3IEJA

Pyrazole-based cathepsin s inhibitors with arylalkynes as p1 binding elements
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
221
structure length
221
Chain Sequence
AALPDSVDWREKGCVTEVKYQGSCGASWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Pyrazole-based cathepsin S inhibitors with arylalkynes as P1 binding elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3iejA00
4I05A 3PBHA 1U9WA 5JH3A 1GCBA 1CTEA 2R9OA 3H6SA 5EGWA 1YALA 1Y08A 4N79A 1PXVA 1DF0A 4X6IA 3KFQA 1PIPA 1AU2A 4N4ZA 1THEA 4HWYA 2C0YA 2IPPB 4CDFB 1SNKA 4QRGA 1KFXL 3OF8A 2NQAA 3K24A 4QBBA 3V6CA 3F5VA 3QSDA 3OVXA 3I06A 2PREA 3OVZA 5F02A 3USVA 3TNXA 4QRVA 4BSQA 2DC6A 4MZSA 2B1MA 2E02A 3ZUAA 3D6SA 2DCAA 4BQVA 4YYVA 3BPMA 3WXEA 1PPPA 3P5XA 2DJGB 2H7JA 4P6GA 2DZZA 2VHFA 2YJBA 3N3KA 3KWBX 2NQIA 1NLJA 4XUIA 3KWZA 3O0UA 3B79A 1QDQA 2JQGR 4FJCA 3LFYA 1Y4HA 5CHTA 2G6DA 2R9MA 2R9NA 4CZWA 1YVBA 1CPJA 1VSNA 2FTDA 1MIRA 1NQCA 5CHVA 3DF0A 4W5BA 3PNRA 3P5VA 2P7UA 1NL6A 3IUTA 1ME3A 2E01A 4Q8GA 4X6JA 4G54A 1EWMA 2DZYA 1AYWA 3HD3A 2Y5BA 3KSEA 1NPZA 1A6RA 1HUCB 3OISA 4CDCB 2AIMA 2PADA 2JQFR 4I07A 4YYUA 4WA6A 1ME4A 3M99A 2BDZA 1YK8A 3H8BA 3HWNA 4YYWA 2OULA 3IOQA 1CV8A 1CS8A 4DMXA 2XU4A 4ZUXU 4P6EA 1BQIA 2CB5A 1SP4B 2DCDA 2BDLA 1EF7A 1MS6A 2G7YA 4BS5A 1BP4A 4MZOA 1FH0A 1QMYA 1Q6KA 1QXPA 3RVVA 4KLBA 4CDDB 2DC8A 2DCCA 4MSXA 1KHPA 1CJLA 3AI8A 1TU6A 1AIMA 1AU4A 1IWDA 4DMYA 4QH6A 5J94A 5PADA 3I3TA 2AS8A 4RY2A 2FQ9A 2GHUA 3N4CA 4YVAA 2HXZA 1TL9A 1EWPA 2GFOA 2FO5A 2E03A 1U5IA 3CH3X 3C9EA 3BCNA 8PCHA 1NB5A 1U9QX 2FRQA 2OZ2A 2R9FA 1F2BA 3OF9A 4FIPA 6PADA 5CVMA 3S3QA 2AVWA 4QRXA 3MHSA 2VHSA 1GLOA 3H7DA 1F2CA 4X6HA 1GMYA 4AXMA 4XR7A 2ACTA 2DJFB 2NQGA 4PP1A 1X9YA 3CBKA 3H8CA 2AU1A 3WXFA 3RVXA 1POPA 3QJ3A 1AYUA 2P86A 2F1GA 4YYQA 3BC3A 3ERVA 1ZIVA 1K3BB 2CIOA 3GCBA 3MHHA 1KHQA 2XU1A 1BGOA 3V6EA 2PBHA 3BOWA 2AYNA 5FPWA 1EWLA 2ARYA 1MEMA 3MTNA 1PADA 1PPDA 3WXGA 2O6XA 2XU5A 3H89A 3LXSA 1MHWA 4Q8HA 4FK5A 5CVNB 3S3RA 1PBHA 2YJ2A 1ZCMA 3P5UA 3F75A 2DC9A 1VJVA 3BWKA 1PCIA 4CDEB 1AYVA 2YJ8A 5A24A 4OEMA 2YJ9A 1ITOA 1NB3A 1PPOA 3CBJA 1KFUL 3QT4A 5K16A 2E00A 4BS6A 1CQDA 1ICFA 3MORA 1S4VA 3BPFA 2F7DA 3O1GA 2FRAA 3KW9A 4PADA 2IBIA 3U8EA 1O0EA 1MEGA 3KKUA 5CVOB 1U9XA 4PI3A 1PPNA 2R9CA 1DEUA 2AYOA 2FT2A 2YJCA 1AU3A 2P0RA 1TLOA 2G8JA 1XKGA 4I04A 2HD5A 3CH2X 7PCKA 2DCBA 1EWOA 1U9VA 2FYEA 4PP2E 1F29A 2R6NA 3RVWA 5EF4A 1QOLA 4K7CA 2WBFX 2AUXA 2DC7A 2FUDA 1CB5A 4N8WA 2G8EA 4YYSA 3IEJA 1ATKA 1AU0A 1MDWA 2PNSA 2XU3A 9PAPA 3HHIA 4W5CA 2ATOA 2B1NA 1M6DA 1KXRA 4W4UA 3IV2A 1YT7A 3K9MA 4AXLA 1JQPA 2NQDB 2HHNA 2AUZA 3PDFA 4YV8A 3N3GA 5JA7A 1F2AA 2OP3A 1CVZA 1PE6A 3HHAA 3IHPA 3NHEA 4YYRA 3KX1A 1CSBB 3PW3A 2Y6EA 4BPVA 1BY8A 1GECE 2HH5A 3E1ZB 1AECA 1STFE 3IMAA 4OELA 3P5WA 1YK7A 3K8UA
chains in the Genus database with same CATH superfamily
4I05A 3PBHA 1U9WA 5JH3A 1GCBA 1CTEA 2R9OA 3H6SA 5EGWA 1YALA 1Y08A 4N79A 3ZNHA 1PXVA 1DF0A 4X6IA 4GUAA 3KFQA 1PIPA 1AU2A 4N4ZA 1THEA 4HWYA 2C0YA 2IPPB 4CDFB 1SNKA 4QRGA 1KFXL 3OF8A 2NQAA 3K24A 4IP3A 4QBBA 3V6CA 2J7QA 3F5VA 3QSDA 3OVXA 2BU3A 3I06A 2PREA 3OVZA 5F02A 3USVA 3TNXA 4QRVA 4BSQA 2DC6A 4MZSA 4M0WA 2B1MA 2E02A 3ZUAA 3D6SA 2DCAA 4BQVA 4YYVA 3BPMA 3WXEA 1PPPA 3P5XA 2DJGB 2H7JA 4P6GA 2DZZA 2VHFA 4BOPA 2YJBA 3N3KA 3KWBX 2NQIA 1NLJA 2FE8A 4XUIA 3W30A 3KWZA 3O0UA 3B79A 1QDQA 4REZA 2JQGR 4D8IA 2AGAA 4FJCA 3LFYA 1Y4HA 5CHTA 2G6DA 4R3DA 2R9MA 2R9NA 4CZWA 1YVBA 1CPJA 1VSNA 2FTDA 1MIRA 1NQCA 3B21A 5CHVA 3DF0A 4W5BA 3E9SA 3PNRA 3P5VA 1YZBA 2P7UA 1NL6A 3IUTA 1ME3A 2E01A 4Q8GA 3MTVA 4X6JA 4D8EA 4G54A 1EWMA 2DZYA 4RKXA 1AYWA 3HD3A 2Y5BA 4MI7A 4OVZB 3KSEA 1NPZA 1A6RA 1HUCB 3OISA 4CDCB 2AIMA 2PADA 2JQFR 4I07A 4YYUA 4WA6A 1ME4A 3M99A 2BDZA 1YK8A 3H8BA 3HWNA 4YYWA 2OULA 4RNAA 3IOQA 1CV8A 1CS8A 1DKIA 4DMXA 2XU4A 4ZUXU 4P6EA 1BQIA 2CB5A 1SP4B 2DCDA 2BDLA 1EF7A 1MS6A 2G7YA 4BS5A 5E6JA 1BP4A 4MZOA 1FH0A 1QMYA 1Q6KA 1QXPA 3RVVA 4KLBA 4CDDB 2DC8A 3TRKA 2DCCA 4MSXA 1KHPA 1CJLA 3AI8A 1TU6A 5JZEA 1AIMA 1AU4A 1IWDA 3OQCA 4DMYA 4PT5A 4QH6A 5J94A 5PADA 3I3TA 3W31A 2AS8A 4RY2A 2FQ9A 2GHUA 3N4CA 4YVAA 2HXZA 1TL9A 1EWPA 2Z84A 2GFOA 2FO5A 2E03A 1U5IA 3BB7A 3C9EA 3CH3X 3BCNA 8PCHA 1NB5A 1U9QX 2FRQA 2OZ2A 2R9FA 1F2BA 3OF9A 4FIPA 3IFUA 6PADA 5CVMA 3PHWA 3S3QA 2AVWA 3MJ5A 4QRXA 4BOSA 3MHSA 2BTWB 2VHSA 1GLOA 3PHUA 3H7DA 3PSEA 1F2CA 4X6HA 1GMYA 4AXMA 4XR7A 4HXDB 4IUMA 2ACTA 4ZTBA 2DJFB 2NQGA 4PP1A 1X9YA 3CBKA 3H8CA 2AU1A 3WXFA 3RVXA 3PRPA 1POPA 1UKFA 3QJ3A 1AYUA 2P86A 2F1GA 4YYQA 3BC3A 2UZJA 3ERVA 1ZIVA 1K3BB 3PT2A 2CIOA 3GCBA 3MHHA 1KHQA 2XU1A 1BGOA 3V6EA 2PBHA 3BOWA 2AYNA 4P16A 4A5UA 5FPWA 1EWLA 2ARYA 1MEMA 3MTNA 1PADA 4OW0A 1PPDA 3WXGA 2O6XA 2XU5A 3H89A 3LXSA 4XZXA 4BOUA 1MHWA 4Q8HA 4FK5A 5CVNB 3S3RA 1PBHA 2YJ2A 1ZCMA 3P5UA 3F75A 2DC9A 1VJVA 3BWKA 1PCIA 4CDEB 1AYVA 2YJ8A 5A24A 3RNVA 4OEMA 2YJ9A 1ITOA 1NB3A 1PPOA 3CBJA 1KFUL 3QT4A 4OVZA 5K16A 2E00A 4BS6A 1CQDA 1ICFA 3MORA 1S4VA 3BPFA 2F7DA 3O1GA 2FRAA 3KW9A 4PADA 2IBIA 3MP2A 3U8EA 1O0EA 3O65A 1MEGA 3KKUA 5CVOB 1U9XA 4PI3A 3TMPA 1PPNA 2R9CA 1DEUA 2AYOA 2FT2A 2YJCA 1AU3A 2P0RA 1TLOA 2G8JA 1XKGA 4I04A 2HD5A 3CH2X 7PCKA 2DCBA 1EWOA 1U9VA 2FYEA 2HWKA 4PP2E 1F29A 2R6NA 3RVWA 5EF4A 1QOLA 5EZQA 4K7CA 2WBFX 2AUXA 4WURA 2DC7A 2FUDA 1CB5A 4BOQA 4N8WA 4RF0A 2G8EA 4YYSA 3IEJA 1ATKA 1AU0A 5EZSA 3PHXA 4RF1A 1MDWA 2PNSA 4BOZA 2XU3A 9PAPA 3HHIA 4W5CA 2ATOA 2B1NA 1M6DA 1KXRA 4W4UA 3IV2A 1YT7A 5KO3A 2J7QC 3K9MA 4AXLA 2JRIA 1JQPA 2NQDB 3BBAA 2HHNA 4D8BA 2AUZA 3PDFA 4YV8A 3N3GA 5JA7A 1F2AA 2OP3A 3PRMA 1CVZA 2JTCA 1PE6A 3HHAA 3IHPA 3NHEA 4YYRA 3KX1A 1CSBB 3PW3A 2Y6EA 4BPVA 1BY8A 2DOSA 2BTWA 4MM3B 1GECE 2HH5A 3C0RA 3E1ZB 1PVJA 3BY4A 1AECA 1STFE 3IMAA 4OELA 3P5WA 1YK7A 3K8UA
chains in the Genus database with same CATH topology
4I05A 3PBHA 1U9WA 5JH3A 1GCBA 1CTEA 2R9OA 3H6SA 5EGWA 1YALA 1Y08A 2VFCA 4N79A 1PXVA 1DF0A 4X6IA 3KFQA 1PIPA 1AU2A 4N4ZA 1THEA 4HWYA 2C0YA 2IPPB 4GUZA 4CDFB 1SNKA 4QRGA 1KFXL 3OF8A 2NQAA 3K24A 4QBBA 3V6CA 3F5VA 3QSDA 3OVXA 3I06A 2PREA 3OVZA 5F02A 3USVA 3TNXA 4QRVA 4BSQA 2DC6A 4MZSA 2B1MA 2E02A 3ZUAA 3D6SA 2DCAA 4BQVA 4YYVA 3BPMA 3WXEA 1PPPA 3P5XA 2DJGB 4BGFA 2H7JA 4P6GA 2DZZA 2VHFA 2YJBA 3N3KA 3KWBX 2NQIA 1NLJA 4XUIA 3KWZA 4C5PA 3O0UA 3B79A 1QDQA 2JQGR 4FJCA 3LFYA 1Y4HA 5CHTA 2G6DA 2R9MA 2R9NA 4CZWA 1YVBA 1CPJA 1VSNA 2FTDA 1MIRA 1NQCA 5CHVA 3DF0A 4W5BA 3PNRA 3P5VA 2P7UA 1NL6A 3IUTA 1ME3A 2E01A 4Q8GA 4X6JA 4B55A 4G54A 1EWMA 2DZYA 1AYWA 3HD3A 2Y5BA 3KSEA 1NPZA 1A6RA 1HUCB 3OISA 4CDCB 2AIMA 2PADA 2JQFR 4I07A 4YYUA 4WA6A 1ME4A 3M99A 2BDZA 1YK8A 3H8BA 3HWNA 4YYWA 2OULA 3IOQA 1CV8A 1CS8A 4DMXA 2XU4A 4ZUXU 4P6EA 1BQIA 2CB5A 1SP4B 2DCDA 2BDLA 1EF7A 1MS6A 2G7YA 4BS5A 1BP4A 4MZOA 1FH0A 1QMYA 1Q6KA 1QXPA 3RVVA 2BSZA 4KLBA 4CDDB 2DC8A 2DCCA 4MSXA 1KHPA 1CJLA 3AI8A 1TU6A 1AIMA 1AU4A 1IWDA 4DMYA 4QH6A 5J94A 5PADA 3I3TA 2AS8A 4RY2A 2FQ9A 2GHUA 3N4CA 4YVAA 2HXZA 1TL9A 4NV7A 1W5RA 1EWPA 2GFOA 2FO5A 2E03A 1E2TA 1U5IA 3CH3X 3C9EA 3BCNA 8PCHA 1NB5A 1U9QX 2FRQA 2OZ2A 2R9FA 1F2BA 3OF9A 4FIPA 6PADA 5CVMA 3S3QA 2AVWA 4QRXA 3MHSA 2VHSA 1GLOA 3H7DA 1F2CA 4X6HA 1GMYA 4AXMA 4XR7A 2ACTA 2DJFB 2NQGA 4PP1A 1X9YA 3CBKA 3H8CA 2AU1A 3WXFA 3RVXA 1POPA 3QJ3A 1AYUA 2P86A 2F1GA 4YYQA 3BC3A 3ERVA 1ZIVA 1K3BB 2CIOA 3GCBA 3MHHA 1KHQA 2XU1A 1BGOA 3V6EA 2PBHA 3BOWA 2AYNA 5FPWA 1EWLA 2ARYA 1MEMA 3MTNA 1PADA 1PPDA 3WXGA 2O6XA 2XU5A 3H89A 3LXSA 1MHWA 4Q8HA 4FK5A 5CVNB 3S3RA 1PBHA 2YJ2A 1ZCMA 3P5UA 3F75A 2DC9A 1VJVA 3BWKA 1PCIA 4CDEB 1AYVA 2YJ8A 5A24A 4OEMA 2YJ9A 1ITOA 1NB3A 1PPOA 3CBJA 1KFUL 3QT4A 5K16A 1GX3A 2E00A 1CQDA 4BS6A 1ICFA 4NV8A 3MORA 1S4VA 3BPFA 2F7DA 3O1GA 2FRAA 3KW9A 3LTWA 4PADA 2IBIA 3U8EA 1O0EA 1MEGA 3KKUA 5CVOB 1U9XA 4PI3A 1PPNA 2R9CA 1DEUA 2AYOA 2FT2A 2YJCA 1AU3A 2P0RA 1TLOA 2G8JA 2VFBA 1XKGA 4I04A 2HD5A 3CH2X 7PCKA 2DCBA 1EWOA 1U9VA 2FYEA 4PP2E 1F29A 3D9WA 2R6NA 3RVWA 5EF4A 1QOLA 4K7CA 2WBFX 2AUXA 2DC7A 2FUDA 1CB5A 4N8WA 2G8EA 4YYSA 3IEJA 1ATKA 1AU0A 1MDWA 1W4TA 2PNSA 2XU3A 9PAPA 3HHIA 4W5CA 2ATOA 2B1NA 1M6DA 1KXRA 4W4UA 3IV2A 1YT7A 3K9MA 4AXLA 1JQPA 2NQDB 2HHNA 2AUZA 3PDFA 4YV8A 3N3GA 5JA7A 1F2AA 2OP3A 1CVZA 1PE6A 3HHAA 1W6FA 3IHPA 3NHEA 4YYRA 3KX1A 1CSBB 3PW3A 2Y6EA 4BPVA 1BY8A 1GECE 2HH5A 3E1ZB 1AECA 1STFE 3IMAA 4OELA 3P5WA 1YK7A 3K8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I05 A;  3PBH A;  1U9W A;  5JH3 A;  1GCB A;  1CTE A;  2R9O A;  3H6S A;  5EGW A;  1YAL A;  1Y08 A;  4N79 A;  1PXV A;  1DF0 A;  4X6I A;  3KFQ A;  1PIP A;  1AU2 A;  4N4Z A;  1THE A;  4HWY A;  2C0Y A;  2IPP B;  4CDF B;  1SNK A;  4QRG A;  1KFX L;  3OF8 A;  2NQA A;  3K24 A;  4QBB A;  3V6C A;  3F5V A;  3QSD A;  3OVX A;  3I06 A;  2PRE A;  3OVZ A;  5F02 A;  3USV A;  3TNX A;  4QRV A;  4BSQ A;  2DC6 A;  4MZS A;  2B1M A;  2E02 A;  3ZUA A;  3D6S A;  2DCA A;  4BQV A;  4YYV A;  3BPM A;  3WXE A;  1PPP A;  3P5X A;  2DJG B;  2H7J A;  4P6G A;  2DZZ A;  2VHF A;  2YJB A;  3N3K A;  3KWB X;  2NQI A;  1NLJ A;  4XUI A;  3KWZ A;  3O0U A;  3B79 A;  1QDQ A;  2JQG R;  4FJC A;  3LFY A;  1Y4H A;  5CHT A;  2G6D A;  2R9M A;  2R9N A;  4CZW A;  1YVB A;  1CPJ A;  1VSN A;  2FTD A;  1MIR A;  1NQC A;  5CHV A;  3DF0 A;  4W5B A;  3PNR A;  3P5V A;  2P7U A;  1NL6 A;  3IUT A;  1ME3 A;  2E01 A;  4Q8G A;  4X6J A;  4G54 A;  1EWM A;  2DZY A;  1AYW A;  3HD3 A;  2Y5B A;  3KSE A;  1NPZ A;  1A6R A;  1HUC B;  3OIS A;  4CDC B;  2AIM A;  2PAD A;  2JQF R;  4I07 A;  4YYU A;  4WA6 A;  1ME4 A;  3M99 A;  2BDZ A;  1YK8 A;  3H8B A;  3HWN A;  4YYW A;  2OUL A;  3IOQ A;  1CV8 A;  1CS8 A;  4DMX A;  2XU4 A;  4ZUX U;  4P6E A;  1BQI A;  2CB5 A;  1SP4 B;  2DCD A;  2BDL A;  1EF7 A;  1MS6 A;  2G7Y A;  4BS5 A;  1BP4 A;  4MZO A;  1FH0 A;  1QMY A;  1Q6K A;  1QXP A;  3RVV A;  4KLB A;  4CDD B;  2DC8 A;  2DCC A;  4MSX A;  1KHP A;  1CJL A;  3AI8 A;  1TU6 A;  1AIM A;  1AU4 A;  1IWD A;  4DMY A;  4QH6 A;  5J94 A;  5PAD A;  3I3T A;  2AS8 A;  4RY2 A;  2FQ9 A;  2GHU A;  3N4C A;  4YVA A;  2HXZ A;  1TL9 A;  1EWP A;  2GFO A;  2FO5 A;  2E03 A;  1U5I A;  3CH3 X;  3C9E A;  3BCN A;  8PCH A;  1NB5 A;  1U9Q X;  2FRQ A;  2OZ2 A;  2R9F A;  1F2B A;  3OF9 A;  4FIP A;  6PAD A;  5CVM A;  3S3Q A;  2AVW A;  4QRX A;  3MHS A;  2VHS A;  1GLO A;  3H7D A;  1F2C A;  4X6H A;  1GMY A;  4AXM A;  4XR7 A;  2ACT A;  2DJF B;  2NQG A;  4PP1 A;  1X9Y A;  3CBK A;  3H8C A;  2AU1 A;  3WXF A;  3RVX A;  1POP A;  3QJ3 A;  1AYU A;  2P86 A;  2F1G A;  4YYQ A;  3BC3 A;  3ERV A;  1ZIV A;  1K3B B;  2CIO A;  3GCB A;  3MHH A;  1KHQ A;  2XU1 A;  1BGO A;  3V6E A;  2PBH A;  3BOW A;  2AYN A;  5FPW A;  1EWL A;  2ARY A;  1MEM A;  3MTN A;  1PAD A;  1PPD A;  3WXG A;  2O6X A;  2XU5 A;  3H89 A;  3LXS A;  1MHW A;  4Q8H A;  4FK5 A;  5CVN B;  3S3R A;  1PBH A;  2YJ2 A;  1ZCM A;  3P5U A;  3F75 A;  2DC9 A;  1VJV A;  3BWK A;  1PCI A;  4CDE B;  1AYV A;  2YJ8 A;  5A24 A;  4OEM A;  2YJ9 A;  1ITO A;  1NB3 A;  1PPO A;  3CBJ A;  1KFU L;  3QT4 A;  5K16 A;  2E00 A;  4BS6 A;  1CQD A;  1ICF A;  3MOR A;  1S4V A;  3BPF A;  2F7D A;  3O1G A;  2FRA A;  3KW9 A;  4PAD A;  2IBI A;  3U8E A;  1O0E A;  1MEG A;  3KKU A;  5CVO B;  1U9X A;  4PI3 A;  1PPN A;  2R9C A;  1DEU A;  2AYO A;  2FT2 A;  2YJC A;  1AU3 A;  2P0R A;  1TLO A;  2G8J A;  1XKG A;  4I04 A;  2HD5 A;  3CH2 X;  7PCK A;  2DCB A;  1EWO A;  1U9V A;  2FYE A;  4PP2 E;  1F29 A;  2R6N A;  3RVW A;  5EF4 A;  1QOL A;  4K7C A;  2WBF X;  2AUX A;  2DC7 A;  2FUD A;  1CB5 A;  4N8W A;  2G8E A;  4YYS A;  3IEJ A;  1ATK A;  1AU0 A;  1MDW A;  2PNS A;  2XU3 A;  9PAP A;  3HHI A;  4W5C A;  2ATO A;  2B1N A;  1M6D A;  1KXR A;  4W4U A;  3IV2 A;  1YT7 A;  3K9M A;  4AXL A;  1JQP A;  2NQD B;  2HHN A;  2AUZ A;  3PDF A;  4YV8 A;  3N3G A;  5JA7 A;  1F2A A;  2OP3 A;  1CVZ A;  1PE6 A;  3HHA A;  3IHP A;  3NHE A;  4YYR A;  3KX1 A;  1CSB B;  3PW3 A;  2Y6E A;  4BPV A;  1BY8 A;  1GEC E;  2HH5 A;  3E1Z B;  1AEC A;  1STF E;  3IMA A;  4OEL A;  3P5W A;  1YK7 A;  3K8U A; 
#chains in the Genus database with same CATH topology
 4I05 A;  3PBH A;  1U9W A;  5JH3 A;  1GCB A;  1CTE A;  2R9O A;  3H6S A;  5EGW A;  1YAL A;  1Y08 A;  4N79 A;  3ZNH A;  1PXV A;  1DF0 A;  4X6I A;  4GUA A;  3KFQ A;  1PIP A;  1AU2 A;  4N4Z A;  1THE A;  4HWY A;  2C0Y A;  2IPP B;  4CDF B;  1SNK A;  4QRG A;  1KFX L;  3OF8 A;  2NQA A;  3K24 A;  4IP3 A;  4QBB A;  3V6C A;  2J7Q A;  3F5V A;  3QSD A;  3OVX A;  2BU3 A;  3I06 A;  2PRE A;  3OVZ A;  5F02 A;  3USV A;  3TNX A;  4QRV A;  4BSQ A;  2DC6 A;  4MZS A;  4M0W A;  2B1M A;  2E02 A;  3ZUA A;  3D6S A;  2DCA A;  4BQV A;  4YYV A;  3BPM A;  3WXE A;  1PPP A;  3P5X A;  2DJG B;  2H7J A;  4P6G A;  2DZZ A;  2VHF A;  4BOP A;  2YJB A;  3N3K A;  3KWB X;  2NQI A;  1NLJ A;  2FE8 A;  4XUI A;  3W30 A;  3KWZ A;  3O0U A;  3B79 A;  1QDQ A;  4REZ A;  2JQG R;  4D8I A;  2AGA A;  4FJC A;  3LFY A;  1Y4H A;  5CHT A;  2G6D A;  4R3D A;  2R9M A;  2R9N A;  4CZW A;  1YVB A;  1CPJ A;  1VSN A;  2FTD A;  1MIR A;  1NQC A;  3B21 A;  5CHV A;  3DF0 A;  4W5B A;  3E9S A;  3PNR A;  3P5V A;  1YZB A;  2P7U A;  1NL6 A;  3IUT A;  1ME3 A;  2E01 A;  4Q8G A;  3MTV A;  4X6J A;  4D8E A;  4G54 A;  1EWM A;  2DZY A;  4RKX A;  1AYW A;  3HD3 A;  2Y5B A;  4MI7 A;  4OVZ B;  3KSE A;  1NPZ A;  1A6R A;  1HUC B;  3OIS A;  4CDC B;  2AIM A;  2PAD A;  2JQF R;  4I07 A;  4YYU A;  4WA6 A;  1ME4 A;  3M99 A;  2BDZ A;  1YK8 A;  3H8B A;  3HWN A;  4YYW A;  2OUL A;  4RNA A;  3IOQ A;  1CV8 A;  1CS8 A;  1DKI A;  4DMX A;  2XU4 A;  4ZUX U;  4P6E A;  1BQI A;  2CB5 A;  1SP4 B;  2DCD A;  2BDL A;  1EF7 A;  1MS6 A;  2G7Y A;  4BS5 A;  5E6J A;  1BP4 A;  4MZO A;  1FH0 A;  1QMY A;  1Q6K A;  1QXP A;  3RVV A;  4KLB A;  4CDD B;  2DC8 A;  3TRK A;  2DCC A;  4MSX A;  1KHP A;  1CJL A;  3AI8 A;  1TU6 A;  5JZE A;  1AIM A;  1AU4 A;  1IWD A;  3OQC A;  4DMY A;  4PT5 A;  4QH6 A;  5J94 A;  5PAD A;  3I3T A;  3W31 A;  2AS8 A;  4RY2 A;  2FQ9 A;  2GHU A;  3N4C A;  4YVA A;  2HXZ A;  1TL9 A;  1EWP A;  2Z84 A;  2GFO A;  2FO5 A;  2E03 A;  1U5I A;  3BB7 A;  3C9E A;  3CH3 X;  3BCN A;  8PCH A;  1NB5 A;  1U9Q X;  2FRQ A;  2OZ2 A;  2R9F A;  1F2B A;  3OF9 A;  4FIP A;  3IFU A;  6PAD A;  5CVM A;  3PHW A;  3S3Q A;  2AVW A;  3MJ5 A;  4QRX A;  4BOS A;  3MHS A;  2BTW B;  2VHS A;  1GLO A;  3PHU A;  3H7D A;  3PSE A;  1F2C A;  4X6H A;  1GMY A;  4AXM A;  4XR7 A;  4HXD B;  4IUM A;  2ACT A;  4ZTB A;  2DJF B;  2NQG A;  4PP1 A;  1X9Y A;  3CBK A;  3H8C A;  2AU1 A;  3WXF A;  3RVX A;  3PRP A;  1POP A;  1UKF A;  3QJ3 A;  1AYU A;  2P86 A;  2F1G A;  4YYQ A;  3BC3 A;  2UZJ A;  3ERV A;  1ZIV A;  1K3B B;  3PT2 A;  2CIO A;  3GCB A;  3MHH A;  1KHQ A;  2XU1 A;  1BGO A;  3V6E A;  2PBH A;  3BOW A;  2AYN A;  4P16 A;  4A5U A;  5FPW A;  1EWL A;  2ARY A;  1MEM A;  3MTN A;  1PAD A;  4OW0 A;  1PPD A;  3WXG A;  2O6X A;  2XU5 A;  3H89 A;  3LXS A;  4XZX A;  4BOU A;  1MHW A;  4Q8H A;  4FK5 A;  5CVN B;  3S3R A;  1PBH A;  2YJ2 A;  1ZCM A;  3P5U A;  3F75 A;  2DC9 A;  1VJV A;  3BWK A;  1PCI A;  4CDE B;  1AYV A;  2YJ8 A;  5A24 A;  3RNV A;  4OEM A;  2YJ9 A;  1ITO A;  1NB3 A;  1PPO A;  3CBJ A;  1KFU L;  3QT4 A;  4OVZ A;  5K16 A;  2E00 A;  4BS6 A;  1CQD A;  1ICF A;  3MOR A;  1S4V A;  3BPF A;  2F7D A;  3O1G A;  2FRA A;  3KW9 A;  4PAD A;  2IBI A;  3MP2 A;  3U8E A;  1O0E A;  3O65 A;  1MEG A;  3KKU A;  5CVO B;  1U9X A;  4PI3 A;  3TMP A;  1PPN A;  2R9C A;  1DEU A;  2AYO A;  2FT2 A;  2YJC A;  1AU3 A;  2P0R A;  1TLO A;  2G8J A;  1XKG A;  4I04 A;  2HD5 A;  3CH2 X;  7PCK A;  2DCB A;  1EWO A;  1U9V A;  2FYE A;  2HWK A;  4PP2 E;  1F29 A;  2R6N A;  3RVW A;  5EF4 A;  1QOL A;  5EZQ A;  4K7C A;  2WBF X;  2AUX A;  4WUR A;  2DC7 A;  2FUD A;  1CB5 A;  4BOQ A;  4N8W A;  4RF0 A;  2G8E A;  4YYS A;  3IEJ A;  1ATK A;  1AU0 A;  5EZS A;  3PHX A;  4RF1 A;  1MDW A;  2PNS A;  4BOZ A;  2XU3 A;  9PAP A;  3HHI A;  4W5C A;  2ATO A;  2B1N A;  1M6D A;  1KXR A;  4W4U A;  3IV2 A;  1YT7 A;  5KO3 A;  2J7Q C;  3K9M A;  4AXL A;  2JRI A;  1JQP A;  2NQD B;  3BBA A;  2HHN A;  4D8B A;  2AUZ A;  3PDF A;  4YV8 A;  3N3G A;  5JA7 A;  1F2A A;  2OP3 A;  3PRM A;  1CVZ A;  2JTC A;  1PE6 A;  3HHA A;  3IHP A;  3NHE A;  4YYR A;  3KX1 A;  1CSB B;  3PW3 A;  2Y6E A;  4BPV A;  1BY8 A;  2DOS A;  2BTW A;  4MM3 B;  1GEC E;  2HH5 A;  3C0R A;  3E1Z B;  1PVJ A;  3BY4 A;  1AEC A;  1STF E;  3IMA A;  4OEL A;  3P5W A;  1YK7 A;  3K8U A; 
#chains in the Genus database with same CATH homology
 4I05 A;  3PBH A;  1U9W A;  5JH3 A;  1GCB A;  1CTE A;  2R9O A;  3H6S A;  5EGW A;  1YAL A;  1Y08 A;  2VFC A;  4N79 A;  1PXV A;  1DF0 A;  4X6I A;  3KFQ A;  1PIP A;  1AU2 A;  4N4Z A;  1THE A;  4HWY A;  2C0Y A;  2IPP B;  4GUZ A;  4CDF B;  1SNK A;  4QRG A;  1KFX L;  3OF8 A;  2NQA A;  3K24 A;  4QBB A;  3V6C A;  3F5V A;  3QSD A;  3OVX A;  3I06 A;  2PRE A;  3OVZ A;  5F02 A;  3USV A;  3TNX A;  4QRV A;  4BSQ A;  2DC6 A;  4MZS A;  2B1M A;  2E02 A;  3ZUA A;  3D6S A;  2DCA A;  4BQV A;  4YYV A;  3BPM A;  3WXE A;  1PPP A;  3P5X A;  2DJG B;  4BGF A;  2H7J A;  4P6G A;  2DZZ A;  2VHF A;  2YJB A;  3N3K A;  3KWB X;  2NQI A;  1NLJ A;  4XUI A;  3KWZ A;  4C5P A;  3O0U A;  3B79 A;  1QDQ A;  2JQG R;  4FJC A;  3LFY A;  1Y4H A;  5CHT A;  2G6D A;  2R9M A;  2R9N A;  4CZW A;  1YVB A;  1CPJ A;  1VSN A;  2FTD A;  1MIR A;  1NQC A;  5CHV A;  3DF0 A;  4W5B A;  3PNR A;  3P5V A;  2P7U A;  1NL6 A;  3IUT A;  1ME3 A;  2E01 A;  4Q8G A;  4X6J A;  4B55 A;  4G54 A;  1EWM A;  2DZY A;  1AYW A;  3HD3 A;  2Y5B A;  3KSE A;  1NPZ A;  1A6R A;  1HUC B;  3OIS A;  4CDC B;  2AIM A;  2PAD A;  2JQF R;  4I07 A;  4YYU A;  4WA6 A;  1ME4 A;  3M99 A;  2BDZ A;  1YK8 A;  3H8B A;  3HWN A;  4YYW A;  2OUL A;  3IOQ A;  1CV8 A;  1CS8 A;  4DMX A;  2XU4 A;  4ZUX U;  4P6E A;  1BQI A;  2CB5 A;  1SP4 B;  2DCD A;  2BDL A;  1EF7 A;  1MS6 A;  2G7Y A;  4BS5 A;  1BP4 A;  4MZO A;  1FH0 A;  1QMY A;  1Q6K A;  1QXP A;  3RVV A;  2BSZ A;  4KLB A;  4CDD B;  2DC8 A;  2DCC A;  4MSX A;  1KHP A;  1CJL A;  3AI8 A;  1TU6 A;  1AIM A;  1AU4 A;  1IWD A;  4DMY A;  4QH6 A;  5J94 A;  5PAD A;  3I3T A;  2AS8 A;  4RY2 A;  2FQ9 A;  2GHU A;  3N4C A;  4YVA A;  2HXZ A;  1TL9 A;  4NV7 A;  1W5R A;  1EWP A;  2GFO A;  2FO5 A;  2E03 A;  1E2T A;  1U5I A;  3CH3 X;  3C9E A;  3BCN A;  8PCH A;  1NB5 A;  1U9Q X;  2FRQ A;  2OZ2 A;  2R9F A;  1F2B A;  3OF9 A;  4FIP A;  6PAD A;  5CVM A;  3S3Q A;  2AVW A;  4QRX A;  3MHS A;  2VHS A;  1GLO A;  3H7D A;  1F2C A;  4X6H A;  1GMY A;  4AXM A;  4XR7 A;  2ACT A;  2DJF B;  2NQG A;  4PP1 A;  1X9Y A;  3CBK A;  3H8C A;  2AU1 A;  3WXF A;  3RVX A;  1POP A;  3QJ3 A;  1AYU A;  2P86 A;  2F1G A;  4YYQ A;  3BC3 A;  3ERV A;  1ZIV A;  1K3B B;  2CIO A;  3GCB A;  3MHH A;  1KHQ A;  2XU1 A;  1BGO A;  3V6E A;  2PBH A;  3BOW A;  2AYN A;  5FPW A;  1EWL A;  2ARY A;  1MEM A;  3MTN A;  1PAD A;  1PPD A;  3WXG A;  2O6X A;  2XU5 A;  3H89 A;  3LXS A;  1MHW A;  4Q8H A;  4FK5 A;  5CVN B;  3S3R A;  1PBH A;  2YJ2 A;  1ZCM A;  3P5U A;  3F75 A;  2DC9 A;  1VJV A;  3BWK A;  1PCI A;  4CDE B;  1AYV A;  2YJ8 A;  5A24 A;  4OEM A;  2YJ9 A;  1ITO A;  1NB3 A;  1PPO A;  3CBJ A;  1KFU L;  3QT4 A;  5K16 A;  1GX3 A;  2E00 A;  1CQD A;  4BS6 A;  1ICF A;  4NV8 A;  3MOR A;  1S4V A;  3BPF A;  2F7D A;  3O1G A;  2FRA A;  3KW9 A;  3LTW A;  4PAD A;  2IBI A;  3U8E A;  1O0E A;  1MEG A;  3KKU A;  5CVO B;  1U9X A;  4PI3 A;  1PPN A;  2R9C A;  1DEU A;  2AYO A;  2FT2 A;  2YJC A;  1AU3 A;  2P0R A;  1TLO A;  2G8J A;  2VFB A;  1XKG A;  4I04 A;  2HD5 A;  3CH2 X;  7PCK A;  2DCB A;  1EWO A;  1U9V A;  2FYE A;  4PP2 E;  1F29 A;  3D9W A;  2R6N A;  3RVW A;  5EF4 A;  1QOL A;  4K7C A;  2WBF X;  2AUX A;  2DC7 A;  2FUD A;  1CB5 A;  4N8W A;  2G8E A;  4YYS A;  3IEJ A;  1ATK A;  1AU0 A;  1MDW A;  1W4T A;  2PNS A;  2XU3 A;  9PAP A;  3HHI A;  4W5C A;  2ATO A;  2B1N A;  1M6D A;  1KXR A;  4W4U A;  3IV2 A;  1YT7 A;  3K9M A;  4AXL A;  1JQP A;  2NQD B;  2HHN A;  2AUZ A;  3PDF A;  4YV8 A;  3N3G A;  5JA7 A;  1F2A A;  2OP3 A;  1CVZ A;  1PE6 A;  3HHA A;  1W6F A;  3IHP A;  3NHE A;  4YYR A;  3KX1 A;  1CSB B;  3PW3 A;  2Y6E A;  4BPV A;  1BY8 A;  1GEC E;  2HH5 A;  3E1Z B;  1AEC A;  1STF E;  3IMA A;  4OEL A;  3P5W A;  1YK7 A;  3K8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...