1NLJA

Crystal structure of the cysteine protease human cathepsin k in complex with a covalent azepanone inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN K
publication title Azepanone-Based Inhibitors of Human and Rat Cathepsin K
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2003-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1nljA00
2FRAA 3IUTA 5A24A 1CS8A 2R9CA 1U5IA 2JQGR 3CH3X 1U9VA 5EF4A 3QSDA 3H6SA 4CDEB 1PPNA 1EF7A 1ICFA 3PNRA 4QRGA 4HWYA 2DC6A 3H8CA 1BQIA 2XU3A 3N3GA 2ARYA 4OEMA 1ZIVA 5CVOB 2GFOA 3CBJA 3GCBA 1AECA 1TL9A 4PP1A 2DZZA 2R9OA 1AU2A 2FTDA 3RVXA 1NB3A 2O6XA 1U9XA 2R9NA 3BC3A 3N3KA 2DJGB 2ACTA 4N8WA 2AUZA 3PDFA 4CDDB 2YJBA 4G54A 1QMYA 4CDFB 2NQAA 1XKGA 5F02A 1GCBA 2E02A 3OF8A 3V6CA 3IHPA 2XU4A 1ME3A 1MS6A 3BCNA 1SNKA 1X9YA 4MZSA 2G6DA 2AS8A 1IWDA 4PADA 1CSBB 3BWKA 2AYNA 4FIPA 2AYOA 4OELA 1PBHA 3E1ZB 1NPZA 1PCIA 3MHSA 1MEMA 3HD3A 1MHWA 2DZYA 2CB5A 4N79A 4YV8A 3K9MA 5CHTA 2HHNA 4PI3A 3P5UA 1AIMA 2R9FA 4QBBA 1CQDA 2PADA 3U8EA 2FUDA 4AXLA 3KW9A 2C0YA 1YK7A 2PBHA 1FH0A 3QJ3A 5CHVA 2YJ8A 1ATKA 1POPA 4P6GA 4ZUXU 4DMYA 1AU3A 3KWZA 1STFE 5FPWA 3IV2A 1F29A 1KHPA 2HD5A 1VSNA 1JQPA 2FT2A 7PCKA 1NQCA 3P5XA 2CIOA 3P5WA 1CV8A 2AUXA 1GLOA 3IOQA 3IEJA 1BY8A 5JH3A 4QRVA 1MIRA 4BQVA 4X6HA 3H7DA 3PBHA 4I07A 4MZOA 1MEGA 2G7YA 3WXGA 3K8UA 1PPDA 3KWBX 1KHQA 4KLBA 3DF0A 1CJLA 4X6JA 1F2CA 4AXMA 2FRQA 3RVWA 4CDCB 3TNXA 3MORA 1NL6A 3KKUA 2YJCA 3H8BA 2YJ2A 2DJFB 1Y08A 2DCBA 2PREA 3MTNA 2DCCA 4YYSA 3BPMA 2FO5A 1DF0A 1PE6A 4I05A 2R9MA 2R6NA 2IBIA 3OVXA 1CVZA 2F1GA 3ZUAA 2HXZA 4RY2A 1AU0A 1KFXL 2G8JA 4BSQA 4YYRA 2Y6EA 3BOWA 1O0EA 2GHUA 1NLJA 1AYUA 2AVWA 2PNSA 3P5VA 3O1GA 3H89A 3USVA 2AU1A 2NQDB 4CZWA 9PAPA 1PXVA 1THEA 3V6EA 3HHAA 3HHIA 1BGOA 2IPPB 1TLOA 3S3RA 4W5BA 1PPOA 1YK8A 3S3QA 1EWMA 3D6SA 1A6RA 3F5VA 4W4UA 3IMAA 3OF9A 3O0UA 2OZ2A 2F7DA 4BS5A 1S4VA 3CBKA 1QXPA 4QH6A 2E01A 1KXRA 4YYQA 2BDLA 1F2AA 2XU1A 5JA7A 6PADA 2AIMA 4MSXA 4N4ZA 2OP3A 1U9QX 4P6EA 1Y4HA 4YYWA 2ATOA 2HH5A 1CPJA 2P7UA 3N4CA 1QOLA 2P86A 3K24A 1BP4A 5J94A 4PP2E 3WXFA 1CTEA 3F75A 3B79A 2E03A 4I04A 3I06A 1PPPA 3PW3A 3CH2X 4QRXA 4DMXA 1EWPA 3KFQA 1AYVA 3KX1A 2JQFR 1ZCMA 2P0RA 1VJVA 2E00A 3LXSA 5PADA 2YJ9A 1F2BA 1AYWA 1KFUL 4YVAA 2VHFA 1NB5A 2B1NA 1ITOA 2NQIA 2VHSA 3BPFA 1GECE 2XU5A 5CVNB 5CVMA 1U9WA 4W5CA 4X6IA 4BS6A 2DCDA 2B1MA 3M99A 4WA6A 2FYEA 1HUCB 4BPVA 2DC8A 3LFYA 1EWLA 3QT4A 4XR7A 4YYUA 3KSEA 2FQ9A 1PADA 1ME4A 3I3TA 3RVVA 3ERVA 4FK5A 1YVBA 3WXEA 2BDZA 1AU4A 1K3BB 3HWNA 1TU6A 1CB5A 1EWOA 4Q8HA 1MDWA 2H7JA 1DEUA 1SP4B 4FJCA 1GMYA 5EGWA 1Q6KA 1YT7A 3C9EA 3NHEA 4Q8GA 3OVZA 4YYVA 5K16A 2DCAA 8PCHA 1QDQA 3OISA 2NQGA 3AI8A 2WBFX 3MHHA 1M6DA 2OULA 4K7CA 2DC7A 2Y5BA 1YALA 2G8EA 1PIPA 4XUIA 2DC9A
chains in the Genus database with same CATH superfamily
2FRAA 3IUTA 3PRPA 5A24A 1CS8A 5E6JA 2R9CA 1U5IA 2J7QA 2JQGR 3CH3X 4D8IA 1U9VA 5EF4A 3QSDA 3H6SA 4CDEB 1PPNA 1EF7A 1ICFA 3PNRA 4QRGA 4HWYA 2DC6A 3H8CA 1BQIA 2XU3A 4BOZA 3N3GA 2ARYA 3BY4A 4OEMA 1ZIVA 5CVOB 3PT2A 4OW0A 2GFOA 3CBJA 3GCBA 4A5UA 1AECA 1TL9A 4PP1A 2DZZA 2HWKA 2R9OA 1AU2A 3PHUA 3OQCA 2FTDA 3RVXA 3TMPA 1NB3A 2O6XA 1U9XA 2R9NA 4RNAA 3BC3A 3N3KA 2DJGB 2ACTA 4N8WA 2AUZA 3PDFA 4CDDB 2YJBA 4G54A 1QMYA 4CDFB 2NQAA 1XKGA 5F02A 1GCBA 2E02A 3OF8A 3V6CA 3IHPA 2XU4A 1ME3A 1MS6A 3BCNA 1SNKA 1X9YA 4MZSA 2G6DA 2AS8A 1IWDA 1DKIA 4PADA 3BB7A 1CSBB 3BWKA 2AYNA 4FIPA 2AYOA 4OELA 1PBHA 3E1ZB 1NPZA 1PCIA 3MHSA 1MEMA 3HD3A 1MHWA 2DZYA 2CB5A 4N79A 3MJ5A 4YV8A 3W30A 3K9MA 5CHTA 4D8BA 2HHNA 3RNVA 4PI3A 3P5UA 1AIMA 2R9FA 4QBBA 1CQDA 2PADA 3U8EA 2FUDA 4M0WA 4RF1A 4AXLA 4D8EA 3KW9A 2C0YA 1YK7A 2PBHA 1FH0A 3QJ3A 5CHVA 2YJ8A 1ATKA 1POPA 4P6GA 4ZUXU 4DMYA 1AU3A 3KWZA 1STFE 4XZXA 5FPWA 3IV2A 1F29A 1KHPA 2HD5A 1VSNA 1JQPA 2FT2A 7PCKA 1NQCA 5EZSA 3P5XA 4BOPA 2CIOA 3P5WA 4MI7A 1CV8A 2AUXA 1GLOA 3IOQA 3IEJA 4GUAA 1BY8A 5JH3A 3W31A 4QRVA 1MIRA 4BQVA 4X6HA 3H7DA 3PBHA 4I07A 4MZOA 1MEGA 2G7YA 3WXGA 2BTWB 4OVZB 3K8UA 1PPDA 3KWBX 1KHQA 4KLBA 3DF0A 1CJLA 2BTWA 4WURA 4OVZA 4X6JA 1F2CA 4AXMA 2FRQA 4BOQA 3RVWA 4CDCB 5EZQA 3TNXA 3MORA 3TRKA 1NL6A 3KKUA 2YJCA 3H8BA 2YJ2A 2DJFB 1Y08A 2DCBA 2PREA 3MTNA 2DCCA 4YYSA 3BPMA 2FO5A 1DF0A 5JZEA 1PE6A 4I05A 2R9MA 2R6NA 2IBIA 3OVXA 1CVZA 2F1GA 4MM3B 3ZUAA 2HXZA 4RY2A 1AU0A 1KFXL 1UKFA 3MP2A 2G8JA 4REZA 4BSQA 4YYRA 2Y6EA 3BOWA 1O0EA 2GHUA 1NLJA 1AYUA 4PT5A 2AVWA 2PNSA 4P16A 3P5VA 3O1GA 3H89A 3USVA 2AU1A 2NQDB 4CZWA 9PAPA 1PXVA 1THEA 3V6EA 3HHAA 3HHIA 1BGOA 4ZTBA 2IPPB 1TLOA 3S3RA 4W5BA 1PPOA 1YK8A 3S3QA 1EWMA 3D6SA 4IP3A 3C0RA 1A6RA 3F5VA 4W4UA 3IMAA 3E9SA 3OF9A 4HXDB 2UZJA 3O0UA 2OZ2A 2F7DA 4BS5A 4RKXA 1S4VA 3CBKA 1QXPA 4QH6A 2E01A 1KXRA 4YYQA 2BDLA 1F2AA 1PVJA 2XU1A 5JA7A 6PADA 2AIMA 4MSXA 4N4ZA 2OP3A 1U9QX 4P6EA 1Y4HA 4YYWA 2ATOA 2HH5A 1CPJA 2P7UA 3N4CA 1QOLA 2P86A 3K24A 1BP4A 2Z84A 4PP2E 5J94A 4RF0A 3WXFA 1CTEA 3F75A 3B79A 2E03A 4I04A 3I06A 1PPPA 3PW3A 3CH2X 4QRXA 4DMXA 3BBAA 4IUMA 1EWPA 3KFQA 1AYVA 3KX1A 2JQFR 1ZCMA 2P0RA 1VJVA 2E00A 3LXSA 5PADA 2YJ9A 1F2BA 1AYWA 1KFUL 1YZBA 4YVAA 2BU3A 2VHFA 1NB5A 2B1NA 4BOUA 1ITOA 2NQIA 2VHSA 3BPFA 1GECE 2XU5A 5CVNB 5CVMA 1U9WA 4W5CA 4X6IA 4BS6A 2DCDA 2B1MA 3M99A 4WA6A 2JRIA 2FYEA 1HUCB 4BPVA 2J7QC 2DC8A 3LFYA 1EWLA 3QT4A 3ZNHA 4XR7A 4YYUA 3KSEA 2FQ9A 1PADA 1ME4A 3PSEA 3I3TA 3RVVA 3ERVA 4FK5A 1YVBA 3WXEA 2BDZA 3O65A 1AU4A 1K3BB 2AGAA 3HWNA 2JTCA 4BOSA 1TU6A 1CB5A 1EWOA 4Q8HA 1MDWA 2H7JA 5KO3A 1DEUA 2DOSA 2FE8A 1SP4B 4FJCA 3B21A 4R3DA 1GMYA 5EGWA 1Q6KA 1YT7A 3C9EA 3PRMA 3NHEA 4Q8GA 3OVZA 4YYVA 5K16A 2DCAA 3PHXA 8PCHA 1QDQA 3OISA 2NQGA 3AI8A 2WBFX 3PHWA 3MHHA 1M6DA 2OULA 3MTVA 4K7CA 2DC7A 3IFUA 2Y5BA 1YALA 2G8EA 1PIPA 4XUIA 2DC9A
chains in the Genus database with same CATH topology
2FRAA 3IUTA 5A24A 1CS8A 1W4TA 2R9CA 1U5IA 2JQGR 3CH3X 1U9VA 5EF4A 3QSDA 3H6SA 4CDEB 1PPNA 1EF7A 1ICFA 3PNRA 4QRGA 4HWYA 2DC6A 3H8CA 1BQIA 2XU3A 3N3GA 2ARYA 4OEMA 1ZIVA 5CVOB 2GFOA 3CBJA 3GCBA 1AECA 1TL9A 4PP1A 2DZZA 4B55A 2R9OA 1AU2A 2FTDA 3RVXA 1NB3A 2O6XA 1U9XA 2R9NA 3BC3A 3N3KA 2DJGB 2ACTA 4N8WA 2AUZA 3PDFA 4CDDB 2YJBA 4G54A 4C5PA 1QMYA 4CDFB 2NQAA 1XKGA 5F02A 1GCBA 2E02A 3OF8A 3V6CA 3IHPA 2XU4A 1ME3A 1W5RA 1MS6A 3BCNA 1SNKA 1X9YA 4MZSA 2G6DA 2AS8A 1IWDA 4PADA 1CSBB 3BWKA 2AYNA 4FIPA 2AYOA 4OELA 1PBHA 3E1ZB 1NPZA 1PCIA 3MHSA 1MEMA 3HD3A 1MHWA 2DZYA 2CB5A 4N79A 4YV8A 3K9MA 5CHTA 2HHNA 4PI3A 3P5UA 1AIMA 2R9FA 4QBBA 1CQDA 2PADA 3U8EA 2FUDA 2BSZA 4AXLA 4NV7A 3KW9A 2C0YA 1YK7A 2PBHA 1FH0A 3QJ3A 5CHVA 2YJ8A 1ATKA 1POPA 4P6GA 4ZUXU 1E2TA 4DMYA 1AU3A 3KWZA 1STFE 5FPWA 3IV2A 1F29A 1KHPA 2HD5A 1VSNA 1JQPA 2FT2A 7PCKA 1NQCA 3P5XA 2CIOA 3P5WA 1CV8A 2AUXA 1GLOA 3IOQA 3IEJA 1BY8A 5JH3A 4QRVA 1MIRA 4BQVA 4X6HA 3H7DA 3PBHA 4I07A 4MZOA 1MEGA 2G7YA 3WXGA 3K8UA 1PPDA 3KWBX 1KHQA 4KLBA 3DF0A 1CJLA 4X6JA 1F2CA 4AXMA 2FRQA 3RVWA 4CDCB 3TNXA 3MORA 1NL6A 3KKUA 2YJCA 3H8BA 2YJ2A 2DJFB 1Y08A 2DCBA 2PREA 3MTNA 2DCCA 3D9WA 4YYSA 3BPMA 4NV8A 2FO5A 1DF0A 1PE6A 4I05A 2R9MA 2R6NA 2IBIA 3OVXA 1CVZA 2F1GA 3ZUAA 2HXZA 4RY2A 1AU0A 1KFXL 2G8JA 4BSQA 4YYRA 2Y6EA 4BGFA 3BOWA 1O0EA 2GHUA 1NLJA 1AYUA 2AVWA 2PNSA 3P5VA 4GUZA 3O1GA 3H89A 3USVA 2AU1A 2NQDB 4CZWA 9PAPA 1PXVA 1THEA 3V6EA 3HHAA 3HHIA 1BGOA 2IPPB 1TLOA 3S3RA 4W5BA 1PPOA 1YK8A 3S3QA 1EWMA 3D6SA 1A6RA 3F5VA 4W4UA 3IMAA 3OF9A 3O0UA 2OZ2A 2F7DA 4BS5A 1S4VA 3CBKA 1QXPA 4QH6A 2E01A 1KXRA 4YYQA 2BDLA 1F2AA 2XU1A 5JA7A 6PADA 2AIMA 4MSXA 4N4ZA 2OP3A 1U9QX 4P6EA 1Y4HA 4YYWA 2ATOA 2HH5A 1CPJA 2P7UA 3N4CA 1QOLA 2P86A 3K24A 1BP4A 5J94A 4PP2E 3WXFA 1CTEA 3F75A 3B79A 2E03A 4I04A 3I06A 1PPPA 3PW3A 3CH2X 1GX3A 4QRXA 4DMXA 1EWPA 3KFQA 1AYVA 3KX1A 2JQFR 1ZCMA 2P0RA 1VJVA 2E00A 3LXSA 5PADA 2YJ9A 1F2BA 1AYWA 1KFUL 4YVAA 2VHFA 1NB5A 2B1NA 1ITOA 2NQIA 2VHSA 3BPFA 1GECE 2XU5A 5CVNB 5CVMA 1U9WA 4W5CA 4X6IA 4BS6A 2DCDA 2B1MA 3M99A 3LTWA 4WA6A 2FYEA 1HUCB 4BPVA 2DC8A 3LFYA 1EWLA 3QT4A 4XR7A 4YYUA 3KSEA 2FQ9A 1PADA 1ME4A 3I3TA 3RVVA 3ERVA 4FK5A 1YVBA 3WXEA 2BDZA 1AU4A 1K3BB 3HWNA 1TU6A 1CB5A 1EWOA 1W6FA 4Q8HA 1MDWA 2H7JA 1DEUA 1SP4B 4FJCA 1GMYA 5EGWA 1Q6KA 1YT7A 3C9EA 3NHEA 4Q8GA 2VFCA 2VFBA 3OVZA 4YYVA 5K16A 2DCAA 8PCHA 1QDQA 3OISA 2NQGA 3AI8A 2WBFX 3MHHA 1M6DA 2OULA 4K7CA 2DC7A 2Y5BA 1YALA 2G8EA 1PIPA 4XUIA 2DC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRA A;  3IUT A;  5A24 A;  1CS8 A;  2R9C A;  1U5I A;  2JQG R;  3CH3 X;  1U9V A;  5EF4 A;  3QSD A;  3H6S A;  4CDE B;  1PPN A;  1EF7 A;  1ICF A;  3PNR A;  4QRG A;  4HWY A;  2DC6 A;  3H8C A;  1BQI A;  2XU3 A;  3N3G A;  2ARY A;  4OEM A;  1ZIV A;  5CVO B;  2GFO A;  3CBJ A;  3GCB A;  1AEC A;  1TL9 A;  4PP1 A;  2DZZ A;  2R9O A;  1AU2 A;  2FTD A;  3RVX A;  1NB3 A;  2O6X A;  1U9X A;  2R9N A;  3BC3 A;  3N3K A;  2DJG B;  2ACT A;  4N8W A;  2AUZ A;  3PDF A;  4CDD B;  2YJB A;  4G54 A;  1QMY A;  4CDF B;  2NQA A;  1XKG A;  5F02 A;  1GCB A;  2E02 A;  3OF8 A;  3V6C A;  3IHP A;  2XU4 A;  1ME3 A;  1MS6 A;  3BCN A;  1SNK A;  1X9Y A;  4MZS A;  2G6D A;  2AS8 A;  1IWD A;  4PAD A;  1CSB B;  3BWK A;  2AYN A;  4FIP A;  2AYO A;  4OEL A;  1PBH A;  3E1Z B;  1NPZ A;  1PCI A;  3MHS A;  1MEM A;  3HD3 A;  1MHW A;  2DZY A;  2CB5 A;  4N79 A;  4YV8 A;  3K9M A;  5CHT A;  2HHN A;  4PI3 A;  3P5U A;  1AIM A;  2R9F A;  4QBB A;  1CQD A;  2PAD A;  3U8E A;  2FUD A;  4AXL A;  3KW9 A;  2C0Y A;  1YK7 A;  2PBH A;  1FH0 A;  3QJ3 A;  5CHV A;  2YJ8 A;  1ATK A;  1POP A;  4P6G A;  4ZUX U;  4DMY A;  1AU3 A;  3KWZ A;  1STF E;  5FPW A;  3IV2 A;  1F29 A;  1KHP A;  2HD5 A;  1VSN A;  1JQP A;  2FT2 A;  7PCK A;  1NQC A;  3P5X A;  2CIO A;  3P5W A;  1CV8 A;  2AUX A;  1GLO A;  3IOQ A;  3IEJ A;  1BY8 A;  5JH3 A;  4QRV A;  1MIR A;  4BQV A;  4X6H A;  3H7D A;  3PBH A;  4I07 A;  4MZO A;  1MEG A;  2G7Y A;  3WXG A;  3K8U A;  1PPD A;  3KWB X;  1KHQ A;  4KLB A;  3DF0 A;  1CJL A;  4X6J A;  1F2C A;  4AXM A;  2FRQ A;  3RVW A;  4CDC B;  3TNX A;  3MOR A;  1NL6 A;  3KKU A;  2YJC A;  3H8B A;  2YJ2 A;  2DJF B;  1Y08 A;  2DCB A;  2PRE A;  3MTN A;  2DCC A;  4YYS A;  3BPM A;  2FO5 A;  1DF0 A;  1PE6 A;  4I05 A;  2R9M A;  2R6N A;  2IBI A;  3OVX A;  1CVZ A;  2F1G A;  3ZUA A;  2HXZ A;  4RY2 A;  1AU0 A;  1KFX L;  2G8J A;  4BSQ A;  4YYR A;  2Y6E A;  3BOW A;  1O0E A;  2GHU A;  1NLJ A;  1AYU A;  2AVW A;  2PNS A;  3P5V A;  3O1G A;  3H89 A;  3USV A;  2AU1 A;  2NQD B;  4CZW A;  9PAP A;  1PXV A;  1THE A;  3V6E A;  3HHA A;  3HHI A;  1BGO A;  2IPP B;  1TLO A;  3S3R A;  4W5B A;  1PPO A;  1YK8 A;  3S3Q A;  1EWM A;  3D6S A;  1A6R A;  3F5V A;  4W4U A;  3IMA A;  3OF9 A;  3O0U A;  2OZ2 A;  2F7D A;  4BS5 A;  1S4V A;  3CBK A;  1QXP A;  4QH6 A;  2E01 A;  1KXR A;  4YYQ A;  2BDL A;  1F2A A;  2XU1 A;  5JA7 A;  6PAD A;  2AIM A;  4MSX A;  4N4Z A;  2OP3 A;  1U9Q X;  4P6E A;  1Y4H A;  4YYW A;  2ATO A;  2HH5 A;  1CPJ A;  2P7U A;  3N4C A;  1QOL A;  2P86 A;  3K24 A;  1BP4 A;  5J94 A;  4PP2 E;  3WXF A;  1CTE A;  3F75 A;  3B79 A;  2E03 A;  4I04 A;  3I06 A;  1PPP A;  3PW3 A;  3CH2 X;  4QRX A;  4DMX A;  1EWP A;  3KFQ A;  1AYV A;  3KX1 A;  2JQF R;  1ZCM A;  2P0R A;  1VJV A;  2E00 A;  3LXS A;  5PAD A;  2YJ9 A;  1F2B A;  1AYW A;  1KFU L;  4YVA A;  2VHF A;  1NB5 A;  2B1N A;  1ITO A;  2NQI A;  2VHS A;  3BPF A;  1GEC E;  2XU5 A;  5CVN B;  5CVM A;  1U9W A;  4W5C A;  4X6I A;  4BS6 A;  2DCD A;  2B1M A;  3M99 A;  4WA6 A;  2FYE A;  1HUC B;  4BPV A;  2DC8 A;  3LFY A;  1EWL A;  3QT4 A;  4XR7 A;  4YYU A;  3KSE A;  2FQ9 A;  1PAD A;  1ME4 A;  3I3T A;  3RVV A;  3ERV A;  4FK5 A;  1YVB A;  3WXE A;  2BDZ A;  1AU4 A;  1K3B B;  3HWN A;  1TU6 A;  1CB5 A;  1EWO A;  4Q8H A;  1MDW A;  2H7J A;  1DEU A;  1SP4 B;  4FJC A;  1GMY A;  5EGW A;  1Q6K A;  1YT7 A;  3C9E A;  3NHE A;  4Q8G A;  3OVZ A;  4YYV A;  5K16 A;  2DCA A;  8PCH A;  1QDQ A;  3OIS A;  2NQG A;  3AI8 A;  2WBF X;  3MHH A;  1M6D A;  2OUL A;  4K7C A;  2DC7 A;  2Y5B A;  1YAL A;  2G8E A;  1PIP A;  4XUI A;  2DC9 A; 
#chains in the Genus database with same CATH topology
 2FRA A;  3IUT A;  3PRP A;  5A24 A;  1CS8 A;  5E6J A;  2R9C A;  1U5I A;  2J7Q A;  2JQG R;  3CH3 X;  4D8I A;  1U9V A;  5EF4 A;  3QSD A;  3H6S A;  4CDE B;  1PPN A;  1EF7 A;  1ICF A;  3PNR A;  4QRG A;  4HWY A;  2DC6 A;  3H8C A;  1BQI A;  2XU3 A;  4BOZ A;  3N3G A;  2ARY A;  3BY4 A;  4OEM A;  1ZIV A;  5CVO B;  3PT2 A;  4OW0 A;  2GFO A;  3CBJ A;  3GCB A;  4A5U A;  1AEC A;  1TL9 A;  4PP1 A;  2DZZ A;  2HWK A;  2R9O A;  1AU2 A;  3PHU A;  3OQC A;  2FTD A;  3RVX A;  3TMP A;  1NB3 A;  2O6X A;  1U9X A;  2R9N A;  4RNA A;  3BC3 A;  3N3K A;  2DJG B;  2ACT A;  4N8W A;  2AUZ A;  3PDF A;  4CDD B;  2YJB A;  4G54 A;  1QMY A;  4CDF B;  2NQA A;  1XKG A;  5F02 A;  1GCB A;  2E02 A;  3OF8 A;  3V6C A;  3IHP A;  2XU4 A;  1ME3 A;  1MS6 A;  3BCN A;  1SNK A;  1X9Y A;  4MZS A;  2G6D A;  2AS8 A;  1IWD A;  1DKI A;  4PAD A;  3BB7 A;  1CSB B;  3BWK A;  2AYN A;  4FIP A;  2AYO A;  4OEL A;  1PBH A;  3E1Z B;  1NPZ A;  1PCI A;  3MHS A;  1MEM A;  3HD3 A;  1MHW A;  2DZY A;  2CB5 A;  4N79 A;  3MJ5 A;  4YV8 A;  3W30 A;  3K9M A;  5CHT A;  4D8B A;  2HHN A;  3RNV A;  4PI3 A;  3P5U A;  1AIM A;  2R9F A;  4QBB A;  1CQD A;  2PAD A;  3U8E A;  2FUD A;  4M0W A;  4RF1 A;  4AXL A;  4D8E A;  3KW9 A;  2C0Y A;  1YK7 A;  2PBH A;  1FH0 A;  3QJ3 A;  5CHV A;  2YJ8 A;  1ATK A;  1POP A;  4P6G A;  4ZUX U;  4DMY A;  1AU3 A;  3KWZ A;  1STF E;  4XZX A;  5FPW A;  3IV2 A;  1F29 A;  1KHP A;  2HD5 A;  1VSN A;  1JQP A;  2FT2 A;  7PCK A;  1NQC A;  5EZS A;  3P5X A;  4BOP A;  2CIO A;  3P5W A;  4MI7 A;  1CV8 A;  2AUX A;  1GLO A;  3IOQ A;  3IEJ A;  4GUA A;  1BY8 A;  5JH3 A;  3W31 A;  4QRV A;  1MIR A;  4BQV A;  4X6H A;  3H7D A;  3PBH A;  4I07 A;  4MZO A;  1MEG A;  2G7Y A;  3WXG A;  2BTW B;  4OVZ B;  3K8U A;  1PPD A;  3KWB X;  1KHQ A;  4KLB A;  3DF0 A;  1CJL A;  2BTW A;  4WUR A;  4OVZ A;  4X6J A;  1F2C A;  4AXM A;  2FRQ A;  4BOQ A;  3RVW A;  4CDC B;  5EZQ A;  3TNX A;  3MOR A;  3TRK A;  1NL6 A;  3KKU A;  2YJC A;  3H8B A;  2YJ2 A;  2DJF B;  1Y08 A;  2DCB A;  2PRE A;  3MTN A;  2DCC A;  4YYS A;  3BPM A;  2FO5 A;  1DF0 A;  5JZE A;  1PE6 A;  4I05 A;  2R9M A;  2R6N A;  2IBI A;  3OVX A;  1CVZ A;  2F1G A;  4MM3 B;  3ZUA A;  2HXZ A;  4RY2 A;  1AU0 A;  1KFX L;  1UKF A;  3MP2 A;  2G8J A;  4REZ A;  4BSQ A;  4YYR A;  2Y6E A;  3BOW A;  1O0E A;  2GHU A;  1NLJ A;  1AYU A;  4PT5 A;  2AVW A;  2PNS A;  4P16 A;  3P5V A;  3O1G A;  3H89 A;  3USV A;  2AU1 A;  2NQD B;  4CZW A;  9PAP A;  1PXV A;  1THE A;  3V6E A;  3HHA A;  3HHI A;  1BGO A;  4ZTB A;  2IPP B;  1TLO A;  3S3R A;  4W5B A;  1PPO A;  1YK8 A;  3S3Q A;  1EWM A;  3D6S A;  4IP3 A;  3C0R A;  1A6R A;  3F5V A;  4W4U A;  3IMA A;  3E9S A;  3OF9 A;  4HXD B;  2UZJ A;  3O0U A;  2OZ2 A;  2F7D A;  4BS5 A;  4RKX A;  1S4V A;  3CBK A;  1QXP A;  4QH6 A;  2E01 A;  1KXR A;  4YYQ A;  2BDL A;  1F2A A;  1PVJ A;  2XU1 A;  5JA7 A;  6PAD A;  2AIM A;  4MSX A;  4N4Z A;  2OP3 A;  1U9Q X;  4P6E A;  1Y4H A;  4YYW A;  2ATO A;  2HH5 A;  1CPJ A;  2P7U A;  3N4C A;  1QOL A;  2P86 A;  3K24 A;  1BP4 A;  2Z84 A;  4PP2 E;  5J94 A;  4RF0 A;  3WXF A;  1CTE A;  3F75 A;  3B79 A;  2E03 A;  4I04 A;  3I06 A;  1PPP A;  3PW3 A;  3CH2 X;  4QRX A;  4DMX A;  3BBA A;  4IUM A;  1EWP A;  3KFQ A;  1AYV A;  3KX1 A;  2JQF R;  1ZCM A;  2P0R A;  1VJV A;  2E00 A;  3LXS A;  5PAD A;  2YJ9 A;  1F2B A;  1AYW A;  1KFU L;  1YZB A;  4YVA A;  2BU3 A;  2VHF A;  1NB5 A;  2B1N A;  4BOU A;  1ITO A;  2NQI A;  2VHS A;  3BPF A;  1GEC E;  2XU5 A;  5CVN B;  5CVM A;  1U9W A;  4W5C A;  4X6I A;  4BS6 A;  2DCD A;  2B1M A;  3M99 A;  4WA6 A;  2JRI A;  2FYE A;  1HUC B;  4BPV A;  2J7Q C;  2DC8 A;  3LFY A;  1EWL A;  3QT4 A;  3ZNH A;  4XR7 A;  4YYU A;  3KSE A;  2FQ9 A;  1PAD A;  1ME4 A;  3PSE A;  3I3T A;  3RVV A;  3ERV A;  4FK5 A;  1YVB A;  3WXE A;  2BDZ A;  3O65 A;  1AU4 A;  1K3B B;  2AGA A;  3HWN A;  2JTC A;  4BOS A;  1TU6 A;  1CB5 A;  1EWO A;  4Q8H A;  1MDW A;  2H7J A;  5KO3 A;  1DEU A;  2DOS A;  2FE8 A;  1SP4 B;  4FJC A;  3B21 A;  4R3D A;  1GMY A;  5EGW A;  1Q6K A;  1YT7 A;  3C9E A;  3PRM A;  3NHE A;  4Q8G A;  3OVZ A;  4YYV A;  5K16 A;  2DCA A;  3PHX A;  8PCH A;  1QDQ A;  3OIS A;  2NQG A;  3AI8 A;  2WBF X;  3PHW A;  3MHH A;  1M6D A;  2OUL A;  3MTV A;  4K7C A;  2DC7 A;  3IFU A;  2Y5B A;  1YAL A;  2G8E A;  1PIP A;  4XUI A;  2DC9 A; 
#chains in the Genus database with same CATH homology
 2FRA A;  3IUT A;  5A24 A;  1CS8 A;  1W4T A;  2R9C A;  1U5I A;  2JQG R;  3CH3 X;  1U9V A;  5EF4 A;  3QSD A;  3H6S A;  4CDE B;  1PPN A;  1EF7 A;  1ICF A;  3PNR A;  4QRG A;  4HWY A;  2DC6 A;  3H8C A;  1BQI A;  2XU3 A;  3N3G A;  2ARY A;  4OEM A;  1ZIV A;  5CVO B;  2GFO A;  3CBJ A;  3GCB A;  1AEC A;  1TL9 A;  4PP1 A;  2DZZ A;  4B55 A;  2R9O A;  1AU2 A;  2FTD A;  3RVX A;  1NB3 A;  2O6X A;  1U9X A;  2R9N A;  3BC3 A;  3N3K A;  2DJG B;  2ACT A;  4N8W A;  2AUZ A;  3PDF A;  4CDD B;  2YJB A;  4G54 A;  4C5P A;  1QMY A;  4CDF B;  2NQA A;  1XKG A;  5F02 A;  1GCB A;  2E02 A;  3OF8 A;  3V6C A;  3IHP A;  2XU4 A;  1ME3 A;  1W5R A;  1MS6 A;  3BCN A;  1SNK A;  1X9Y A;  4MZS A;  2G6D A;  2AS8 A;  1IWD A;  4PAD A;  1CSB B;  3BWK A;  2AYN A;  4FIP A;  2AYO A;  4OEL A;  1PBH A;  3E1Z B;  1NPZ A;  1PCI A;  3MHS A;  1MEM A;  3HD3 A;  1MHW A;  2DZY A;  2CB5 A;  4N79 A;  4YV8 A;  3K9M A;  5CHT A;  2HHN A;  4PI3 A;  3P5U A;  1AIM A;  2R9F A;  4QBB A;  1CQD A;  2PAD A;  3U8E A;  2FUD A;  2BSZ A;  4AXL A;  4NV7 A;  3KW9 A;  2C0Y A;  1YK7 A;  2PBH A;  1FH0 A;  3QJ3 A;  5CHV A;  2YJ8 A;  1ATK A;  1POP A;  4P6G A;  4ZUX U;  1E2T A;  4DMY A;  1AU3 A;  3KWZ A;  1STF E;  5FPW A;  3IV2 A;  1F29 A;  1KHP A;  2HD5 A;  1VSN A;  1JQP A;  2FT2 A;  7PCK A;  1NQC A;  3P5X A;  2CIO A;  3P5W A;  1CV8 A;  2AUX A;  1GLO A;  3IOQ A;  3IEJ A;  1BY8 A;  5JH3 A;  4QRV A;  1MIR A;  4BQV A;  4X6H A;  3H7D A;  3PBH A;  4I07 A;  4MZO A;  1MEG A;  2G7Y A;  3WXG A;  3K8U A;  1PPD A;  3KWB X;  1KHQ A;  4KLB A;  3DF0 A;  1CJL A;  4X6J A;  1F2C A;  4AXM A;  2FRQ A;  3RVW A;  4CDC B;  3TNX A;  3MOR A;  1NL6 A;  3KKU A;  2YJC A;  3H8B A;  2YJ2 A;  2DJF B;  1Y08 A;  2DCB A;  2PRE A;  3MTN A;  2DCC A;  3D9W A;  4YYS A;  3BPM A;  4NV8 A;  2FO5 A;  1DF0 A;  1PE6 A;  4I05 A;  2R9M A;  2R6N A;  2IBI A;  3OVX A;  1CVZ A;  2F1G A;  3ZUA A;  2HXZ A;  4RY2 A;  1AU0 A;  1KFX L;  2G8J A;  4BSQ A;  4YYR A;  2Y6E A;  4BGF A;  3BOW A;  1O0E A;  2GHU A;  1NLJ A;  1AYU A;  2AVW A;  2PNS A;  3P5V A;  4GUZ A;  3O1G A;  3H89 A;  3USV A;  2AU1 A;  2NQD B;  4CZW A;  9PAP A;  1PXV A;  1THE A;  3V6E A;  3HHA A;  3HHI A;  1BGO A;  2IPP B;  1TLO A;  3S3R A;  4W5B A;  1PPO A;  1YK8 A;  3S3Q A;  1EWM A;  3D6S A;  1A6R A;  3F5V A;  4W4U A;  3IMA A;  3OF9 A;  3O0U A;  2OZ2 A;  2F7D A;  4BS5 A;  1S4V A;  3CBK A;  1QXP A;  4QH6 A;  2E01 A;  1KXR A;  4YYQ A;  2BDL A;  1F2A A;  2XU1 A;  5JA7 A;  6PAD A;  2AIM A;  4MSX A;  4N4Z A;  2OP3 A;  1U9Q X;  4P6E A;  1Y4H A;  4YYW A;  2ATO A;  2HH5 A;  1CPJ A;  2P7U A;  3N4C A;  1QOL A;  2P86 A;  3K24 A;  1BP4 A;  5J94 A;  4PP2 E;  3WXF A;  1CTE A;  3F75 A;  3B79 A;  2E03 A;  4I04 A;  3I06 A;  1PPP A;  3PW3 A;  3CH2 X;  1GX3 A;  4QRX A;  4DMX A;  1EWP A;  3KFQ A;  1AYV A;  3KX1 A;  2JQF R;  1ZCM A;  2P0R A;  1VJV A;  2E00 A;  3LXS A;  5PAD A;  2YJ9 A;  1F2B A;  1AYW A;  1KFU L;  4YVA A;  2VHF A;  1NB5 A;  2B1N A;  1ITO A;  2NQI A;  2VHS A;  3BPF A;  1GEC E;  2XU5 A;  5CVN B;  5CVM A;  1U9W A;  4W5C A;  4X6I A;  4BS6 A;  2DCD A;  2B1M A;  3M99 A;  3LTW A;  4WA6 A;  2FYE A;  1HUC B;  4BPV A;  2DC8 A;  3LFY A;  1EWL A;  3QT4 A;  4XR7 A;  4YYU A;  3KSE A;  2FQ9 A;  1PAD A;  1ME4 A;  3I3T A;  3RVV A;  3ERV A;  4FK5 A;  1YVB A;  3WXE A;  2BDZ A;  1AU4 A;  1K3B B;  3HWN A;  1TU6 A;  1CB5 A;  1EWO A;  1W6F A;  4Q8H A;  1MDW A;  2H7J A;  1DEU A;  1SP4 B;  4FJC A;  1GMY A;  5EGW A;  1Q6K A;  1YT7 A;  3C9E A;  3NHE A;  4Q8G A;  2VFC A;  2VFB A;  3OVZ A;  4YYV A;  5K16 A;  2DCA A;  8PCH A;  1QDQ A;  3OIS A;  2NQG A;  3AI8 A;  2WBF X;  3MHH A;  1M6D A;  2OUL A;  4K7C A;  2DC7 A;  2Y5B A;  1YAL A;  2G8E A;  1PIP A;  4XUI A;  2DC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...