4BOPA

Structure of otud1 otu domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
149
structure length
149
Chain Sequence
b'KLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTU DOMAIN-CONTAINING PROTEIN 1
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4bopA00
3BY4A 3PSEA 4HXDB 4BOZA 3PHWA 3C0RA 4BOUA 3TMPA 4BOSA 3ZNHA 3PRMA 3PRPA 3PT2A 4BOPA 4BOQA 3PHXA 5JZEA 3PHUA
chains in the Genus database with same CATH superfamily
2BDLA 2R9OA 4Q8GA 4R3DA 4YV8A 1EWOA 1EWLA 1PPPA 3H7DA 1F29A 2ATOA 4K7CA 9PAPA 2DC9A 3QT4A 3WXEA 3I3TA 4IUMA 1ME4A 5J94A 4FK5A 3V6EA 2PNSA 3HWNA 2GHUA 2PBHA 3N4CA 1PXVA 3KX1A 4BOUA 4AXMA 2OP3A 4IP3A 3I06A 3IMAA 3BWKA 4REZA 2FRAA 2AUZA 4XZXA 4N4ZA 3GCBA 2IPPB 4I04A 4YYUA 3PW3A 1VJVA 2YJCA 1IWDA 2BTWB 1HUCB 2J7QA 1U9XA 4A5UA 4DMXA 3K9MA 4YYRA 1THEA 2H7JA 3E1ZB 3V6CA 1O0EA 6PADA 5JA7A 4BOPA 1MEMA 2XU4A 1AYUA 2G6DA 3AI8A 1QMYA 3QSDA 3IFUA 2DZYA 2HHNA 4W5CA 5PADA 4CDCB 3BPFA 2CIOA 2ACTA 2YJ2A 1KHQA 1YZBA 3PRPA 3MP2A 3W30A 1Y08A 2G8EA 4CDDB 2YJBA 1PCIA 1YK7A 3P5XA 4QH6A 4PP2E 4OVZA 1AIMA 3NHEA 2P7UA 4MI7A 3KW9A 5JH3A 4YYWA 1POPA 3KWBX 4QRVA 4ZTBA 2R9MA 4BPVA 1BQIA 2R6NA 4QBBA 3MHSA 2FE8A 3RVWA 4P6GA 3WXGA 1TL9A 1NPZA 2HXZA 4DMYA 1KHPA 1U9VA 1GECE 4M0WA 2BDZA 3H6SA 1TU6A 3M99A 3PDFA 2DC7A 2AIMA 2XU1A 1QOLA 2PREA 3RNVA 1CSBB 3USVA 3CH3X 4MZSA 5CVMA 1ICFA 2HD5A 3WXFA 1MEGA 3S3QA 3KFQA 3O0UA 3S3RA 3N3KA 3MORA 3OVZA 3O1GA 2VHSA 2FT2A 3TMPA 2AS8A 2HWKA 3OVXA 2F1GA 5EZQA 4RNAA 1VSNA 1ZIVA 4QRGA 4RY2A 4HWYA 2Y6EA 1SP4B 4N79A 1DF0A 1U9QX 7PCKA 4BS5A 3K8UA 2JQFR 4MSXA 2DC6A 3IUTA 1BY8A 2OZ2A 4PADA 5EZSA 3W31A 3PNRA 4D8IA 1JQPA 4CDFB 1MDWA 3OF8A 4HXDB 2VHFA 4RF0A 1NQCA 1KXRA 3B21A 4RF1A 3BOWA 1PADA 4X6JA 3RVVA 4AXLA 2DCAA 1KFXL 2DC8A 2FRQA 3ZUAA 1GMYA 3MJ5A 3PBHA 2O6XA 5A24A 4BOSA 2YJ8A 1EF7A 1ITOA 1F2CA 2FQ9A 5CHTA 1PBHA 2YJ9A 4P6EA 1CTEA 1PE6A 1TLOA 1F2AA 2Z84A 4OELA 3KWZA 1YT7A 2IBIA 3PT2A 3KSEA 5KO3A 1NLJA 2AUXA 4WURA 3C0RA 3BBAA 1AU0A 1GLOA 3F75A 2C0YA 1CJLA 1DKIA 3BY4A 3ERVA 2FTDA 2R9FA 3K24A 3O65A 3QJ3A 3CBJA 2DJFB 2NQAA 1AU4A 4PT5A 2DOSA 3HD3A 5CVNB 3E9SA 5FPWA 1AYWA 3KKUA 2AU1A 4I05A 1Q6KA 1MIRA 2BTWA 3P5WA 2R9CA 1KFUL 3PHXA 3B79A 5JZEA 4BQVA 3F5VA 5F02A 4XUIA 4OW0A 1STFE 2DZZA 2XU3A 2DJGB 4YVAA 1BGOA 4ZUXU 2UZJA 3HHIA 1QXPA 1YALA 5CHVA 2R9NA 3BC3A 2WBFX 3CH2X 3IHPA 4MM3B 1MS6A 2BU3A 1NB5A 3CBKA 1CV8A 3TRKA 2NQDB 2P0RA 4PI3A 3H8BA 3P5VA 4OEMA 4G54A 1ME3A 1EWPA 1QDQA 3IV2A 1SNKA 4BS6A 1EWMA 1F2BA 1UKFA 2E02A 1S4VA 2DCBA 2DCDA 1PIPA 2G7YA 3LXSA 4MZOA 4D8EA 4I07A 1FH0A 3U8EA 2ARYA 1AU3A 1M6DA 2FYEA 1U9WA 3MHHA 2PADA 4YYQA 3RVXA 2E00A 3C9EA 5CVOB 2NQGA 2P86A 4OVZB 1AECA 3IOQA 2J7QC 1XKGA 4D8BA 4RKXA 4BOZA 4BSQA 4CZWA 2JTCA 1PVJA 3H89A 2JQGR 3D6SA 1YVBA 3PSEA 1PPOA 1U5IA 2FO5A 2E01A 3MTNA 2AVWA 2Y5BA 3N3GA 3OF9A 1GCBA 2NQIA 3H8CA 1BP4A 2B1MA 4X6IA 1DEUA 4W4UA 3TNXA 1AU2A 3PRMA 1NL6A 4PP1A 4QRXA 2HH5A 1CQDA 4N8WA 2AYOA 8PCHA 3MTVA 3DF0A 5EF4A 4YYVA 3PHWA 1CVZA 3ZNHA 4Q8HA 4W5BA 2OULA 3BPMA 4XR7A 1YK8A 4CDEB 4X6HA 1CPJA 5EGWA 3PHUA 2XU5A 4FJCA 2AGAA 2DCCA 1X9YA 1ZCMA 3OQCA 1PPDA 2G8JA 3BCNA 3HHAA 1A6RA 1K3BB 4P16A 1PPNA 3BB7A 2GFOA 4BOQA 1Y4HA 1CB5A 2E03A 3IEJA 5E6JA 2CB5A 3P5UA 2FUDA 1ATKA 4YYSA 1AYVA 2JRIA 3LFYA 4WA6A 1NB3A 1MHWA 2F7DA 3OISA 4KLBA 4FIPA 2B1NA 1CS8A 4GUAA 5K16A 2AYNA
chains in the Genus database with same CATH topology
4R3DA 4OVZA 4OVZB 4MI7A 3MJ5A 2J7QC 4BOSA 4D8BA 4RKXA 4ZTBA 4BOZA 4IUMA 2JTCA 2Z84A 1PVJA 2FE8A 3PT2A 5KO3A 3PSEA 4WURA 3C0RA 3BBAA 4M0WA 4BOUA 1DKIA 3BY4A 4IP3A 3PRMA 4REZA 3O65A 3RNVA 4PT5A 2DOSA 3E9SA 4XZXA 3MTVA 3PHWA 2BTWA 3ZNHA 2BTWB 3PHXA 5JZEA 2J7QA 4OW0A 4A5UA 3PHUA 2AGAA 2UZJA 3TMPA 3OQCA 2HWKA 5EZQA 4RNAA 4BOPA 4P16A 4MM3B 3BB7A 4BOQA 2BU3A 3TRKA 3IFUA 5E6JA 5EZSA 3W31A 2JRIA 1UKFA 4D8IA 1YZBA 3PRPA 3MP2A 3W30A 4D8EA 4HXDB 4RF0A 4GUAA 3B21A 4RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY4 A;  3PSE A;  4HXD B;  4BOZ A;  3PHW A;  3C0R A;  4BOU A;  3TMP A;  4BOS A;  3ZNH A;  3PRM A;  3PRP A;  3PT2 A;  4BOP A;  4BOQ A;  3PHX A;  5JZE A;  3PHU A; 
#chains in the Genus database with same CATH topology
 2BDL A;  2R9O A;  4Q8G A;  4R3D A;  4YV8 A;  1EWO A;  1EWL A;  1PPP A;  3H7D A;  1F29 A;  2ATO A;  4K7C A;  9PAP A;  2DC9 A;  3QT4 A;  3WXE A;  3I3T A;  4IUM A;  1ME4 A;  5J94 A;  4FK5 A;  3V6E A;  2PNS A;  3HWN A;  2GHU A;  2PBH A;  3N4C A;  1PXV A;  3KX1 A;  4BOU A;  4AXM A;  2OP3 A;  4IP3 A;  3I06 A;  3IMA A;  3BWK A;  4REZ A;  2FRA A;  2AUZ A;  4XZX A;  4N4Z A;  3GCB A;  2IPP B;  4I04 A;  4YYU A;  3PW3 A;  1VJV A;  2YJC A;  1IWD A;  2BTW B;  1HUC B;  2J7Q A;  1U9X A;  4A5U A;  4DMX A;  3K9M A;  4YYR A;  1THE A;  2H7J A;  3E1Z B;  3V6C A;  1O0E A;  6PAD A;  5JA7 A;  4BOP A;  1MEM A;  2XU4 A;  1AYU A;  2G6D A;  3AI8 A;  1QMY A;  3QSD A;  3IFU A;  2DZY A;  2HHN A;  4W5C A;  5PAD A;  4CDC B;  3BPF A;  2CIO A;  2ACT A;  2YJ2 A;  1KHQ A;  1YZB A;  3PRP A;  3MP2 A;  3W30 A;  1Y08 A;  2G8E A;  4CDD B;  2YJB A;  1PCI A;  1YK7 A;  3P5X A;  4QH6 A;  4PP2 E;  4OVZ A;  1AIM A;  3NHE A;  2P7U A;  4MI7 A;  3KW9 A;  5JH3 A;  4YYW A;  1POP A;  3KWB X;  4QRV A;  4ZTB A;  2R9M A;  4BPV A;  1BQI A;  2R6N A;  4QBB A;  3MHS A;  2FE8 A;  3RVW A;  4P6G A;  3WXG A;  1TL9 A;  1NPZ A;  2HXZ A;  4DMY A;  1KHP A;  1U9V A;  1GEC E;  4M0W A;  2BDZ A;  3H6S A;  1TU6 A;  3M99 A;  3PDF A;  2DC7 A;  2AIM A;  2XU1 A;  1QOL A;  2PRE A;  3RNV A;  1CSB B;  3USV A;  3CH3 X;  4MZS A;  5CVM A;  1ICF A;  2HD5 A;  3WXF A;  1MEG A;  3S3Q A;  3KFQ A;  3O0U A;  3S3R A;  3N3K A;  3MOR A;  3OVZ A;  3O1G A;  2VHS A;  2FT2 A;  3TMP A;  2AS8 A;  2HWK A;  3OVX A;  2F1G A;  5EZQ A;  4RNA A;  1VSN A;  1ZIV A;  4QRG A;  4RY2 A;  4HWY A;  2Y6E A;  1SP4 B;  4N79 A;  1DF0 A;  1U9Q X;  7PCK A;  4BS5 A;  3K8U A;  2JQF R;  4MSX A;  2DC6 A;  3IUT A;  1BY8 A;  2OZ2 A;  4PAD A;  5EZS A;  3W31 A;  3PNR A;  4D8I A;  1JQP A;  4CDF B;  1MDW A;  3OF8 A;  4HXD B;  2VHF A;  4RF0 A;  1NQC A;  1KXR A;  3B21 A;  4RF1 A;  3BOW A;  1PAD A;  4X6J A;  3RVV A;  4AXL A;  2DCA A;  1KFX L;  2DC8 A;  2FRQ A;  3ZUA A;  1GMY A;  3MJ5 A;  3PBH A;  2O6X A;  5A24 A;  4BOS A;  2YJ8 A;  1EF7 A;  1ITO A;  1F2C A;  2FQ9 A;  5CHT A;  1PBH A;  2YJ9 A;  4P6E A;  1CTE A;  1PE6 A;  1TLO A;  1F2A A;  2Z84 A;  4OEL A;  3KWZ A;  1YT7 A;  2IBI A;  3PT2 A;  3KSE A;  5KO3 A;  1NLJ A;  2AUX A;  4WUR A;  3C0R A;  3BBA A;  1AU0 A;  1GLO A;  3F75 A;  2C0Y A;  1CJL A;  1DKI A;  3BY4 A;  3ERV A;  2FTD A;  2R9F A;  3K24 A;  3O65 A;  3QJ3 A;  3CBJ A;  2DJF B;  2NQA A;  1AU4 A;  4PT5 A;  2DOS A;  3HD3 A;  5CVN B;  3E9S A;  5FPW A;  1AYW A;  3KKU A;  2AU1 A;  4I05 A;  1Q6K A;  1MIR A;  2BTW A;  3P5W A;  2R9C A;  1KFU L;  3PHX A;  3B79 A;  5JZE A;  4BQV A;  3F5V A;  5F02 A;  4XUI A;  4OW0 A;  1STF E;  2DZZ A;  2XU3 A;  2DJG B;  4YVA A;  1BGO A;  4ZUX U;  2UZJ A;  3HHI A;  1QXP A;  1YAL A;  5CHV A;  2R9N A;  3BC3 A;  2WBF X;  3CH2 X;  3IHP A;  4MM3 B;  1MS6 A;  2BU3 A;  1NB5 A;  3CBK A;  1CV8 A;  3TRK A;  2NQD B;  2P0R A;  4PI3 A;  3H8B A;  3P5V A;  4OEM A;  4G54 A;  1ME3 A;  1EWP A;  1QDQ A;  3IV2 A;  1SNK A;  4BS6 A;  1EWM A;  1F2B A;  1UKF A;  2E02 A;  1S4V A;  2DCB A;  2DCD A;  1PIP A;  2G7Y A;  3LXS A;  4MZO A;  4D8E A;  4I07 A;  1FH0 A;  3U8E A;  2ARY A;  1AU3 A;  1M6D A;  2FYE A;  1U9W A;  3MHH A;  2PAD A;  4YYQ A;  3RVX A;  2E00 A;  3C9E A;  5CVO B;  2NQG A;  2P86 A;  4OVZ B;  1AEC A;  3IOQ A;  2J7Q C;  1XKG A;  4D8B A;  4RKX A;  4BOZ A;  4BSQ A;  4CZW A;  2JTC A;  1PVJ A;  3H89 A;  2JQG R;  3D6S A;  1YVB A;  3PSE A;  1PPO A;  1U5I A;  2FO5 A;  2E01 A;  3MTN A;  2AVW A;  2Y5B A;  3N3G A;  3OF9 A;  1GCB A;  2NQI A;  3H8C A;  1BP4 A;  2B1M A;  4X6I A;  1DEU A;  4W4U A;  3TNX A;  1AU2 A;  3PRM A;  1NL6 A;  4PP1 A;  4QRX A;  2HH5 A;  1CQD A;  4N8W A;  2AYO A;  8PCH A;  3MTV A;  3DF0 A;  5EF4 A;  4YYV A;  3PHW A;  1CVZ A;  3ZNH A;  4Q8H A;  4W5B A;  2OUL A;  3BPM A;  4XR7 A;  1YK8 A;  4CDE B;  4X6H A;  1CPJ A;  5EGW A;  3PHU A;  2XU5 A;  4FJC A;  2AGA A;  2DCC A;  1X9Y A;  1ZCM A;  3OQC A;  1PPD A;  2G8J A;  3BCN A;  3HHA A;  1A6R A;  1K3B B;  4P16 A;  1PPN A;  3BB7 A;  2GFO A;  4BOQ A;  1Y4H A;  1CB5 A;  2E03 A;  3IEJ A;  5E6J A;  2CB5 A;  3P5U A;  2FUD A;  1ATK A;  4YYS A;  1AYV A;  2JRI A;  3LFY A;  4WA6 A;  1NB3 A;  1MHW A;  2F7D A;  3OIS A;  4KLB A;  4FIP A;  2B1N A;  1CS8 A;  4GUA A;  5K16 A;  2AYN A; 
#chains in the Genus database with same CATH homology
 4R3D A;  4OVZ A;  4OVZ B;  4MI7 A;  3MJ5 A;  2J7Q C;  4BOS A;  4D8B A;  4RKX A;  4ZTB A;  4BOZ A;  4IUM A;  2JTC A;  2Z84 A;  1PVJ A;  2FE8 A;  3PT2 A;  5KO3 A;  3PSE A;  4WUR A;  3C0R A;  3BBA A;  4M0W A;  4BOU A;  1DKI A;  3BY4 A;  4IP3 A;  3PRM A;  4REZ A;  3O65 A;  3RNV A;  4PT5 A;  2DOS A;  3E9S A;  4XZX A;  3MTV A;  3PHW A;  2BTW A;  3ZNH A;  2BTW B;  3PHX A;  5JZE A;  2J7Q A;  4OW0 A;  4A5U A;  3PHU A;  2AGA A;  2UZJ A;  3TMP A;  3OQC A;  2HWK A;  5EZQ A;  4RNA A;  4BOP A;  4P16 A;  4MM3 B;  3BB7 A;  4BOQ A;  2BU3 A;  3TRK A;  3IFU A;  5E6J A;  5EZS A;  3W31 A;  2JRI A;  1UKF A;  4D8I A;  1YZB A;  3PRP A;  3MP2 A;  3W30 A;  4D8E A;  4HXD B;  4RF0 A;  4GUA A;  3B21 A;  4RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...