4BOPA

Structure of otud1 otu domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
149
structure length
149
Chain Sequence
KLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU DOMAIN-CONTAINING PROTEIN 1
total genus 49
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4bopA00
4BOUA 3PRMA 4HXDB 3PSEA 3TMPA 4BOPA 4BOQA 4BOZA 3PT2A 3PHWA 3PHXA 3ZNHA 3PHUA 4BOSA 3BY4A 3PRPA 3C0RA 5JZEA
chains in the Genus database with same CATH superfamily
1BGOA 4GUAA 2DC9A 2OP3A 1EWLA 4FIPA 4BSQA 2VHFA 3BOWA 2P86A 4MZSA 1AIMA 1PPPA 3TNXA 1ZIVA 3BPFA 4YV8A 1AYUA 5EZQA 1MHWA 1DEUA 3DF0A 4I07A 5CVNB 4N79A 3F5VA 4RF0A 3C9EA 3BCNA 3B21A 2JQGR 2Y6EA 2BU3A 4ZTBA 3QJ3A 3ZNHA 1AU3A 2OULA 2AYOA 3ZUAA 1PVJA 1EWMA 3O0UA 3KWZA 5EGWA 3PNRA 4QH6A 4XR7A 1QDQA 2R9MA 1U9XA 5JH3A 4MSXA 4PT5A 3PDFA 1CQDA 2DC7A 4BPVA 5CVMA 1KFUL 1XKGA 3E1ZB 3HHAA 5JA7A 3H6SA 3H7DA 1TL9A 4OEMA 1CTEA 1BQIA 2UZJA 4OVZA 1NL6A 1BY8A 3P5UA 3HHIA 1NQCA 4YYVA 1YZBA 1BP4A 2PREA 1YT7A 3IHPA 4XZXA 1NPZA 1PPOA 3OQCA 2JQFR 4MI7A 2DOSA 3K9MA 1GMYA 3N3GA 4IUMA 3V6EA 1F29A 2IPPB 2P7UA 1ME3A 4QRGA 4REZA 3AI8A 2HHNA 3PHUA 2FT2A 2E03A 4X6IA 1KFXL 2FRAA 1SNKA 1PCIA 3PHWA 1A6RA 2HD5A 4M0WA 3PRMA 3H8CA 1CPJA 1AU4A 1F2AA 4BQVA 2R9FA 1KHPA 4P6GA 4QRXA 3BC3A 1CVZA 1NB5A 2NQIA 3W30A 1F2BA 1AU0A 4P16A 2J7QC 4W5CA 2G8JA 2FO5A 1U9QX 2B1MA 5E6JA 3H8BA 3O65A 3BBAA 2FUDA 2YJ2A 4I04A 4FJCA 3RVXA 3NHEA 3OVXA 1YALA 3MHSA 4Q8HA 1F2CA 3LFYA 1STFE 1Y08A 4K7CA 4W5BA 4RY2A 3W31A 2HWKA 3BB7A 3F75A 4AXMA 3BWKA 5CHTA 1ZCMA 2AU1A 1UKFA 1PADA 1POPA 4D8BA 1AECA 2R6NA 3WXFA 2NQAA 2BDZA 5KO3A 4DMXA 3K24A 3V6CA 8PCHA 3GCBA 1JQPA 2C0YA 2VHSA 4CDFB 2AUXA 4P6EA 5CVOB 3M99A 4YYQA 4YYWA 2GFOA 2NQGA 4G54A 4X6HA 2R9CA 4D8IA 4HXDB 1GLOA 2OZ2A 3P5VA 4CDDB 4CZWA 2DZZA 2G7YA 2BTWA 3B79A 4BS6A 1GCBA 3I3TA 4WURA 3IEJA 4BOQA 2XU1A 2E01A 1VJVA 2FTDA 1EF7A 2FE8A 2HH5A 3HWNA 3KW9A 3C0RA 1DKIA 1EWOA 3K8UA 2FQ9A 5EF4A 4PP1A 3ERVA 1KHQA 2CIOA 4ZUXU 3P5WA 1O0EA 3PRPA 2H7JA 2G6DA 3PW3A 4N8WA 2AVWA 1PBHA 4BOZA 5JZEA 2GHUA 3RVVA 2NQDB 3LXSA 3BY4A 1GECE 3MP2A 1CB5A 1NB3A 1AYVA 3P5XA 1CJLA 2O6XA 1ATKA 3CBJA 3KSEA 4RF1A 2R9NA 3PT2A 3OF8A 1YK7A 4A5UA 4MM3B 2FRQA 2XU5A 2FYEA 3KKUA 2DC8A 4Q8GA 1M6DA 2WBFX 3PSEA 3N4CA 4MZOA 4BOSA 2BTWB 2AYNA 3QSDA 3TMPA 1THEA 2YJBA 2PBHA 2ACTA 4YYRA 1MEMA 3IV2A 4HWYA 4RKXA 3E9SA 4RNAA 1AU2A 1S4VA 1MDWA 2J7QA 3N3KA 4CDEB 2ARYA 6PADA 3MHHA 4N4ZA 4I05A 1QOLA 1PE6A 2Y5BA 2YJCA 2HXZA 2R9OA 3OISA 2DC6A 3KFQA 3WXEA 3CBKA 5FPWA 2DCBA 9PAPA 7PCKA 5CHVA 2P0RA 1IWDA 1KXRA 1PPNA 4YYUA 4DMYA 1HUCB 3CH3X 3CH2X 2DJGB 4CDCB 4W4UA 1MS6A 2AIMA 2B1NA 2DJFB 4YYSA 5K16A 1U9VA 1VSNA 2DCCA 3S3RA 3MTVA 3WXGA 1Y4HA 3IFUA 1ICFA 2JTCA 3MORA 2DCAA 2PNSA 3OVZA 2F7DA 1TLOA 1AYWA 1CV8A 2BDLA 1YK8A 3I06A 3D6SA 3IUTA 3KX1A 4PI3A 2XU4A 3KWBX 2YJ8A 4AXLA 2DZYA 1ITOA 4KLBA 1PPDA 2F1GA 4D8EA 4FK5A 2AUZA 3USVA 4BS5A 4PADA 3OF9A 2YJ9A 2G8EA 4WA6A 5PADA 1EWPA 5A24A 4OW0A 4X6JA 3RVWA 1PIPA 3MTNA 3IMAA 3IOQA 2CB5A 1FH0A 3QT4A 3RNVA 4IP3A 3MJ5A 2Z84A 3U8EA 1YVBA 1QMYA 4BOPA 4OVZB 1X9YA 4YVAA 5J94A 2DCDA 1DF0A 4OELA 4XUIA 1MIRA 1NLJA 2IBIA 4QBBA 1TU6A 3TRKA 1U5IA 5F02A 3S3QA 2ATOA 1PXVA 2E00A 1U9WA 2AGAA 2AS8A 2E02A 1QXPA 3PBHA 4R3DA 4PP2E 3HD3A 2XU3A 1Q6KA 2JRIA 3O1GA 1SP4B 1ME4A 3H89A 1CSBB 5EZSA 1CS8A 3BPMA 1K3BB 4BOUA 1MEGA 3PHXA 2PADA 4QRVA
chains in the Genus database with same CATH topology
3E9SA 4HXDB 3MJ5A 1DKIA 4P16A 4R3DA 2J7QC 4GUAA 2Z84A 4RNAA 4D8BA 3B21A 4ZTBA 2BU3A 3PHWA 4IUMA 3ZNHA 5E6JA 4M0WA 2J7QA 3PRPA 3O65A 2BTWA 3PRMA 3BBAA 3PSEA 4RF0A 2UZJA 5KO3A 4BOPA 4OVZA 4OVZB 4WURA 1PVJA 4BOSA 4OW0A 2JRIA 2BTWB 4BOZA 4BOQA 5JZEA 3TMPA 3TRKA 1YZBA 4REZA 3PHUA 5EZSA 3W31A 3BB7A 3BY4A 2HWKA 5EZQA 4D8IA 3MP2A 3MTVA 4BOUA 4PT5A 2FE8A 3IFUA 4XZXA 4D8EA 3RNVA 3W30A 2AGAA 2JTCA 4RF1A 3OQCA 3PT2A 3PHXA 4A5UA 1UKFA 4MM3B 4IP3A 4MI7A 2DOSA 3C0RA 4RKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOU A;  3PRM A;  4HXD B;  3PSE A;  3TMP A;  4BOP A;  4BOQ A;  4BOZ A;  3PT2 A;  3PHW A;  3PHX A;  3ZNH A;  3PHU A;  4BOS A;  3BY4 A;  3PRP A;  3C0R A;  5JZE A; 
#chains in the Genus database with same CATH topology
 1BGO A;  4GUA A;  2DC9 A;  2OP3 A;  1EWL A;  4FIP A;  4BSQ A;  2VHF A;  3BOW A;  2P86 A;  4MZS A;  1AIM A;  1PPP A;  3TNX A;  1ZIV A;  3BPF A;  4YV8 A;  1AYU A;  5EZQ A;  1MHW A;  1DEU A;  3DF0 A;  4I07 A;  5CVN B;  4N79 A;  3F5V A;  4RF0 A;  3C9E A;  3BCN A;  3B21 A;  2JQG R;  2Y6E A;  2BU3 A;  4ZTB A;  3QJ3 A;  3ZNH A;  1AU3 A;  2OUL A;  2AYO A;  3ZUA A;  1PVJ A;  1EWM A;  3O0U A;  3KWZ A;  5EGW A;  3PNR A;  4QH6 A;  4XR7 A;  1QDQ A;  2R9M A;  1U9X A;  5JH3 A;  4MSX A;  4PT5 A;  3PDF A;  1CQD A;  2DC7 A;  4BPV A;  5CVM A;  1KFU L;  1XKG A;  3E1Z B;  3HHA A;  5JA7 A;  3H6S A;  3H7D A;  1TL9 A;  4OEM A;  1CTE A;  1BQI A;  2UZJ A;  4OVZ A;  1NL6 A;  1BY8 A;  3P5U A;  3HHI A;  1NQC A;  4YYV A;  1YZB A;  1BP4 A;  2PRE A;  1YT7 A;  3IHP A;  4XZX A;  1NPZ A;  1PPO A;  3OQC A;  2JQF R;  4MI7 A;  2DOS A;  3K9M A;  1GMY A;  3N3G A;  4IUM A;  3V6E A;  1F29 A;  2IPP B;  2P7U A;  1ME3 A;  4QRG A;  4REZ A;  3AI8 A;  2HHN A;  3PHU A;  2FT2 A;  2E03 A;  4X6I A;  1KFX L;  2FRA A;  1SNK A;  1PCI A;  3PHW A;  1A6R A;  2HD5 A;  4M0W A;  3PRM A;  3H8C A;  1CPJ A;  1AU4 A;  1F2A A;  4BQV A;  2R9F A;  1KHP A;  4P6G A;  4QRX A;  3BC3 A;  1CVZ A;  1NB5 A;  2NQI A;  3W30 A;  1F2B A;  1AU0 A;  4P16 A;  2J7Q C;  4W5C A;  2G8J A;  2FO5 A;  1U9Q X;  2B1M A;  5E6J A;  3H8B A;  3O65 A;  3BBA A;  2FUD A;  2YJ2 A;  4I04 A;  4FJC A;  3RVX A;  3NHE A;  3OVX A;  1YAL A;  3MHS A;  4Q8H A;  1F2C A;  3LFY A;  1STF E;  1Y08 A;  4K7C A;  4W5B A;  4RY2 A;  3W31 A;  2HWK A;  3BB7 A;  3F75 A;  4AXM A;  3BWK A;  5CHT A;  1ZCM A;  2AU1 A;  1UKF A;  1PAD A;  1POP A;  4D8B A;  1AEC A;  2R6N A;  3WXF A;  2NQA A;  2BDZ A;  5KO3 A;  4DMX A;  3K24 A;  3V6C A;  8PCH A;  3GCB A;  1JQP A;  2C0Y A;  2VHS A;  4CDF B;  2AUX A;  4P6E A;  5CVO B;  3M99 A;  4YYQ A;  4YYW A;  2GFO A;  2NQG A;  4G54 A;  4X6H A;  2R9C A;  4D8I A;  4HXD B;  1GLO A;  2OZ2 A;  3P5V A;  4CDD B;  4CZW A;  2DZZ A;  2G7Y A;  2BTW A;  3B79 A;  4BS6 A;  1GCB A;  3I3T A;  4WUR A;  3IEJ A;  4BOQ A;  2XU1 A;  2E01 A;  1VJV A;  2FTD A;  1EF7 A;  2FE8 A;  2HH5 A;  3HWN A;  3KW9 A;  3C0R A;  1DKI A;  1EWO A;  3K8U A;  2FQ9 A;  5EF4 A;  4PP1 A;  3ERV A;  1KHQ A;  2CIO A;  4ZUX U;  3P5W A;  1O0E A;  3PRP A;  2H7J A;  2G6D A;  3PW3 A;  4N8W A;  2AVW A;  1PBH A;  4BOZ A;  5JZE A;  2GHU A;  3RVV A;  2NQD B;  3LXS A;  3BY4 A;  1GEC E;  3MP2 A;  1CB5 A;  1NB3 A;  1AYV A;  3P5X A;  1CJL A;  2O6X A;  1ATK A;  3CBJ A;  3KSE A;  4RF1 A;  2R9N A;  3PT2 A;  3OF8 A;  1YK7 A;  4A5U A;  4MM3 B;  2FRQ A;  2XU5 A;  2FYE A;  3KKU A;  2DC8 A;  4Q8G A;  1M6D A;  2WBF X;  3PSE A;  3N4C A;  4MZO A;  4BOS A;  2BTW B;  2AYN A;  3QSD A;  3TMP A;  1THE A;  2YJB A;  2PBH A;  2ACT A;  4YYR A;  1MEM A;  3IV2 A;  4HWY A;  4RKX A;  3E9S A;  4RNA A;  1AU2 A;  1S4V A;  1MDW A;  2J7Q A;  3N3K A;  4CDE B;  2ARY A;  6PAD A;  3MHH A;  4N4Z A;  4I05 A;  1QOL A;  1PE6 A;  2Y5B A;  2YJC A;  2HXZ A;  2R9O A;  3OIS A;  2DC6 A;  3KFQ A;  3WXE A;  3CBK A;  5FPW A;  2DCB A;  9PAP A;  7PCK A;  5CHV A;  2P0R A;  1IWD A;  1KXR A;  1PPN A;  4YYU A;  4DMY A;  1HUC B;  3CH3 X;  3CH2 X;  2DJG B;  4CDC B;  4W4U A;  1MS6 A;  2AIM A;  2B1N A;  2DJF B;  4YYS A;  5K16 A;  1U9V A;  1VSN A;  2DCC A;  3S3R A;  3MTV A;  3WXG A;  1Y4H A;  3IFU A;  1ICF A;  2JTC A;  3MOR A;  2DCA A;  2PNS A;  3OVZ A;  2F7D A;  1TLO A;  1AYW A;  1CV8 A;  2BDL A;  1YK8 A;  3I06 A;  3D6S A;  3IUT A;  3KX1 A;  4PI3 A;  2XU4 A;  3KWB X;  2YJ8 A;  4AXL A;  2DZY A;  1ITO A;  4KLB A;  1PPD A;  2F1G A;  4D8E A;  4FK5 A;  2AUZ A;  3USV A;  4BS5 A;  4PAD A;  3OF9 A;  2YJ9 A;  2G8E A;  4WA6 A;  5PAD A;  1EWP A;  5A24 A;  4OW0 A;  4X6J A;  3RVW A;  1PIP A;  3MTN A;  3IMA A;  3IOQ A;  2CB5 A;  1FH0 A;  3QT4 A;  3RNV A;  4IP3 A;  3MJ5 A;  2Z84 A;  3U8E A;  1YVB A;  1QMY A;  4BOP A;  4OVZ B;  1X9Y A;  4YVA A;  5J94 A;  2DCD A;  1DF0 A;  4OEL A;  4XUI A;  1MIR A;  1NLJ A;  2IBI A;  4QBB A;  1TU6 A;  3TRK A;  1U5I A;  5F02 A;  3S3Q A;  2ATO A;  1PXV A;  2E00 A;  1U9W A;  2AGA A;  2AS8 A;  2E02 A;  1QXP A;  3PBH A;  4R3D A;  4PP2 E;  3HD3 A;  2XU3 A;  1Q6K A;  2JRI A;  3O1G A;  1SP4 B;  1ME4 A;  3H89 A;  1CSB B;  5EZS A;  1CS8 A;  3BPM A;  1K3B B;  4BOU A;  1MEG A;  3PHX A;  2PAD A;  4QRV A; 
#chains in the Genus database with same CATH homology
 3E9S A;  4HXD B;  3MJ5 A;  1DKI A;  4P16 A;  4R3D A;  2J7Q C;  4GUA A;  2Z84 A;  4RNA A;  4D8B A;  3B21 A;  4ZTB A;  2BU3 A;  3PHW A;  4IUM A;  3ZNH A;  5E6J A;  4M0W A;  2J7Q A;  3PRP A;  3O65 A;  2BTW A;  3PRM A;  3BBA A;  3PSE A;  4RF0 A;  2UZJ A;  5KO3 A;  4BOP A;  4OVZ A;  4OVZ B;  4WUR A;  1PVJ A;  4BOS A;  4OW0 A;  2JRI A;  2BTW B;  4BOZ A;  4BOQ A;  5JZE A;  3TMP A;  3TRK A;  1YZB A;  4REZ A;  3PHU A;  5EZS A;  3W31 A;  3BB7 A;  3BY4 A;  2HWK A;  5EZQ A;  4D8I A;  3MP2 A;  3MTV A;  4BOU A;  4PT5 A;  2FE8 A;  3IFU A;  4XZX A;  4D8E A;  3RNV A;  3W30 A;  2AGA A;  2JTC A;  4RF1 A;  3OQC A;  3PT2 A;  3PHX A;  4A5U A;  1UKF A;  4MM3 B;  4IP3 A;  4MI7 A;  2DOS A;  3C0R A;  4RKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...