS6A 4W5CA
chains in the Genus database with same CATH topology
4MM3B 4A5UA 4ZTBA 4P16A 2BTWB 4BOSA 4BOQA 3PT2A 3ZNHA 2J7QA 4REZA 3BBAA 3W31A 4XZXA 3BY4A 1PVJA 4RNAA 3TMPA 2UZJA 3PRMA 4MI7A 3PHUA 3W30A 3BB7A 4IP3A 4OVZB 4D8BA 2DOSA 4BOUA 3MJ5A 3IFUA 4OVZA 3PSEA 3OQCA 2Z84A 4RF0A 3O65A 3RNVA 3C0RA 2AGAA 4RF1A 4BOPA 5EZSA 2BU3A 2FE8A 4IUMA 5E6JA 4OW0A 3PHWA 4PT5A 5KO3A 2J7QC 5JZEA 3E9SA 4R3DA 3MTVA 3PHXA 3PRPA 4D8EA 1DKIA 4WURA 2JTCA 1UKFA 4GUAA 4M0WA 2BTWA 4D8IA 3TRKA 3B21A 4BOZA 4HXDB 3MP2A 2JRIA 1YZBA 5EZQA 4RKXA 2HWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHU A;  5JZE A;  4BOS A;  3BY4 A;  3PSE A;  3PT2 A;  4BOQ A;  3ZNH A;  3PHX A;  3PHW A;  3PRP A;  4HXD B;  3TMP A;  4BOZ A;  3PRM A;  4BOP A;  4BOU A;  3C0R A; 
#chains in the Genus database with same CATH topology
 4KLB A;  3KSE A;  5CHT A;  5FPW A;  1BY8 A;  2R6N A;  3PT2 A;  1THE A;  2R9N A;  1POP A;  1SNK A;  1QDQ A;  1EWO A;  4REZ A;  4BS5 A;  2HD5 A;  4XZX A;  1CB5 A;  2IPP B;  4MI7 A;  2DCC A;  3P5W A;  2DJF B;  2FT2 A;  3IEJ A;  1ATK A;  2DOS A;  1CJL A;  4DMX A;  3LFY A;  1ICF A;  4YYU A;  3IFU A;  4OVZ A;  3QT4 A;  4RF0 A;  3GCB A;  3K9M A;  1NB5 A;  3C0R A;  2AGA A;  3H6S A;  2B1N A;  4G54 A;  1BGO A;  1Y08 A;  2AYO A;  4BOP A;  1EF7 A;  2BDZ A;  3C9E A;  3N4C A;  1MEM A;  2YJ2 A;  3CBK A;  2VHF A;  4BS6 A;  5EZS A;  2BU3 A;  2B1M A;  2FE8 A;  2AYN A;  1TL9 A;  1STF E;  2R9F A;  4OW0 A;  5KO3 A;  2CIO A;  1PIP A;  4X6H A;  5JZE A;  1CTE A;  1AU2 A;  1U9Q X;  2GFO A;  4W5B A;  3WXF A;  4BQV A;  1QXP A;  2DC8 A;  2JQF R;  2XU4 A;  4WUR A;  1AYV A;  5A24 A;  3KKU A;  3F5V A;  1S4V A;  1PAD A;  1IWD A;  1PE6 A;  1U9W A;  3LXS A;  2BTW A;  3S3Q A;  3O0U A;  5EGW A;  3B21 A;  1F2A A;  2DC9 A;  2ARY A;  3BPM A;  1NLJ A;  1U9X A;  3DF0 A;  1PPD A;  4OEM A;  7PCK A;  3HHI A;  1YZB A;  2HWK A;  3N3K A;  2G6D A;  1F29 A;  1A6R A;  2OP3 A;  4MM3 B;  3WXG A;  4A5U A;  3HHA A;  3TNX A;  4P16 A;  2BTW B;  4YYQ A;  4BOS A;  5J94 A;  4XR7 A;  3ZNH A;  3O1G A;  2R9O A;  1O0E A;  3P5V A;  3KWZ A;  2Y5B A;  2J7Q A;  4P6E A;  5F02 A;  2E00 A;  2PAD A;  3OF8 A;  1PVJ A;  4RNA A;  1GEC E;  4YYS A;  3H7D A;  3RVX A;  3PHU A;  1CVZ A;  4RY2 A;  1EWP A;  4OEL A;  1NB3 A;  1VJV A;  2OZ2 A;  4IP3 A;  2XU3 A;  4D8B A;  1NL6 A;  3KFQ A;  1ZCM A;  4BOU A;  3MJ5 A;  3S3R A;  1CV8 A;  3RVW A;  3IUT A;  1NPZ A;  1DEU A;  4X6J A;  2Z84 A;  2FRQ A;  1GMY A;  5EF4 A;  3PDF A;  2P7U A;  3RNV A;  3OVZ A;  2AVW A;  1ME4 A;  3PBH A;  3E1Z B;  1GCB A;  2E01 A;  6PAD A;  4WA6 A;  1PPP A;  3CH2 X;  1YVB A;  2DZZ A;  1CPJ A;  5E6J A;  2R9C A;  4I05 A;  3BWK A;  2J7Q C;  2DCA A;  4FJC A;  1HUC B;  2IBI A;  3E9S A;  4R3D A;  4QRX A;  3PNR A;  2DZY A;  5CVM A;  3H8C A;  1PBH A;  2AUZ A;  4D8E A;  2Y6E A;  2BDL A;  3PW3 A;  1CSB B;  1ZIV A;  1FH0 A;  3CH3 X;  4PAD A;  4MZS A;  4AXM A;  2JTC A;  1UKF A;  1KHP A;  2P86 A;  4FK5 A;  2AUX A;  2DJG B;  4CDF B;  4BOZ A;  4HXD B;  3KWB X;  3MP2 A;  2YJ8 A;  2AIM A;  2FTD A;  4FIP A;  4K7C A;  2ATO A;  5EZQ A;  4RKX A;  4PP1 A;  2XU1 A;  1F2C A;  3OF9 A;  4CDC B;  2NQG A;  2P0R A;  1AU0 A;  3ERV A;  4I07 A;  4MZO A;  1Y4H A;  3KW9 A;  1YK8 A;  4YYV A;  2FO5 A;  2OUL A;  2CB5 A;  3CBJ A;  4W4U A;  5CHV A;  2E03 A;  4QBB A;  1Q6K A;  5K16 A;  3I06 A;  3W31 A;  2E02 A;  4CZW A;  2UZJ A;  3PRM A;  3MTN A;  3U8E A;  3D6S A;  3BC3 A;  2FQ9 A;  8PCH A;  4I04 A;  3V6C A;  3OIS A;  5JA7 A;  2HHN A;  1CQD A;  4CDE B;  4YVA A;  4YYW A;  2FYE A;  4QRG A;  1BQI A;  3OQC A;  2O6X A;  3M99 A;  4XUI A;  4PI3 A;  3BOW A;  4RF1 A;  1AU3 A;  3NHE A;  1EWL A;  1AEC A;  1ME3 A;  1KXR A;  2PRE A;  1QOL A;  4CDD B;  2XU5 A;  2DCD A;  3PHW A;  4PT5 A;  4Q8H A;  1ITO A;  3IV2 A;  2ACT A;  1GLO A;  2G8J A;  3IOQ A;  2DC7 A;  3ZUA A;  3OVX A;  2FRA A;  3MTV A;  3KX1 A;  4X6I A;  3BPF A;  3IHP A;  2PNS A;  3PHX A;  3PRP A;  2HXZ A;  4PP2 E;  1DKI A;  2G7Y A;  3MOR A;  1PPN A;  4QH6 A;  4GUA A;  1CS8 A;  4D8I A;  1MDW A;  1TU6 A;  4N8W A;  3MHS A;  3MHH A;  1AU4 A;  4QRV A;  3P5U A;  1YAL A;  3N3G A;  1DF0 A;  4ZTB A;  3K8U A;  3P5X A;  1U5I A;  4BOQ A;  2AS8 A;  5JH3 A;  1AIM A;  4BPV A;  1NQC A;  4ZUX U;  1EWM A;  3HD3 A;  1AYU A;  3QJ3 A;  3B79 A;  3BBA A;  3BY4 A;  1KFX L;  1M6D A;  2FUD A;  3TMP A;  1PCI A;  1MIR A;  3W30 A;  4MSX A;  2GHU A;  2NQD B;  3AI8 A;  1JQP A;  2H7J A;  4HWY A;  3BB7 A;  2R9M A;  4N79 A;  1SP4 B;  5PAD A;  4OVZ B;  2DCB A;  2NQI A;  1MHW A;  1PPO A;  1QMY A;  3PSE A;  1VSN A;  4P6G A;  3USV A;  2G8E A;  3O65 A;  1XKG A;  3H8B A;  3HWN A;  1U9V A;  4YYR A;  4YV8 A;  3F75 A;  1X9Y A;  3QSD A;  1MEG A;  3H89 A;  4IUM A;  2NQA A;  5CVO B;  4N4Z A;  1K3B B;  4AXL A;  2DC6 A;  2YJB A;  2YJC A;  4DMY A;  3V6E A;  1TLO A;  2PBH A;  3K24 A;  1PXV A;  2YJ9 A;  2VHS A;  1KFU L;  2HH5 A;  1F2B A;  5CVN B;  1KHQ A;  3IMA A;  1BP4 A;  1YK7 A;  2F1G A;  2JQG R;  2WBF X;  4M0W A;  9PAP A;  4BSQ A;  1YT7 A;  3I3T A;  3TRK A;  2C0Y A;  2AU1 A;  3WXE A;  1AYW A;  2JRI A;  3BCN A;  2F7D A;  4Q8G A;  3RVV A;  1MS6 A;  4W5C A; 
#chains in the Genus database with same CATH homology
 4MM3 B;  4A5U A;  4ZTB A;  4P16 A;  2BTW B;  4BOS A;  4BOQ A;  3PT2 A;  3ZNH A;  2J7Q A;  4REZ A;  3BBA A;  3W31 A;  4XZX A;  3BY4 A;  1PVJ A;  4RNA A;  3TMP A;  2UZJ A;  3PRM A;  4MI7 A;  3PHU A;  3W30 A;  3BB7 A;  4IP3 A;  4OVZ B;  4D8B A;  2DOS A;  4BOU A;  3MJ5 A;  3IFU A;  4OVZ A;  3PSE A;  3OQC A;  2Z84 A;  4RF0 A;  3O65 A;  3RNV A;  3C0R A;  2AGA A;  4RF1 A;  4BOP A;  5EZS A;  2BU3 A;  2FE8 A;  4IUM A;  5E6J A;  4OW0 A;  3PHW A;  4PT5 A;  5KO3 A;  2J7Q C;  5JZE A;  3E9S A;  4R3D A;  3MTV A;  3PHX A;  3PRP A;  4D8E A;  1DKI A;  4WUR A;  2JTC A;  1UKF A;  4GUA A;  4M0W A;  2BTW A;  4D8I A;  3TRK A;  3B21 A;  4BOZ A;  4HXD B;  3MP2 A;  2JRI A;  1YZB A;  5EZQ A;  4RKX A;  2HWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...