3CH2X

Crystal structure analysis of sera5e from plasmodium falciparum
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
265
structure length
256
Chain Sequence
NMFCNKEYCNRLKDENNCISNLQVEDQGNCDTSWIFASKYHLETIRCMKGYEPTKISALYVANCYKGEHKDRCDEGSSPMEFLQIIEDYGFLPAESNYPYNYVKVGEQCPKVEDHWMNLWDNGKILHGKGYTAYESERFHDNMDAFVKIIKTEVMNKGSVIAYIKAENVMGYEFSGKKVQNLCGDDTADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPYWGDEGYFKVDMYGPTHCHFNFIHSVVIFNVDLPMNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Serine-repeat antigen protein
publication title Structural Insights into the Protease-like Antigen Plasmodium falciparum SERA5 and Its Noncanonical Active-Site Serine
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 74
structure length 256
sequence length 265
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3ch2X00
3I06A 1AIMA 1MHWA 2VHFA 4MZSA 1SNKA 1TU6A 1U9QX 2DCCA 2AIMA 2IBIA 1K3BB 4Q8HA 5J94A 3P5VA 3BPMA 3IV2A 4AXLA 2BDZA 3MORA 4FK5A 5JH3A 1POPA 1DF0A 3HD3A 1DEUA 4QRGA 1QMYA 3ZUAA 5F02A 3E1ZB 1BGOA 2F1GA 2H7JA 2CIOA 1PE6A 1NLJA 4PP2E 3PBHA 2DC6A 2P7UA 2R9FA 1AECA 3S3QA 2PADA 4PADA 1EWOA 3H6SA 4FJCA 4CZWA 3KX1A 2ATOA 1ATKA 5PADA 2GFOA 1MS6A 4BSQA 5JA7A 1BY8A 3U8EA 1AYWA 3QSDA 3WXEA 1PADA 2G6DA 1AYVA 2XU4A 2AVWA 2G8JA 5EF4A 1KFXL 4QBBA 3WXFA 2JQFR 4Q8GA 3PW3A 2HXZA 3QT4A 3CH2X 2NQGA 1ME4A 3IMAA 4WA6A 1BQIA 1YT7A 2PNSA 2DZYA 1U9XA 1M6DA 1F2AA 1SP4B 2XU1A 1QOLA 2B1NA 1CJLA 4KLBA 4QH6A 4N79A 1ZIVA 2YJ2A 3CBJA 1THEA 2B1MA 5EGWA 1EWLA 1PPOA 2FYEA 4HWYA 1KFUL 2IPPB 1CSBB 3IHPA 1CVZA 1KHPA 3O0UA 3K9MA 2OZ2A 2AU1A 4P6GA 3IOQA 4QRXA 2Y5BA 4X6IA 1IWDA 2OULA 1QDQA 2R9MA 3N3KA 2WBFX 2HHNA 4K7CA 4CDFB 2VHSA 4N4ZA 2PBHA 4PP1A 2OP3A 1CV8A 3NHEA 1O0EA 1FH0A 3KFQA 3KWBX 1GCBA 3V6EA 3CBKA 2FRQA 3RVVA 3HWNA 1NPZA 4G54A 5FPWA 5CHTA 3K24A 2AUXA 4CDDB 1A6RA 3MHHA 1PIPA 3BWKA 4ZUXU 2HD5A 2YJ8A 3H89A 8PCHA 2DZZA 1NQCA 2NQDB 1NB3A 1STFE 3AI8A 1HUCB 4X6HA 3OISA 2JQGR 2R9OA 1PPNA 2R9CA 3F75A 5CVMA 1PPPA 2P0RA 3K8UA 4BQVA 3IUTA 3P5UA 1KHQA 2O6XA 1TLOA 3HHIA 3M99A 1U5IA 4N8WA 1EF7A 3TNXA 2FUDA 4W5BA 7PCKA 4MSXA 3IEJA 4W4UA 3KKUA 1CQDA 5CHVA 3P5XA 2GHUA 4YYSA 1CS8A 1NL6A 4YYVA 1AU2A 3D6SA 4PI3A 1AU3A 2AUZA 4BPVA 4AXMA 1F2BA 3RVXA 3GCBA 2YJCA 4OELA 4YYWA 2FT2A 1YALA 1Y08A 1AYUA 2FO5A 4P6EA 2YJBA 4W5CA 3N3GA 1EWMA 3MTNA 4BS5A 1YK8A 1F2CA 1PCIA 2PREA 3MHSA 2DC9A 1U9VA 3HHAA 1AU4A 4CDEB 2BDLA 1GLOA 3WXGA 1XKGA 2E02A 2E00A 4QRVA 1PPDA 1Q6KA 3BC3A 4YYUA 6PADA 4OEMA 1PBHA 1EWPA 3P5WA 5K16A 3S3RA 1YVBA 3OVZA 4XUIA 3I3TA 2G7YA 1ZCMA 1U9WA 4DMXA 9PAPA 2E03A 1GMYA 1ME3A 3BCNA 3BPFA 3USVA 4MZOA 2NQIA 2DCBA 2NQAA 2E01A 2ARYA 2DC7A 3F5VA 3H8BA 3H7DA 1ITOA 1CTEA 2XU3A 1Y4HA 2R9NA 5A24A 3ERVA 3PDFA 2FRAA 2DCAA 2R6NA 4YYQA 1X9YA 4I05A 3B79A 2YJ9A 4I07A 4XR7A 2AYOA 2C0YA 3C9EA 2DC8A 3OF9A 3RVWA 2Y6EA 2G8EA 3KWZA 1VJVA 5CVOB 3N4CA 1BP4A 4DMYA 3LFYA 1MIRA 4X6JA 1MDWA 5CVNB 4FIPA 3OF8A 4YV8A 2DJFB 3H8CA 3LXSA 1PXVA 1AU0A 3QJ3A 2DCDA 3CH3X 3DF0A 2ACTA 1S4VA 2XU5A 1F29A 4CDCB 1CPJA 1VSNA 2CB5A 1ICFA 4BS6A 2HH5A 2F7DA 2P86A 1CB5A 4I04A 3BOWA 2FQ9A 2AYNA 3OVXA 3O1GA 1YK7A 1MEGA 1MEMA 3V6CA 2FTDA 2DJGB 1GECE 3PNRA 1JQPA 1TL9A 3KSEA 3KW9A 1QXPA 4RY2A 4YVAA 1NB5A 2AS8A 1KXRA 4YYRA
chains in the Genus database with same CATH superfamily
3I06A 1AIMA 1MHWA 2FE8A 2VHFA 4MZSA 1SNKA 1TU6A 1U9QX 2DCCA 2AIMA 2IBIA 1K3BB 4Q8HA 5J94A 3P5VA 3BPMA 3IV2A 4AXLA 2BDZA 3MORA 4FK5A 5JH3A 1POPA 1DF0A 3HD3A 1DEUA 4QRGA 1QMYA 3ZUAA 3C0RA 5F02A 1YZBA 3PRPA 3E1ZB 1BGOA 2F1GA 2H7JA 2CIOA 1PE6A 1NLJA 4PP2E 4D8EA 3PBHA 2DC6A 2P7UA 2R9FA 1AECA 3S3QA 2PADA 4PADA 1EWOA 3H6SA 4FJCA 4BOSA 3PRMA 4CZWA 3KX1A 2ATOA 1ATKA 4D8BA 5PADA 2GFOA 1MS6A 4BSQA 5JA7A 1BY8A 3U8EA 1AYWA 3QSDA 3WXEA 5JZEA 1PADA 2G6DA 1AYVA 2XU4A 2AVWA 2G8JA 5EF4A 1KFXL 4QBBA 3WXFA 4IUMA 2JQFR 4Q8GA 3PW3A 2HXZA 4P16A 4IP3A 3QT4A 3CH2X 4BOQA 2NQGA 1ME4A 3IMAA 4WA6A 1BQIA 1YT7A 2PNSA 2DZYA 4REZA 1U9XA 4MM3B 1M6DA 1F2AA 4M0WA 1SP4B 2XU1A 1QOLA 2JTCA 4RKXA 2B1NA 1CJLA 4KLBA 4GUAA 2Z84A 4QH6A 4N79A 1ZIVA 2YJ2A 3CBJA 3MJ5A 2AGAA 1THEA 2B1MA 5EGWA 3RNVA 1EWLA 1PPOA 2FYEA 3BBAA 4HWYA 1KFUL 2IPPB 4D8IA 1CSBB 3IHPA 3BY4A 1CVZA 1KHPA 3OQCA 3O0UA 3K9MA 3PSEA 2OZ2A 2AU1A 4P6GA 1PVJA 3IOQA 4QRXA 2Y5BA 2BU3A 4X6IA 1IWDA 2OULA 1QDQA 3TRKA 2R9MA 3N3KA 2WBFX 2HHNA 4K7CA 4CDFB 2VHSA 4N4ZA 2PBHA 4PP1A 2OP3A 4OVZB 1CV8A 3NHEA 1O0EA 1FH0A 2JRIA 3KFQA 3KWBX 1GCBA 3V6EA 3CBKA 2FRQA 4MI7A 3RVVA 3HWNA 1NPZA 3IFUA 4G54A 2UZJA 5FPWA 5CHTA 3K24A 2AUXA 4CDDB 1A6RA 3MHHA 1PIPA 3BWKA 4ZUXU 2HD5A 2YJ8A 3H89A 8PCHA 2DZZA 1NQCA 2NQDB 1NB3A 1STFE 3AI8A 1HUCB 4X6HA 3OISA 4ZTBA 2JQGR 2R9OA 1PPNA 2R9CA 2DOSA 3F75A 3TMPA 2J7QC 1PPPA 5CVMA 4HXDB 2P0RA 3K8UA 4BQVA 3IUTA 3P5UA 1KHQA 2O6XA 3E9SA 1TLOA 3HHIA 3M99A 1U5IA 4N8WA 1EF7A 3TNXA 2HWKA 3O65A 2FUDA 4W5BA 7PCKA 4MSXA 4OVZA 3IEJA 4W4UA 3KKUA 1CQDA 5CHVA 3P5XA 2GHUA 4YYSA 1CS8A 1NL6A 4YYVA 1AU2A 4WURA 3D6SA 4PI3A 1AU3A 2AUZA 4BPVA 4AXMA 3BB7A 1F2BA 3RVXA 3GCBA 2YJCA 4OELA 3MP2A 4YYWA 4PT5A 2FT2A 1YALA 1Y08A 1AYUA 2FO5A 4P6EA 2YJBA 4W5CA 4R3DA 4XZXA 3N3GA 1EWMA 4RF0A 3MTNA 4BS5A 1YK8A 1F2CA 1PCIA 3MTVA 2PREA 3MHSA 2DC9A 1U9VA 3HHAA 5EZSA 1AU4A 4CDEB 2BDLA 2BTWB 1GLOA 3WXGA 1XKGA 2E02A 2E00A 4QRVA 4RF1A 1PPDA 3PHXA 1Q6KA 3BC3A 4YYUA 6PADA 4OEMA 1PBHA 1EWPA 3P5WA 5K16A 3S3RA 4BOUA 1YVBA 3OVZA 4XUIA 3I3TA 2G7YA 1ZCMA 1U9WA 4BOZA 4DMXA 9PAPA 2E03A 1GMYA 1ME3A 3BCNA 3BPFA 3USVA 4MZOA 2NQIA 2DCBA 2NQAA 2E01A 2ARYA 2DC7A 3F5VA 3H8BA 3H7DA 1ITOA 1CTEA 2XU3A 1Y4HA 2R9NA 5A24A 3ERVA 3PDFA 2FRAA 2DCAA 2R6NA 4YYQA 1X9YA 3W31A 2J7QA 3B21A 3W30A 4I05A 2BTWA 3B79A 2YJ9A 4I07A 4XR7A 2AYOA 3PT2A 2C0YA 3C9EA 2DC8A 3OF9A 3RVWA 2Y6EA 2G8EA 3KWZA 1VJVA 5CVOB 3N4CA 1BP4A 4DMYA 3LFYA 1MIRA 4X6JA 1DKIA 1MDWA 5CVNB 4FIPA 3OF8A 4YV8A 2DJFB 3ZNHA 3H8CA 3LXSA 1PXVA 1AU0A 3QJ3A 2DCDA 3CH3X 3DF0A 2ACTA 3PHUA 1S4VA 2XU5A 1F29A 4CDCB 1CPJA 1VSNA 2CB5A 1ICFA 4BS6A 2HH5A 2F7DA 4RNAA 2P86A 1CB5A 5KO3A 3PHWA 4I04A 5E6JA 4A5UA 3BOWA 2FQ9A 2AYNA 3OVXA 1UKFA 3O1GA 4OW0A 1YK7A 1MEGA 1MEMA 5EZQA 3V6CA 2FTDA 2DJGB 1GECE 3PNRA 1JQPA 1TL9A 3KSEA 3KW9A 1QXPA 4RY2A 4YVAA 1NB5A 2AS8A 4BOPA 1KXRA 4YYRA
chains in the Genus database with same CATH topology
3I06A 1AIMA 1MHWA 2VHFA 4BGFA 4MZSA 1SNKA 1TU6A 1U9QX 2DCCA 2AIMA 2IBIA 1K3BB 4Q8HA 5J94A 3P5VA 3BPMA 3IV2A 4AXLA 2BDZA 3MORA 4FK5A 5JH3A 1POPA 1DF0A 3HD3A 1DEUA 3LTWA 4QRGA 1QMYA 3ZUAA 5F02A 3E1ZB 1BGOA 2F1GA 2H7JA 2CIOA 1PE6A 1NLJA 4PP2E 3PBHA 2DC6A 2P7UA 2R9FA 1AECA 3S3QA 2PADA 4PADA 1EWOA 3H6SA 4FJCA 2VFCA 4CZWA 3KX1A 2ATOA 1ATKA 5PADA 2GFOA 1MS6A 4BSQA 5JA7A 1BY8A 3U8EA 1AYWA 3QSDA 3WXEA 1PADA 2G6DA 1AYVA 2XU4A 2AVWA 2G8JA 5EF4A 1KFXL 4QBBA 3WXFA 2JQFR 4Q8GA 3PW3A 2HXZA 3QT4A 3CH2X 2NQGA 1ME4A 3IMAA 4WA6A 1BQIA 1YT7A 2PNSA 2DZYA 1U9XA 1M6DA 1F2AA 1SP4B 2XU1A 1QOLA 2B1NA 1CJLA 4KLBA 4QH6A 4N79A 1ZIVA 2YJ2A 3CBJA 1THEA 2B1MA 5EGWA 1EWLA 1W4TA 1PPOA 2FYEA 4HWYA 1KFUL 2IPPB 1CSBB 3IHPA 1CVZA 1KHPA 3O0UA 3K9MA 2OZ2A 2AU1A 4P6GA 3IOQA 4NV7A 4QRXA 2Y5BA 4X6IA 1IWDA 2OULA 1QDQA 2R9MA 3N3KA 2WBFX 2HHNA 4K7CA 4CDFB 2VHSA 4N4ZA 2PBHA 2BSZA 4PP1A 2OP3A 1CV8A 3NHEA 1O0EA 1FH0A 3KFQA 3KWBX 1GCBA 3V6EA 3CBKA 2FRQA 3RVVA 3HWNA 1NPZA 4G54A 5FPWA 5CHTA 3K24A 2AUXA 4CDDB 1A6RA 3MHHA 1PIPA 3BWKA 4ZUXU 2HD5A 2YJ8A 3H89A 8PCHA 2DZZA 1NQCA 2NQDB 1NB3A 1STFE 3AI8A 1W6FA 1HUCB 4X6HA 3OISA 2JQGR 2R9OA 1PPNA 2R9CA 3F75A 5CVMA 1PPPA 2P0RA 3K8UA 4BQVA 3IUTA 3P5UA 1KHQA 1GX3A 2O6XA 1TLOA 3HHIA 3M99A 1U5IA 4N8WA 1EF7A 3TNXA 2FUDA 4W5BA 7PCKA 4MSXA 3IEJA 4W4UA 3KKUA 1CQDA 2VFBA 4GUZA 4C5PA 5CHVA 3P5XA 2GHUA 4YYSA 4NV8A 1CS8A 1NL6A 4YYVA 1AU2A 3D6SA 4PI3A 1AU3A 2AUZA 4BPVA 4AXMA 1F2BA 3RVXA 3GCBA 2YJCA 4OELA 4YYWA 2FT2A 1YALA 1Y08A 1AYUA 2FO5A 4P6EA 2YJBA 4W5CA 1W5RA 3N3GA 1EWMA 3MTNA 4BS5A 1YK8A 1F2CA 1PCIA 2PREA 3MHSA 2DC9A 1U9VA 3HHAA 1AU4A 4CDEB 2BDLA 1GLOA 3WXGA 1XKGA 2E02A 2E00A 4QRVA 1PPDA 1Q6KA 3BC3A 4YYUA 6PADA 4OEMA 1PBHA 1EWPA 3P5WA 5K16A 3S3RA 1YVBA 3OVZA 4XUIA 3I3TA 2G7YA 1ZCMA 1U9WA 4DMXA 9PAPA 2E03A 1GMYA 1ME3A 3BCNA 3BPFA 3USVA 4B55A 4MZOA 2NQIA 2DCBA 2NQAA 1E2TA 2E01A 2ARYA 2DC7A 3F5VA 3H8BA 3H7DA 1ITOA 1CTEA 2XU3A 1Y4HA 2R9NA 5A24A 3ERVA 3PDFA 2FRAA 2DCAA 2R6NA 4YYQA 1X9YA 4I05A 3B79A 2YJ9A 4I07A 4XR7A 2AYOA 2C0YA 3C9EA 3D9WA 2DC8A 3OF9A 3RVWA 2Y6EA 2G8EA 3KWZA 1VJVA 5CVOB 3N4CA 1BP4A 4DMYA 3LFYA 1MIRA 4X6JA 1MDWA 5CVNB 4FIPA 3OF8A 4YV8A 2DJFB 3H8CA 3LXSA 1PXVA 1AU0A 3QJ3A 2DCDA 3CH3X 3DF0A 2ACTA 1S4VA 2XU5A 1F29A 4CDCB 1CPJA 1VSNA 2CB5A 1ICFA 4BS6A 2HH5A 2F7DA 2P86A 1CB5A 4I04A 3BOWA 2FQ9A 2AYNA 3OVXA 3O1GA 1YK7A 1MEGA 1MEMA 3V6CA 2FTDA 2DJGB 1GECE 3PNRA 1JQPA 1TL9A 3KSEA 3KW9A 1QXPA 4RY2A 4YVAA 1NB5A 2AS8A 1KXRA 4YYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I06 A;  1AIM A;  1MHW A;  2VHF A;  4MZS A;  1SNK A;  1TU6 A;  1U9Q X;  2DCC A;  2AIM A;  2IBI A;  1K3B B;  4Q8H A;  5J94 A;  3P5V A;  3BPM A;  3IV2 A;  4AXL A;  2BDZ A;  3MOR A;  4FK5 A;  5JH3 A;  1POP A;  1DF0 A;  3HD3 A;  1DEU A;  4QRG A;  1QMY A;  3ZUA A;  5F02 A;  3E1Z B;  1BGO A;  2F1G A;  2H7J A;  2CIO A;  1PE6 A;  1NLJ A;  4PP2 E;  3PBH A;  2DC6 A;  2P7U A;  2R9F A;  1AEC A;  3S3Q A;  2PAD A;  4PAD A;  1EWO A;  3H6S A;  4FJC A;  4CZW A;  3KX1 A;  2ATO A;  1ATK A;  5PAD A;  2GFO A;  1MS6 A;  4BSQ A;  5JA7 A;  1BY8 A;  3U8E A;  1AYW A;  3QSD A;  3WXE A;  1PAD A;  2G6D A;  1AYV A;  2XU4 A;  2AVW A;  2G8J A;  5EF4 A;  1KFX L;  4QBB A;  3WXF A;  2JQF R;  4Q8G A;  3PW3 A;  2HXZ A;  3QT4 A;  3CH2 X;  2NQG A;  1ME4 A;  3IMA A;  4WA6 A;  1BQI A;  1YT7 A;  2PNS A;  2DZY A;  1U9X A;  1M6D A;  1F2A A;  1SP4 B;  2XU1 A;  1QOL A;  2B1N A;  1CJL A;  4KLB A;  4QH6 A;  4N79 A;  1ZIV A;  2YJ2 A;  3CBJ A;  1THE A;  2B1M A;  5EGW A;  1EWL A;  1PPO A;  2FYE A;  4HWY A;  1KFU L;  2IPP B;  1CSB B;  3IHP A;  1CVZ A;  1KHP A;  3O0U A;  3K9M A;  2OZ2 A;  2AU1 A;  4P6G A;  3IOQ A;  4QRX A;  2Y5B A;  4X6I A;  1IWD A;  2OUL A;  1QDQ A;  2R9M A;  3N3K A;  2WBF X;  2HHN A;  4K7C A;  4CDF B;  2VHS A;  4N4Z A;  2PBH A;  4PP1 A;  2OP3 A;  1CV8 A;  3NHE A;  1O0E A;  1FH0 A;  3KFQ A;  3KWB X;  1GCB A;  3V6E A;  3CBK A;  2FRQ A;  3RVV A;  3HWN A;  1NPZ A;  4G54 A;  5FPW A;  5CHT A;  3K24 A;  2AUX A;  4CDD B;  1A6R A;  3MHH A;  1PIP A;  3BWK A;  4ZUX U;  2HD5 A;  2YJ8 A;  3H89 A;  8PCH A;  2DZZ A;  1NQC A;  2NQD B;  1NB3 A;  1STF E;  3AI8 A;  1HUC B;  4X6H A;  3OIS A;  2JQG R;  2R9O A;  1PPN A;  2R9C A;  3F75 A;  5CVM A;  1PPP A;  2P0R A;  3K8U A;  4BQV A;  3IUT A;  3P5U A;  1KHQ A;  2O6X A;  1TLO A;  3HHI A;  3M99 A;  1U5I A;  4N8W A;  1EF7 A;  3TNX A;  2FUD A;  4W5B A;  7PCK A;  4MSX A;  3IEJ A;  4W4U A;  3KKU A;  1CQD A;  5CHV A;  3P5X A;  2GHU A;  4YYS A;  1CS8 A;  1NL6 A;  4YYV A;  1AU2 A;  3D6S A;  4PI3 A;  1AU3 A;  2AUZ A;  4BPV A;  4AXM A;  1F2B A;  3RVX A;  3GCB A;  2YJC A;  4OEL A;  4YYW A;  2FT2 A;  1YAL A;  1Y08 A;  1AYU A;  2FO5 A;  4P6E A;  2YJB A;  4W5C A;  3N3G A;  1EWM A;  3MTN A;  4BS5 A;  1YK8 A;  1F2C A;  1PCI A;  2PRE A;  3MHS A;  2DC9 A;  1U9V A;  3HHA A;  1AU4 A;  4CDE B;  2BDL A;  1GLO A;  3WXG A;  1XKG A;  2E02 A;  2E00 A;  4QRV A;  1PPD A;  1Q6K A;  3BC3 A;  4YYU A;  6PAD A;  4OEM A;  1PBH A;  1EWP A;  3P5W A;  5K16 A;  3S3R A;  1YVB A;  3OVZ A;  4XUI A;  3I3T A;  2G7Y A;  1ZCM A;  1U9W A;  4DMX A;  9PAP A;  2E03 A;  1GMY A;  1ME3 A;  3BCN A;  3BPF A;  3USV A;  4MZO A;  2NQI A;  2DCB A;  2NQA A;  2E01 A;  2ARY A;  2DC7 A;  3F5V A;  3H8B A;  3H7D A;  1ITO A;  1CTE A;  2XU3 A;  1Y4H A;  2R9N A;  5A24 A;  3ERV A;  3PDF A;  2FRA A;  2DCA A;  2R6N A;  4YYQ A;  1X9Y A;  4I05 A;  3B79 A;  2YJ9 A;  4I07 A;  4XR7 A;  2AYO A;  2C0Y A;  3C9E A;  2DC8 A;  3OF9 A;  3RVW A;  2Y6E A;  2G8E A;  3KWZ A;  1VJV A;  5CVO B;  3N4C A;  1BP4 A;  4DMY A;  3LFY A;  1MIR A;  4X6J A;  1MDW A;  5CVN B;  4FIP A;  3OF8 A;  4YV8 A;  2DJF B;  3H8C A;  3LXS A;  1PXV A;  1AU0 A;  3QJ3 A;  2DCD A;  3CH3 X;  3DF0 A;  2ACT A;  1S4V A;  2XU5 A;  1F29 A;  4CDC B;  1CPJ A;  1VSN A;  2CB5 A;  1ICF A;  4BS6 A;  2HH5 A;  2F7D A;  2P86 A;  1CB5 A;  4I04 A;  3BOW A;  2FQ9 A;  2AYN A;  3OVX A;  3O1G A;  1YK7 A;  1MEG A;  1MEM A;  3V6C A;  2FTD A;  2DJG B;  1GEC E;  3PNR A;  1JQP A;  1TL9 A;  3KSE A;  3KW9 A;  1QXP A;  4RY2 A;  4YVA A;  1NB5 A;  2AS8 A;  1KXR A;  4YYR A; 
#chains in the Genus database with same CATH topology
 3I06 A;  1AIM A;  1MHW A;  2FE8 A;  2VHF A;  4MZS A;  1SNK A;  1TU6 A;  1U9Q X;  2DCC A;  2AIM A;  2IBI A;  1K3B B;  4Q8H A;  5J94 A;  3P5V A;  3BPM A;  3IV2 A;  4AXL A;  2BDZ A;  3MOR A;  4FK5 A;  5JH3 A;  1POP A;  1DF0 A;  3HD3 A;  1DEU A;  4QRG A;  1QMY A;  3ZUA A;  3C0R A;  5F02 A;  1YZB A;  3PRP A;  3E1Z B;  1BGO A;  2F1G A;  2H7J A;  2CIO A;  1PE6 A;  1NLJ A;  4PP2 E;  4D8E A;  3PBH A;  2DC6 A;  2P7U A;  2R9F A;  1AEC A;  3S3Q A;  2PAD A;  4PAD A;  1EWO A;  3H6S A;  4FJC A;  4BOS A;  3PRM A;  4CZW A;  3KX1 A;  2ATO A;  1ATK A;  4D8B A;  5PAD A;  2GFO A;  1MS6 A;  4BSQ A;  5JA7 A;  1BY8 A;  3U8E A;  1AYW A;  3QSD A;  3WXE A;  5JZE A;  1PAD A;  2G6D A;  1AYV A;  2XU4 A;  2AVW A;  2G8J A;  5EF4 A;  1KFX L;  4QBB A;  3WXF A;  4IUM A;  2JQF R;  4Q8G A;  3PW3 A;  2HXZ A;  4P16 A;  4IP3 A;  3QT4 A;  3CH2 X;  4BOQ A;  2NQG A;  1ME4 A;  3IMA A;  4WA6 A;  1BQI A;  1YT7 A;  2PNS A;  2DZY A;  4REZ A;  1U9X A;  4MM3 B;  1M6D A;  1F2A A;  4M0W A;  1SP4 B;  2XU1 A;  1QOL A;  2JTC A;  4RKX A;  2B1N A;  1CJL A;  4KLB A;  4GUA A;  2Z84 A;  4QH6 A;  4N79 A;  1ZIV A;  2YJ2 A;  3CBJ A;  3MJ5 A;  2AGA A;  1THE A;  2B1M A;  5EGW A;  3RNV A;  1EWL A;  1PPO A;  2FYE A;  3BBA A;  4HWY A;  1KFU L;  2IPP B;  4D8I A;  1CSB B;  3IHP A;  3BY4 A;  1CVZ A;  1KHP A;  3OQC A;  3O0U A;  3K9M A;  3PSE A;  2OZ2 A;  2AU1 A;  4P6G A;  1PVJ A;  3IOQ A;  4QRX A;  2Y5B A;  2BU3 A;  4X6I A;  1IWD A;  2OUL A;  1QDQ A;  3TRK A;  2R9M A;  3N3K A;  2WBF X;  2HHN A;  4K7C A;  4CDF B;  2VHS A;  4N4Z A;  2PBH A;  4PP1 A;  2OP3 A;  4OVZ B;  1CV8 A;  3NHE A;  1O0E A;  1FH0 A;  2JRI A;  3KFQ A;  3KWB X;  1GCB A;  3V6E A;  3CBK A;  2FRQ A;  4MI7 A;  3RVV A;  3HWN A;  1NPZ A;  3IFU A;  4G54 A;  2UZJ A;  5FPW A;  5CHT A;  3K24 A;  2AUX A;  4CDD B;  1A6R A;  3MHH A;  1PIP A;  3BWK A;  4ZUX U;  2HD5 A;  2YJ8 A;  3H89 A;  8PCH A;  2DZZ A;  1NQC A;  2NQD B;  1NB3 A;  1STF E;  3AI8 A;  1HUC B;  4X6H A;  3OIS A;  4ZTB A;  2JQG R;  2R9O A;  1PPN A;  2R9C A;  2DOS A;  3F75 A;  3TMP A;  2J7Q C;  1PPP A;  5CVM A;  4HXD B;  2P0R A;  3K8U A;  4BQV A;  3IUT A;  3P5U A;  1KHQ A;  2O6X A;  3E9S A;  1TLO A;  3HHI A;  3M99 A;  1U5I A;  4N8W A;  1EF7 A;  3TNX A;  2HWK A;  3O65 A;  2FUD A;  4W5B A;  7PCK A;  4MSX A;  4OVZ A;  3IEJ A;  4W4U A;  3KKU A;  1CQD A;  5CHV A;  3P5X A;  2GHU A;  4YYS A;  1CS8 A;  1NL6 A;  4YYV A;  1AU2 A;  4WUR A;  3D6S A;  4PI3 A;  1AU3 A;  2AUZ A;  4BPV A;  4AXM A;  3BB7 A;  1F2B A;  3RVX A;  3GCB A;  2YJC A;  4OEL A;  3MP2 A;  4YYW A;  4PT5 A;  2FT2 A;  1YAL A;  1Y08 A;  1AYU A;  2FO5 A;  4P6E A;  2YJB A;  4W5C A;  4R3D A;  4XZX A;  3N3G A;  1EWM A;  4RF0 A;  3MTN A;  4BS5 A;  1YK8 A;  1F2C A;  1PCI A;  3MTV A;  2PRE A;  3MHS A;  2DC9 A;  1U9V A;  3HHA A;  5EZS A;  1AU4 A;  4CDE B;  2BDL A;  2BTW B;  1GLO A;  3WXG A;  1XKG A;  2E02 A;  2E00 A;  4QRV A;  4RF1 A;  1PPD A;  3PHX A;  1Q6K A;  3BC3 A;  4YYU A;  6PAD A;  4OEM A;  1PBH A;  1EWP A;  3P5W A;  5K16 A;  3S3R A;  4BOU A;  1YVB A;  3OVZ A;  4XUI A;  3I3T A;  2G7Y A;  1ZCM A;  1U9W A;  4BOZ A;  4DMX A;  9PAP A;  2E03 A;  1GMY A;  1ME3 A;  3BCN A;  3BPF A;  3USV A;  4MZO A;  2NQI A;  2DCB A;  2NQA A;  2E01 A;  2ARY A;  2DC7 A;  3F5V A;  3H8B A;  3H7D A;  1ITO A;  1CTE A;  2XU3 A;  1Y4H A;  2R9N A;  5A24 A;  3ERV A;  3PDF A;  2FRA A;  2DCA A;  2R6N A;  4YYQ A;  1X9Y A;  3W31 A;  2J7Q A;  3B21 A;  3W30 A;  4I05 A;  2BTW A;  3B79 A;  2YJ9 A;  4I07 A;  4XR7 A;  2AYO A;  3PT2 A;  2C0Y A;  3C9E A;  2DC8 A;  3OF9 A;  3RVW A;  2Y6E A;  2G8E A;  3KWZ A;  1VJV A;  5CVO B;  3N4C A;  1BP4 A;  4DMY A;  3LFY A;  1MIR A;  4X6J A;  1DKI A;  1MDW A;  5CVN B;  4FIP A;  3OF8 A;  4YV8 A;  2DJF B;  3ZNH A;  3H8C A;  3LXS A;  1PXV A;  1AU0 A;  3QJ3 A;  2DCD A;  3CH3 X;  3DF0 A;  2ACT A;  3PHU A;  1S4V A;  2XU5 A;  1F29 A;  4CDC B;  1CPJ A;  1VSN A;  2CB5 A;  1ICF A;  4BS6 A;  2HH5 A;  2F7D A;  4RNA A;  2P86 A;  1CB5 A;  5KO3 A;  3PHW A;  4I04 A;  5E6J A;  4A5U A;  3BOW A;  2FQ9 A;  2AYN A;  3OVX A;  1UKF A;  3O1G A;  4OW0 A;  1YK7 A;  1MEG A;  1MEM A;  5EZQ A;  3V6C A;  2FTD A;  2DJG B;  1GEC E;  3PNR A;  1JQP A;  1TL9 A;  3KSE A;  3KW9 A;  1QXP A;  4RY2 A;  4YVA A;  1NB5 A;  2AS8 A;  4BOP A;  1KXR A;  4YYR A; 
#chains in the Genus database with same CATH homology
 3I06 A;  1AIM A;  1MHW A;  2VHF A;  4BGF A;  4MZS A;  1SNK A;  1TU6 A;  1U9Q X;  2DCC A;  2AIM A;  2IBI A;  1K3B B;  4Q8H A;  5J94 A;  3P5V A;  3BPM A;  3IV2 A;  4AXL A;  2BDZ A;  3MOR A;  4FK5 A;  5JH3 A;  1POP A;  1DF0 A;  3HD3 A;  1DEU A;  3LTW A;  4QRG A;  1QMY A;  3ZUA A;  5F02 A;  3E1Z B;  1BGO A;  2F1G A;  2H7J A;  2CIO A;  1PE6 A;  1NLJ A;  4PP2 E;  3PBH A;  2DC6 A;  2P7U A;  2R9F A;  1AEC A;  3S3Q A;  2PAD A;  4PAD A;  1EWO A;  3H6S A;  4FJC A;  2VFC A;  4CZW A;  3KX1 A;  2ATO A;  1ATK A;  5PAD A;  2GFO A;  1MS6 A;  4BSQ A;  5JA7 A;  1BY8 A;  3U8E A;  1AYW A;  3QSD A;  3WXE A;  1PAD A;  2G6D A;  1AYV A;  2XU4 A;  2AVW A;  2G8J A;  5EF4 A;  1KFX L;  4QBB A;  3WXF A;  2JQF R;  4Q8G A;  3PW3 A;  2HXZ A;  3QT4 A;  3CH2 X;  2NQG A;  1ME4 A;  3IMA A;  4WA6 A;  1BQI A;  1YT7 A;  2PNS A;  2DZY A;  1U9X A;  1M6D A;  1F2A A;  1SP4 B;  2XU1 A;  1QOL A;  2B1N A;  1CJL A;  4KLB A;  4QH6 A;  4N79 A;  1ZIV A;  2YJ2 A;  3CBJ A;  1THE A;  2B1M A;  5EGW A;  1EWL A;  1W4T A;  1PPO A;  2FYE A;  4HWY A;  1KFU L;  2IPP B;  1CSB B;  3IHP A;  1CVZ A;  1KHP A;  3O0U A;  3K9M A;  2OZ2 A;  2AU1 A;  4P6G A;  3IOQ A;  4NV7 A;  4QRX A;  2Y5B A;  4X6I A;  1IWD A;  2OUL A;  1QDQ A;  2R9M A;  3N3K A;  2WBF X;  2HHN A;  4K7C A;  4CDF B;  2VHS A;  4N4Z A;  2PBH A;  2BSZ A;  4PP1 A;  2OP3 A;  1CV8 A;  3NHE A;  1O0E A;  1FH0 A;  3KFQ A;  3KWB X;  1GCB A;  3V6E A;  3CBK A;  2FRQ A;  3RVV A;  3HWN A;  1NPZ A;  4G54 A;  5FPW A;  5CHT A;  3K24 A;  2AUX A;  4CDD B;  1A6R A;  3MHH A;  1PIP A;  3BWK A;  4ZUX U;  2HD5 A;  2YJ8 A;  3H89 A;  8PCH A;  2DZZ A;  1NQC A;  2NQD B;  1NB3 A;  1STF E;  3AI8 A;  1W6F A;  1HUC B;  4X6H A;  3OIS A;  2JQG R;  2R9O A;  1PPN A;  2R9C A;  3F75 A;  5CVM A;  1PPP A;  2P0R A;  3K8U A;  4BQV A;  3IUT A;  3P5U A;  1KHQ A;  1GX3 A;  2O6X A;  1TLO A;  3HHI A;  3M99 A;  1U5I A;  4N8W A;  1EF7 A;  3TNX A;  2FUD A;  4W5B A;  7PCK A;  4MSX A;  3IEJ A;  4W4U A;  3KKU A;  1CQD A;  2VFB A;  4GUZ A;  4C5P A;  5CHV A;  3P5X A;  2GHU A;  4YYS A;  4NV8 A;  1CS8 A;  1NL6 A;  4YYV A;  1AU2 A;  3D6S A;  4PI3 A;  1AU3 A;  2AUZ A;  4BPV A;  4AXM A;  1F2B A;  3RVX A;  3GCB A;  2YJC A;  4OEL A;  4YYW A;  2FT2 A;  1YAL A;  1Y08 A;  1AYU A;  2FO5 A;  4P6E A;  2YJB A;  4W5C A;  1W5R A;  3N3G A;  1EWM A;  3MTN A;  4BS5 A;  1YK8 A;  1F2C A;  1PCI A;  2PRE A;  3MHS A;  2DC9 A;  1U9V A;  3HHA A;  1AU4 A;  4CDE B;  2BDL A;  1GLO A;  3WXG A;  1XKG A;  2E02 A;  2E00 A;  4QRV A;  1PPD A;  1Q6K A;  3BC3 A;  4YYU A;  6PAD A;  4OEM A;  1PBH A;  1EWP A;  3P5W A;  5K16 A;  3S3R A;  1YVB A;  3OVZ A;  4XUI A;  3I3T A;  2G7Y A;  1ZCM A;  1U9W A;  4DMX A;  9PAP A;  2E03 A;  1GMY A;  1ME3 A;  3BCN A;  3BPF A;  3USV A;  4B55 A;  4MZO A;  2NQI A;  2DCB A;  2NQA A;  1E2T A;  2E01 A;  2ARY A;  2DC7 A;  3F5V A;  3H8B A;  3H7D A;  1ITO A;  1CTE A;  2XU3 A;  1Y4H A;  2R9N A;  5A24 A;  3ERV A;  3PDF A;  2FRA A;  2DCA A;  2R6N A;  4YYQ A;  1X9Y A;  4I05 A;  3B79 A;  2YJ9 A;  4I07 A;  4XR7 A;  2AYO A;  2C0Y A;  3C9E A;  3D9W A;  2DC8 A;  3OF9 A;  3RVW A;  2Y6E A;  2G8E A;  3KWZ A;  1VJV A;  5CVO B;  3N4C A;  1BP4 A;  4DMY A;  3LFY A;  1MIR A;  4X6J A;  1MDW A;  5CVN B;  4FIP A;  3OF8 A;  4YV8 A;  2DJF B;  3H8C A;  3LXS A;  1PXV A;  1AU0 A;  3QJ3 A;  2DCD A;  3CH3 X;  3DF0 A;  2ACT A;  1S4V A;  2XU5 A;  1F29 A;  4CDC B;  1CPJ A;  1VSN A;  2CB5 A;  1ICF A;  4BS6 A;  2HH5 A;  2F7D A;  2P86 A;  1CB5 A;  4I04 A;  3BOW A;  2FQ9 A;  2AYN A;  3OVX A;  3O1G A;  1YK7 A;  1MEG A;  1MEM A;  3V6C A;  2FTD A;  2DJG B;  1GEC E;  3PNR A;  1JQP A;  1TL9 A;  3KSE A;  3KW9 A;  1QXP A;  4RY2 A;  4YVA A;  1NB5 A;  2AS8 A;  1KXR A;  4YYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...