3IEJA

Pyrazole-based cathepsin s inhibitors with arylalkynes as p1 binding elements
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
221
structure length
221
Chain Sequence
AALPDSVDWREKGCVTEVKYQGSCGASWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrazole-based cathepsin S inhibitors with arylalkynes as P1 binding elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 69
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3iejA00
1CQDA 2GFOA 3KWBX 3P5VA 3RVWA 2NQGA 4I04A 4MZSA 4W4UA 1AYVA 5K16A 2R6NA 1S4VA 1AYWA 3PDFA 1ITOA 2OZ2A 2IPPB 2NQAA 1MS6A 2R9NA 3WXEA 3D6SA 1SNKA 1MIRA 1Y08A 5CHVA 1NB3A 1PPOA 3IV2A 1ME4A 4MSXA 2DC6A 4CDFB 3O0UA 1BY8A 2AS8A 3GCBA 1NQCA 1AU3A 2R9OA 3BC3A 4RY2A 3ZUAA 4FK5A 4MZOA 1XKGA 1TU6A 3KX1A 3PNRA 3MTNA 2FTDA 3BPMA 2DCAA 1CJLA 3U8EA 3IEJA 7PCKA 1ATKA 2F7DA 2JQGR 4CDCB 2F1GA 2AUZA 3BCNA 1AU0A 3H6SA 4K7CA 1NL6A 2AU1A 1EWLA 2AYOA 1PPNA 1F2CA 5CVOB 1EF7A 2R9MA 2YJ8A 3CH3X 3H8BA 2ATOA 3IOQA 1KFUL 5CVMA 1PPDA 4PP1A 4CDDB 2YJ9A 4BS6A 1CPJA 2DC7A 1YT7A 3KWZA 1ZCMA 2YJBA 1PIPA 1AYUA 3MORA 5EF4A 1A6RA 1U9QX 3H7DA 3I06A 3HHAA 4OELA 1SP4B 4X6HA 3MHHA 4BPVA 4XUIA 3V6EA 5CVNB 1EWOA 2R9FA 1GLOA 1K3BB 2CIOA 4Q8HA 4QH6A 2GHUA 4QBBA 1KHQA 1BGOA 2HXZA 4XR7A 3IHPA 2WBFX 2YJCA 1F2BA 2OP3A 2DZYA 2E00A 4BSQA 1U9VA 3BPFA 4PP2E 4P6EA 5PADA 3V6CA 2AIMA 1GCBA 1PBHA 4AXLA 4P6GA 1AECA 3DF0A 3KFQA 4N79A 3P5XA 1CV8A 1EWPA 1TL9A 2IBIA 1ZIVA 3KKUA 1PADA 1CSBB 2H7JA 4OEMA 6PADA 3WXFA 3F75A 2DCBA 3E1ZB 3OF9A 1M6DA 4FJCA 2VHFA 1PCIA 4BQVA 5A24A 3OVZA 3PBHA 2BDZA 3RVXA 1MDWA 1QXPA 5J94A 1DEUA 3CBJA 4I07A 2Y6EA 2DC8A 2CB5A 4BS5A 1FH0A 3IMAA 2DJGB 4X6JA 3K24A 2HH5A 2DJFB 2P7UA 2O6XA 1POPA 2C0YA 1QDQA 2FUDA 2YJ2A 2DC9A 1MHWA 3K9MA 1AU4A 4CZWA 3LXSA 3C9EA 1GECE 2B1NA 2FRQA 2B1MA 3PW3A 1F29A 1PXVA 1CTEA 4YYQA 4PADA 2Y5BA 2PADA 4X6IA 3LFYA 3CH2X 4YYWA 2XU5A 1U9XA 2XU1A 3P5UA 3TNXA 3N4CA 2FO5A 3H89A 4ZUXU 1JQPA 3KSEA 1YALA 3S3QA 5JA7A 3HHIA 2FQ9A 1NB5A 1CVZA 2G7YA 3MHSA 4N4ZA 1HUCB 1F2AA 4KLBA 2E01A 1Y4HA 1MEGA 2ACTA 2DZZA 2FYEA 3H8CA 2AVWA 4G54A 3QJ3A 3BWKA 1NLJA 2G8EA 4CDEB 4I05A 4QRGA 1THEA 2AUXA 2HHNA 1ICFA 4YVAA 2E03A 4YYSA 4YYRA 4N8WA 1KFXL 2NQIA 4YYVA 1TLOA 1YVBA 4DMYA 3B79A 3HWNA 4AXMA 4QRVA 2PBHA 5F02A 4PI3A 1O0EA 1BQIA 3KW9A 8PCHA 4WA6A 5FPWA 4YV8A 4QRXA 1U9WA 3OISA 3NHEA 2JQFR 1STFE 3QT4A 3USVA 1KHPA 3RVVA 1MEMA 1NPZA 1IWDA 4DMXA 5EGWA 1KXRA 3O1GA 5JH3A 3QSDA 1PE6A 1CS8A 3M99A 3AI8A 1PPPA 3IUTA 2FT2A 2PNSA 2PREA 3S3RA 2XU3A 3I3TA 3N3GA 2E02A 2P0RA 3BOWA 9PAPA 3F5VA 3ERVA 1YK8A 2BDLA 3WXGA 1YK7A 3K8UA 1DF0A 2NQDB 2OULA 2ARYA 1QMYA 5CHTA 2XU4A 1ME3A 1QOLA 2G8JA 3P5WA 1VJVA 2HD5A 4W5BA 2R9CA 1EWMA 3OF8A 1U5IA 2FRAA 2P86A 4W5CA 1VSNA 4Q8GA 1AU2A 2DCCA 1Q6KA 4HWYA 2G6DA 3N3KA 3CBKA 1AIMA 3HD3A 2VHSA 4YYUA 1BP4A 2DCDA 3OVXA 1GMYA 1X9YA 2AYNA 4FIPA 1CB5A
chains in the Genus database with same CATH superfamily
1CQDA 2GFOA 3KWBX 3P5VA 3RVWA 2NQGA 4I04A 4MZSA 4W4UA 1AYVA 5K16A 3O65A 2R6NA 1S4VA 1AYWA 3PDFA 1ITOA 5EZQA 2OZ2A 2IPPB 2NQAA 1MS6A 2R9NA 3WXEA 3D6SA 1SNKA 1MIRA 1Y08A 5CHVA 1NB3A 1PPOA 3IV2A 1ME4A 4MSXA 2DC6A 4CDFB 3O0UA 5JZEA 1BY8A 2AS8A 3GCBA 1NQCA 1AU3A 2R9OA 3BC3A 4RY2A 3ZUAA 4FK5A 4MZOA 1XKGA 4ZTBA 1TU6A 3KX1A 3PNRA 3MTNA 2FTDA 3PHWA 3BPMA 2DCAA 1CJLA 3U8EA 3IEJA 7PCKA 4WURA 1ATKA 4RNAA 2F7DA 4XZXA 2JQGR 4CDCB 2F1GA 2AUZA 3BCNA 1AU0A 3H6SA 4K7CA 1NL6A 2AU1A 1EWLA 2AYOA 1PPNA 1F2CA 5CVOB 3OQCA 2BTWB 1EF7A 2R9MA 2YJ8A 3CH3X 3H8BA 2ATOA 3IOQA 1KFUL 5CVMA 1PPDA 4PP1A 4CDDB 4GUAA 2HWKA 2YJ9A 4BS6A 1CPJA 2DC7A 3BB7A 1YT7A 3KWZA 1ZCMA 4IUMA 2YJBA 4MM3B 1PIPA 1AYUA 3MORA 5EF4A 1A6RA 1U9QX 3H7DA 3I06A 4BOPA 3HHAA 4BOUA 4OELA 1SP4B 4X6HA 3BBAA 3MHHA 4RF1A 4BPVA 4BOSA 4BOQA 4XUIA 3V6EA 5CVNB 4IP3A 3PRMA 1EWOA 2R9FA 4OW0A 1GLOA 1K3BB 3TRKA 2CIOA 4Q8HA 4QH6A 2GHUA 4QBBA 1KHQA 1BGOA 2HXZA 4XR7A 4RKXA 3IHPA 2WBFX 2YJCA 1F2BA 2OP3A 2DZYA 2E00A 4BSQA 1U9VA 3BPFA 4PP2E 4P6EA 5PADA 3V6CA 5E6JA 3ZNHA 4D8EA 2AIMA 3PSEA 1GCBA 4PT5A 1PBHA 4AXLA 2AGAA 4P6GA 1AECA 3DF0A 3KFQA 4N79A 2FE8A 3P5XA 4R3DA 1CV8A 1EWPA 1TL9A 2IBIA 1ZIVA 3KKUA 1PADA 3PRPA 1CSBB 2H7JA 4OEMA 6PADA 4OVZA 3WXFA 3F75A 2DCBA 3E1ZB 3OF9A 1M6DA 4FJCA 2VHFA 1PCIA 4BQVA 5A24A 3OVZA 3PBHA 2BDZA 1UKFA 3RVXA 1MDWA 5EZSA 1QXPA 5J94A 1DEUA 3CBJA 1PVJA 4I07A 2Y6EA 2DC8A 2CB5A 4BS5A 1FH0A 3IMAA 2DJGB 4X6JA 3K24A 2HH5A 2DJFB 2P7UA 2O6XA 1POPA 2C0YA 2Z84A 1QDQA 2FUDA 2YJ2A 2DC9A 1MHWA 2BU3A 3K9MA 1AU4A 4CZWA 3LXSA 3C9EA 1GECE 2B1NA 2FRQA 2B1MA 3PW3A 1F29A 1PXVA 3IFUA 1CTEA 4YYQA 4PADA 2DOSA 2Y5BA 2PADA 4X6IA 3LFYA 4D8IA 3CH2X 4YYWA 3BY4A 2XU5A 1U9XA 2XU1A 3P5UA 3TNXA 3N4CA 2FO5A 3H89A 4ZUXU 1JQPA 3KSEA 4BOZA 1YALA 3S3QA 5JA7A 3HHIA 2FQ9A 1NB5A 1CVZA 2G7YA 3MHSA 4N4ZA 1HUCB 3MJ5A 1F2AA 4KLBA 4REZA 2E01A 1Y4HA 1MEGA 2ACTA 2DZZA 2FYEA 3H8CA 2AVWA 4G54A 3QJ3A 3BWKA 1NLJA 4MI7A 3TMPA 2G8EA 4CDEB 4I05A 4QRGA 1THEA 2AUXA 2HHNA 1ICFA 4YVAA 5KO3A 4OVZB 2E03A 4YYSA 4YYRA 4N8WA 1KFXL 3E9SA 4A5UA 2NQIA 4YYVA 3PHXA 1TLOA 1YVBA 3W31A 4DMYA 3B79A 3HWNA 4AXMA 4QRVA 2PBHA 5F02A 4PI3A 1O0EA 1BQIA 3KW9A 8PCHA 4WA6A 5FPWA 4YV8A 4QRXA 3B21A 1U9WA 3OISA 3NHEA 2JQFR 1STFE 3QT4A 3USVA 1KHPA 3RVVA 2J7QC 1MEMA 1NPZA 3MTVA 1IWDA 4DMXA 5EGWA 1YZBA 1KXRA 3O1GA 5JH3A 3QSDA 1PE6A 1CS8A 3M99A 3AI8A 1PPPA 3IUTA 2FT2A 2PNSA 2PREA 3RNVA 2JRIA 3S3RA 2XU3A 3I3TA 3N3GA 2E02A 2P0RA 3BOWA 2JTCA 9PAPA 3F5VA 3ERVA 1YK8A 2BDLA 3WXGA 1YK7A 3K8UA 1DF0A 3MP2A 2NQDB 2OULA 2ARYA 1QMYA 2BTWA 4P16A 5CHTA 2XU4A 4M0WA 1ME3A 1QOLA 4HXDB 2G8JA 3P5WA 1VJVA 3PHUA 2HD5A 4W5BA 2R9CA 1DKIA 4RF0A 4D8BA 2J7QA 1EWMA 3OF8A 1U5IA 2FRAA 2P86A 4W5CA 1VSNA 4Q8GA 1AU2A 3W30A 2DCCA 1Q6KA 3C0RA 4HWYA 3PT2A 2G6DA 3N3KA 3CBKA 1AIMA 3HD3A 2VHSA 4YYUA 1BP4A 2DCDA 3OVXA 1GMYA 1X9YA 2UZJA 2AYNA 4FIPA 1CB5A
chains in the Genus database with same CATH topology
1CQDA 2GFOA 3KWBX 3P5VA 3RVWA 4BGFA 2NQGA 4I04A 4MZSA 4W4UA 1AYVA 4NV7A 5K16A 2R6NA 1S4VA 1AYWA 3PDFA 1ITOA 2OZ2A 2IPPB 2NQAA 1MS6A 2R9NA 3WXEA 3D6SA 1SNKA 1MIRA 1Y08A 5CHVA 1NB3A 1PPOA 3IV2A 1ME4A 4MSXA 2DC6A 4CDFB 3O0UA 1BY8A 2AS8A 3GCBA 1NQCA 1AU3A 2R9OA 3BC3A 4RY2A 3ZUAA 4FK5A 4MZOA 1XKGA 1TU6A 3KX1A 3PNRA 2BSZA 1GX3A 3MTNA 2FTDA 4GUZA 3BPMA 2DCAA 2VFBA 1CJLA 3U8EA 3IEJA 7PCKA 1ATKA 2F7DA 2JQGR 4CDCB 2F1GA 2AUZA 3BCNA 1AU0A 3H6SA 4K7CA 1NL6A 2AU1A 1EWLA 2AYOA 4C5PA 1PPNA 1F2CA 5CVOB 1EF7A 2R9MA 2YJ8A 3CH3X 3H8BA 2ATOA 4B55A 3IOQA 1KFUL 5CVMA 1PPDA 4PP1A 4CDDB 2YJ9A 4BS6A 1CPJA 2DC7A 1YT7A 3KWZA 1ZCMA 2YJBA 1PIPA 1AYUA 3MORA 5EF4A 1A6RA 1U9QX 3H7DA 3I06A 3HHAA 4OELA 1SP4B 4X6HA 3MHHA 4BPVA 4XUIA 3D9WA 3V6EA 5CVNB 1EWOA 2R9FA 1GLOA 1K3BB 2CIOA 4Q8HA 4QH6A 2GHUA 4QBBA 1KHQA 1BGOA 2HXZA 4XR7A 3IHPA 2WBFX 2YJCA 1F2BA 2OP3A 2DZYA 2E00A 4BSQA 1U9VA 3BPFA 4PP2E 4P6EA 5PADA 3V6CA 3LTWA 2AIMA 1GCBA 1PBHA 4AXLA 4P6GA 1AECA 3DF0A 3KFQA 4N79A 3P5XA 1CV8A 1EWPA 1TL9A 2IBIA 1ZIVA 3KKUA 1PADA 1CSBB 2H7JA 4OEMA 6PADA 3WXFA 3F75A 2DCBA 3E1ZB 3OF9A 1M6DA 4FJCA 2VHFA 1PCIA 1W5RA 4BQVA 5A24A 1W6FA 3OVZA 3PBHA 2BDZA 3RVXA 1MDWA 1QXPA 5J94A 1DEUA 3CBJA 4I07A 2Y6EA 2DC8A 2CB5A 4BS5A 1FH0A 3IMAA 2DJGB 4X6JA 3K24A 2HH5A 2DJFB 2P7UA 2O6XA 1POPA 2C0YA 1QDQA 2VFCA 2FUDA 2YJ2A 2DC9A 1MHWA 3K9MA 1AU4A 4CZWA 3LXSA 3C9EA 1GECE 2B1NA 2FRQA 2B1MA 3PW3A 1F29A 1PXVA 1CTEA 4YYQA 4PADA 2Y5BA 2PADA 4X6IA 3LFYA 3CH2X 4YYWA 2XU5A 1U9XA 2XU1A 3P5UA 3TNXA 3N4CA 2FO5A 3H89A 4ZUXU 1JQPA 3KSEA 1YALA 3S3QA 5JA7A 3HHIA 2FQ9A 1NB5A 1CVZA 2G7YA 3MHSA 4N4ZA 1HUCB 1F2AA 4KLBA 2E01A 1Y4HA 1MEGA 2ACTA 2DZZA 1W4TA 2FYEA 3H8CA 2AVWA 4G54A 3QJ3A 3BWKA 1NLJA 2G8EA 4CDEB 4I05A 4QRGA 1THEA 2AUXA 2HHNA 1ICFA 4YVAA 2E03A 4YYSA 4YYRA 4N8WA 1KFXL 2NQIA 4NV8A 4YYVA 1TLOA 1YVBA 4DMYA 3B79A 3HWNA 4AXMA 4QRVA 2PBHA 5F02A 4PI3A 1O0EA 1BQIA 3KW9A 8PCHA 4WA6A 5FPWA 4YV8A 4QRXA 1U9WA 3OISA 3NHEA 2JQFR 1STFE 3QT4A 3USVA 1KHPA 3RVVA 1MEMA 1NPZA 1IWDA 4DMXA 5EGWA 1KXRA 3O1GA 5JH3A 3QSDA 1PE6A 1CS8A 3M99A 3AI8A 1PPPA 3IUTA 2FT2A 2PNSA 2PREA 1E2TA 3S3RA 2XU3A 3I3TA 3N3GA 2E02A 2P0RA 3BOWA 9PAPA 3F5VA 3ERVA 1YK8A 2BDLA 3WXGA 1YK7A 3K8UA 1DF0A 2NQDB 2OULA 2ARYA 1QMYA 5CHTA 2XU4A 1ME3A 1QOLA 2G8JA 3P5WA 1VJVA 2HD5A 4W5BA 2R9CA 1EWMA 3OF8A 1U5IA 2FRAA 2P86A 4W5CA 1VSNA 4Q8GA 1AU2A 2DCCA 1Q6KA 4HWYA 2G6DA 3N3KA 3CBKA 1AIMA 3HD3A 2VHSA 4YYUA 1BP4A 2DCDA 3OVXA 1GMYA 1X9YA 2AYNA 4FIPA 1CB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQD A;  2GFO A;  3KWB X;  3P5V A;  3RVW A;  2NQG A;  4I04 A;  4MZS A;  4W4U A;  1AYV A;  5K16 A;  2R6N A;  1S4V A;  1AYW A;  3PDF A;  1ITO A;  2OZ2 A;  2IPP B;  2NQA A;  1MS6 A;  2R9N A;  3WXE A;  3D6S A;  1SNK A;  1MIR A;  1Y08 A;  5CHV A;  1NB3 A;  1PPO A;  3IV2 A;  1ME4 A;  4MSX A;  2DC6 A;  4CDF B;  3O0U A;  1BY8 A;  2AS8 A;  3GCB A;  1NQC A;  1AU3 A;  2R9O A;  3BC3 A;  4RY2 A;  3ZUA A;  4FK5 A;  4MZO A;  1XKG A;  1TU6 A;  3KX1 A;  3PNR A;  3MTN A;  2FTD A;  3BPM A;  2DCA A;  1CJL A;  3U8E A;  3IEJ A;  7PCK A;  1ATK A;  2F7D A;  2JQG R;  4CDC B;  2F1G A;  2AUZ A;  3BCN A;  1AU0 A;  3H6S A;  4K7C A;  1NL6 A;  2AU1 A;  1EWL A;  2AYO A;  1PPN A;  1F2C A;  5CVO B;  1EF7 A;  2R9M A;  2YJ8 A;  3CH3 X;  3H8B A;  2ATO A;  3IOQ A;  1KFU L;  5CVM A;  1PPD A;  4PP1 A;  4CDD B;  2YJ9 A;  4BS6 A;  1CPJ A;  2DC7 A;  1YT7 A;  3KWZ A;  1ZCM A;  2YJB A;  1PIP A;  1AYU A;  3MOR A;  5EF4 A;  1A6R A;  1U9Q X;  3H7D A;  3I06 A;  3HHA A;  4OEL A;  1SP4 B;  4X6H A;  3MHH A;  4BPV A;  4XUI A;  3V6E A;  5CVN B;  1EWO A;  2R9F A;  1GLO A;  1K3B B;  2CIO A;  4Q8H A;  4QH6 A;  2GHU A;  4QBB A;  1KHQ A;  1BGO A;  2HXZ A;  4XR7 A;  3IHP A;  2WBF X;  2YJC A;  1F2B A;  2OP3 A;  2DZY A;  2E00 A;  4BSQ A;  1U9V A;  3BPF A;  4PP2 E;  4P6E A;  5PAD A;  3V6C A;  2AIM A;  1GCB A;  1PBH A;  4AXL A;  4P6G A;  1AEC A;  3DF0 A;  3KFQ A;  4N79 A;  3P5X A;  1CV8 A;  1EWP A;  1TL9 A;  2IBI A;  1ZIV A;  3KKU A;  1PAD A;  1CSB B;  2H7J A;  4OEM A;  6PAD A;  3WXF A;  3F75 A;  2DCB A;  3E1Z B;  3OF9 A;  1M6D A;  4FJC A;  2VHF A;  1PCI A;  4BQV A;  5A24 A;  3OVZ A;  3PBH A;  2BDZ A;  3RVX A;  1MDW A;  1QXP A;  5J94 A;  1DEU A;  3CBJ A;  4I07 A;  2Y6E A;  2DC8 A;  2CB5 A;  4BS5 A;  1FH0 A;  3IMA A;  2DJG B;  4X6J A;  3K24 A;  2HH5 A;  2DJF B;  2P7U A;  2O6X A;  1POP A;  2C0Y A;  1QDQ A;  2FUD A;  2YJ2 A;  2DC9 A;  1MHW A;  3K9M A;  1AU4 A;  4CZW A;  3LXS A;  3C9E A;  1GEC E;  2B1N A;  2FRQ A;  2B1M A;  3PW3 A;  1F29 A;  1PXV A;  1CTE A;  4YYQ A;  4PAD A;  2Y5B A;  2PAD A;  4X6I A;  3LFY A;  3CH2 X;  4YYW A;  2XU5 A;  1U9X A;  2XU1 A;  3P5U A;  3TNX A;  3N4C A;  2FO5 A;  3H89 A;  4ZUX U;  1JQP A;  3KSE A;  1YAL A;  3S3Q A;  5JA7 A;  3HHI A;  2FQ9 A;  1NB5 A;  1CVZ A;  2G7Y A;  3MHS A;  4N4Z A;  1HUC B;  1F2A A;  4KLB A;  2E01 A;  1Y4H A;  1MEG A;  2ACT A;  2DZZ A;  2FYE A;  3H8C A;  2AVW A;  4G54 A;  3QJ3 A;  3BWK A;  1NLJ A;  2G8E A;  4CDE B;  4I05 A;  4QRG A;  1THE A;  2AUX A;  2HHN A;  1ICF A;  4YVA A;  2E03 A;  4YYS A;  4YYR A;  4N8W A;  1KFX L;  2NQI A;  4YYV A;  1TLO A;  1YVB A;  4DMY A;  3B79 A;  3HWN A;  4AXM A;  4QRV A;  2PBH A;  5F02 A;  4PI3 A;  1O0E A;  1BQI A;  3KW9 A;  8PCH A;  4WA6 A;  5FPW A;  4YV8 A;  4QRX A;  1U9W A;  3OIS A;  3NHE A;  2JQF R;  1STF E;  3QT4 A;  3USV A;  1KHP A;  3RVV A;  1MEM A;  1NPZ A;  1IWD A;  4DMX A;  5EGW A;  1KXR A;  3O1G A;  5JH3 A;  3QSD A;  1PE6 A;  1CS8 A;  3M99 A;  3AI8 A;  1PPP A;  3IUT A;  2FT2 A;  2PNS A;  2PRE A;  3S3R A;  2XU3 A;  3I3T A;  3N3G A;  2E02 A;  2P0R A;  3BOW A;  9PAP A;  3F5V A;  3ERV A;  1YK8 A;  2BDL A;  3WXG A;  1YK7 A;  3K8U A;  1DF0 A;  2NQD B;  2OUL A;  2ARY A;  1QMY A;  5CHT A;  2XU4 A;  1ME3 A;  1QOL A;  2G8J A;  3P5W A;  1VJV A;  2HD5 A;  4W5B A;  2R9C A;  1EWM A;  3OF8 A;  1U5I A;  2FRA A;  2P86 A;  4W5C A;  1VSN A;  4Q8G A;  1AU2 A;  2DCC A;  1Q6K A;  4HWY A;  2G6D A;  3N3K A;  3CBK A;  1AIM A;  3HD3 A;  2VHS A;  4YYU A;  1BP4 A;  2DCD A;  3OVX A;  1GMY A;  1X9Y A;  2AYN A;  4FIP A;  1CB5 A; 
#chains in the Genus database with same CATH topology
 1CQD A;  2GFO A;  3KWB X;  3P5V A;  3RVW A;  2NQG A;  4I04 A;  4MZS A;  4W4U A;  1AYV A;  5K16 A;  3O65 A;  2R6N A;  1S4V A;  1AYW A;  3PDF A;  1ITO A;  5EZQ A;  2OZ2 A;  2IPP B;  2NQA A;  1MS6 A;  2R9N A;  3WXE A;  3D6S A;  1SNK A;  1MIR A;  1Y08 A;  5CHV A;  1NB3 A;  1PPO A;  3IV2 A;  1ME4 A;  4MSX A;  2DC6 A;  4CDF B;  3O0U A;  5JZE A;  1BY8 A;  2AS8 A;  3GCB A;  1NQC A;  1AU3 A;  2R9O A;  3BC3 A;  4RY2 A;  3ZUA A;  4FK5 A;  4MZO A;  1XKG A;  4ZTB A;  1TU6 A;  3KX1 A;  3PNR A;  3MTN A;  2FTD A;  3PHW A;  3BPM A;  2DCA A;  1CJL A;  3U8E A;  3IEJ A;  7PCK A;  4WUR A;  1ATK A;  4RNA A;  2F7D A;  4XZX A;  2JQG R;  4CDC B;  2F1G A;  2AUZ A;  3BCN A;  1AU0 A;  3H6S A;  4K7C A;  1NL6 A;  2AU1 A;  1EWL A;  2AYO A;  1PPN A;  1F2C A;  5CVO B;  3OQC A;  2BTW B;  1EF7 A;  2R9M A;  2YJ8 A;  3CH3 X;  3H8B A;  2ATO A;  3IOQ A;  1KFU L;  5CVM A;  1PPD A;  4PP1 A;  4CDD B;  4GUA A;  2HWK A;  2YJ9 A;  4BS6 A;  1CPJ A;  2DC7 A;  3BB7 A;  1YT7 A;  3KWZ A;  1ZCM A;  4IUM A;  2YJB A;  4MM3 B;  1PIP A;  1AYU A;  3MOR A;  5EF4 A;  1A6R A;  1U9Q X;  3H7D A;  3I06 A;  4BOP A;  3HHA A;  4BOU A;  4OEL A;  1SP4 B;  4X6H A;  3BBA A;  3MHH A;  4RF1 A;  4BPV A;  4BOS A;  4BOQ A;  4XUI A;  3V6E A;  5CVN B;  4IP3 A;  3PRM A;  1EWO A;  2R9F A;  4OW0 A;  1GLO A;  1K3B B;  3TRK A;  2CIO A;  4Q8H A;  4QH6 A;  2GHU A;  4QBB A;  1KHQ A;  1BGO A;  2HXZ A;  4XR7 A;  4RKX A;  3IHP A;  2WBF X;  2YJC A;  1F2B A;  2OP3 A;  2DZY A;  2E00 A;  4BSQ A;  1U9V A;  3BPF A;  4PP2 E;  4P6E A;  5PAD A;  3V6C A;  5E6J A;  3ZNH A;  4D8E A;  2AIM A;  3PSE A;  1GCB A;  4PT5 A;  1PBH A;  4AXL A;  2AGA A;  4P6G A;  1AEC A;  3DF0 A;  3KFQ A;  4N79 A;  2FE8 A;  3P5X A;  4R3D A;  1CV8 A;  1EWP A;  1TL9 A;  2IBI A;  1ZIV A;  3KKU A;  1PAD A;  3PRP A;  1CSB B;  2H7J A;  4OEM A;  6PAD A;  4OVZ A;  3WXF A;  3F75 A;  2DCB A;  3E1Z B;  3OF9 A;  1M6D A;  4FJC A;  2VHF A;  1PCI A;  4BQV A;  5A24 A;  3OVZ A;  3PBH A;  2BDZ A;  1UKF A;  3RVX A;  1MDW A;  5EZS A;  1QXP A;  5J94 A;  1DEU A;  3CBJ A;  1PVJ A;  4I07 A;  2Y6E A;  2DC8 A;  2CB5 A;  4BS5 A;  1FH0 A;  3IMA A;  2DJG B;  4X6J A;  3K24 A;  2HH5 A;  2DJF B;  2P7U A;  2O6X A;  1POP A;  2C0Y A;  2Z84 A;  1QDQ A;  2FUD A;  2YJ2 A;  2DC9 A;  1MHW A;  2BU3 A;  3K9M A;  1AU4 A;  4CZW A;  3LXS A;  3C9E A;  1GEC E;  2B1N A;  2FRQ A;  2B1M A;  3PW3 A;  1F29 A;  1PXV A;  3IFU A;  1CTE A;  4YYQ A;  4PAD A;  2DOS A;  2Y5B A;  2PAD A;  4X6I A;  3LFY A;  4D8I A;  3CH2 X;  4YYW A;  3BY4 A;  2XU5 A;  1U9X A;  2XU1 A;  3P5U A;  3TNX A;  3N4C A;  2FO5 A;  3H89 A;  4ZUX U;  1JQP A;  3KSE A;  4BOZ A;  1YAL A;  3S3Q A;  5JA7 A;  3HHI A;  2FQ9 A;  1NB5 A;  1CVZ A;  2G7Y A;  3MHS A;  4N4Z A;  1HUC B;  3MJ5 A;  1F2A A;  4KLB A;  4REZ A;  2E01 A;  1Y4H A;  1MEG A;  2ACT A;  2DZZ A;  2FYE A;  3H8C A;  2AVW A;  4G54 A;  3QJ3 A;  3BWK A;  1NLJ A;  4MI7 A;  3TMP A;  2G8E A;  4CDE B;  4I05 A;  4QRG A;  1THE A;  2AUX A;  2HHN A;  1ICF A;  4YVA A;  5KO3 A;  4OVZ B;  2E03 A;  4YYS A;  4YYR A;  4N8W A;  1KFX L;  3E9S A;  4A5U A;  2NQI A;  4YYV A;  3PHX A;  1TLO A;  1YVB A;  3W31 A;  4DMY A;  3B79 A;  3HWN A;  4AXM A;  4QRV A;  2PBH A;  5F02 A;  4PI3 A;  1O0E A;  1BQI A;  3KW9 A;  8PCH A;  4WA6 A;  5FPW A;  4YV8 A;  4QRX A;  3B21 A;  1U9W A;  3OIS A;  3NHE A;  2JQF R;  1STF E;  3QT4 A;  3USV A;  1KHP A;  3RVV A;  2J7Q C;  1MEM A;  1NPZ A;  3MTV A;  1IWD A;  4DMX A;  5EGW A;  1YZB A;  1KXR A;  3O1G A;  5JH3 A;  3QSD A;  1PE6 A;  1CS8 A;  3M99 A;  3AI8 A;  1PPP A;  3IUT A;  2FT2 A;  2PNS A;  2PRE A;  3RNV A;  2JRI A;  3S3R A;  2XU3 A;  3I3T A;  3N3G A;  2E02 A;  2P0R A;  3BOW A;  2JTC A;  9PAP A;  3F5V A;  3ERV A;  1YK8 A;  2BDL A;  3WXG A;  1YK7 A;  3K8U A;  1DF0 A;  3MP2 A;  2NQD B;  2OUL A;  2ARY A;  1QMY A;  2BTW A;  4P16 A;  5CHT A;  2XU4 A;  4M0W A;  1ME3 A;  1QOL A;  4HXD B;  2G8J A;  3P5W A;  1VJV A;  3PHU A;  2HD5 A;  4W5B A;  2R9C A;  1DKI A;  4RF0 A;  4D8B A;  2J7Q A;  1EWM A;  3OF8 A;  1U5I A;  2FRA A;  2P86 A;  4W5C A;  1VSN A;  4Q8G A;  1AU2 A;  3W30 A;  2DCC A;  1Q6K A;  3C0R A;  4HWY A;  3PT2 A;  2G6D A;  3N3K A;  3CBK A;  1AIM A;  3HD3 A;  2VHS A;  4YYU A;  1BP4 A;  2DCD A;  3OVX A;  1GMY A;  1X9Y A;  2UZJ A;  2AYN A;  4FIP A;  1CB5 A; 
#chains in the Genus database with same CATH homology
 1CQD A;  2GFO A;  3KWB X;  3P5V A;  3RVW A;  4BGF A;  2NQG A;  4I04 A;  4MZS A;  4W4U A;  1AYV A;  4NV7 A;  5K16 A;  2R6N A;  1S4V A;  1AYW A;  3PDF A;  1ITO A;  2OZ2 A;  2IPP B;  2NQA A;  1MS6 A;  2R9N A;  3WXE A;  3D6S A;  1SNK A;  1MIR A;  1Y08 A;  5CHV A;  1NB3 A;  1PPO A;  3IV2 A;  1ME4 A;  4MSX A;  2DC6 A;  4CDF B;  3O0U A;  1BY8 A;  2AS8 A;  3GCB A;  1NQC A;  1AU3 A;  2R9O A;  3BC3 A;  4RY2 A;  3ZUA A;  4FK5 A;  4MZO A;  1XKG A;  1TU6 A;  3KX1 A;  3PNR A;  2BSZ A;  1GX3 A;  3MTN A;  2FTD A;  4GUZ A;  3BPM A;  2DCA A;  2VFB A;  1CJL A;  3U8E A;  3IEJ A;  7PCK A;  1ATK A;  2F7D A;  2JQG R;  4CDC B;  2F1G A;  2AUZ A;  3BCN A;  1AU0 A;  3H6S A;  4K7C A;  1NL6 A;  2AU1 A;  1EWL A;  2AYO A;  4C5P A;  1PPN A;  1F2C A;  5CVO B;  1EF7 A;  2R9M A;  2YJ8 A;  3CH3 X;  3H8B A;  2ATO A;  4B55 A;  3IOQ A;  1KFU L;  5CVM A;  1PPD A;  4PP1 A;  4CDD B;  2YJ9 A;  4BS6 A;  1CPJ A;  2DC7 A;  1YT7 A;  3KWZ A;  1ZCM A;  2YJB A;  1PIP A;  1AYU A;  3MOR A;  5EF4 A;  1A6R A;  1U9Q X;  3H7D A;  3I06 A;  3HHA A;  4OEL A;  1SP4 B;  4X6H A;  3MHH A;  4BPV A;  4XUI A;  3D9W A;  3V6E A;  5CVN B;  1EWO A;  2R9F A;  1GLO A;  1K3B B;  2CIO A;  4Q8H A;  4QH6 A;  2GHU A;  4QBB A;  1KHQ A;  1BGO A;  2HXZ A;  4XR7 A;  3IHP A;  2WBF X;  2YJC A;  1F2B A;  2OP3 A;  2DZY A;  2E00 A;  4BSQ A;  1U9V A;  3BPF A;  4PP2 E;  4P6E A;  5PAD A;  3V6C A;  3LTW A;  2AIM A;  1GCB A;  1PBH A;  4AXL A;  4P6G A;  1AEC A;  3DF0 A;  3KFQ A;  4N79 A;  3P5X A;  1CV8 A;  1EWP A;  1TL9 A;  2IBI A;  1ZIV A;  3KKU A;  1PAD A;  1CSB B;  2H7J A;  4OEM A;  6PAD A;  3WXF A;  3F75 A;  2DCB A;  3E1Z B;  3OF9 A;  1M6D A;  4FJC A;  2VHF A;  1PCI A;  1W5R A;  4BQV A;  5A24 A;  1W6F A;  3OVZ A;  3PBH A;  2BDZ A;  3RVX A;  1MDW A;  1QXP A;  5J94 A;  1DEU A;  3CBJ A;  4I07 A;  2Y6E A;  2DC8 A;  2CB5 A;  4BS5 A;  1FH0 A;  3IMA A;  2DJG B;  4X6J A;  3K24 A;  2HH5 A;  2DJF B;  2P7U A;  2O6X A;  1POP A;  2C0Y A;  1QDQ A;  2VFC A;  2FUD A;  2YJ2 A;  2DC9 A;  1MHW A;  3K9M A;  1AU4 A;  4CZW A;  3LXS A;  3C9E A;  1GEC E;  2B1N A;  2FRQ A;  2B1M A;  3PW3 A;  1F29 A;  1PXV A;  1CTE A;  4YYQ A;  4PAD A;  2Y5B A;  2PAD A;  4X6I A;  3LFY A;  3CH2 X;  4YYW A;  2XU5 A;  1U9X A;  2XU1 A;  3P5U A;  3TNX A;  3N4C A;  2FO5 A;  3H89 A;  4ZUX U;  1JQP A;  3KSE A;  1YAL A;  3S3Q A;  5JA7 A;  3HHI A;  2FQ9 A;  1NB5 A;  1CVZ A;  2G7Y A;  3MHS A;  4N4Z A;  1HUC B;  1F2A A;  4KLB A;  2E01 A;  1Y4H A;  1MEG A;  2ACT A;  2DZZ A;  1W4T A;  2FYE A;  3H8C A;  2AVW A;  4G54 A;  3QJ3 A;  3BWK A;  1NLJ A;  2G8E A;  4CDE B;  4I05 A;  4QRG A;  1THE A;  2AUX A;  2HHN A;  1ICF A;  4YVA A;  2E03 A;  4YYS A;  4YYR A;  4N8W A;  1KFX L;  2NQI A;  4NV8 A;  4YYV A;  1TLO A;  1YVB A;  4DMY A;  3B79 A;  3HWN A;  4AXM A;  4QRV A;  2PBH A;  5F02 A;  4PI3 A;  1O0E A;  1BQI A;  3KW9 A;  8PCH A;  4WA6 A;  5FPW A;  4YV8 A;  4QRX A;  1U9W A;  3OIS A;  3NHE A;  2JQF R;  1STF E;  3QT4 A;  3USV A;  1KHP A;  3RVV A;  1MEM A;  1NPZ A;  1IWD A;  4DMX A;  5EGW A;  1KXR A;  3O1G A;  5JH3 A;  3QSD A;  1PE6 A;  1CS8 A;  3M99 A;  3AI8 A;  1PPP A;  3IUT A;  2FT2 A;  2PNS A;  2PRE A;  1E2T A;  3S3R A;  2XU3 A;  3I3T A;  3N3G A;  2E02 A;  2P0R A;  3BOW A;  9PAP A;  3F5V A;  3ERV A;  1YK8 A;  2BDL A;  3WXG A;  1YK7 A;  3K8U A;  1DF0 A;  2NQD B;  2OUL A;  2ARY A;  1QMY A;  5CHT A;  2XU4 A;  1ME3 A;  1QOL A;  2G8J A;  3P5W A;  1VJV A;  2HD5 A;  4W5B A;  2R9C A;  1EWM A;  3OF8 A;  1U5I A;  2FRA A;  2P86 A;  4W5C A;  1VSN A;  4Q8G A;  1AU2 A;  2DCC A;  1Q6K A;  4HWY A;  2G6D A;  3N3K A;  3CBK A;  1AIM A;  3HD3 A;  2VHS A;  4YYU A;  1BP4 A;  2DCD A;  3OVX A;  1GMY A;  1X9Y A;  2AYN A;  4FIP A;  1CB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...