2H7JA

Crystal structure of cathepsin s in complex with a nonpeptidic inhibitor.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Identification of selective, nonpeptidic nitrile inhibitors of cathepsin s using the substrate activity screening method.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2h7jA00
3PW3A 3V6EA 1CVZA 2O6XA 1PIPA 7PCKA 4AXLA 3RVWA 3P5XA 3LXSA 2E01A 5A24A 3GCBA 3PBHA 3QSDA 1O0EA 2XU3A 1X9YA 5PADA 4XUIA 2E02A 2OP3A 3PDFA 4PADA 2AVWA 5EGWA 4P6GA 1KHQA 4X6JA 1ITOA 1EWMA 1ZIVA 2DZYA 1YALA 1POPA 2PBHA 2FUDA 2FQ9A 4BS5A 3TNXA 2DJFB 1AIMA 1U9WA 1FH0A 1M6DA 2AUXA 1AU0A 2AYNA 2PADA 2OZ2A 1Y08A 3O1GA 4G54A 1GCBA 5J94A 2ACTA 1GLOA 2YJBA 1KFXL 2XU5A 1BQIA 1Q6KA 1DEUA 1QDQA 2E00A 1S4VA 3I3TA 1F2BA 3K24A 2DC9A 1MEGA 3BCNA 3IEJA 2WBFX 2AU1A 1BGOA 4W5CA 4W4UA 2GHUA 3BPFA 1PPOA 3KWZA 1PE6A 3CH3X 2FRQA 3KX1A 1ME3A 1SP4B 1ME4A 2E03A 2BDZA 4HWYA 1U9XA 2YJCA 1PPPA 2JQFR 2NQGA 2R9MA 5CVNB 1CTEA 3OF8A 3KFQA 2P86A 2XU4A 4YYVA 2DC8A 3MHSA 2DCBA 3IHPA 1IWDA 2AIMA 1CSBB 4YYWA 4YYSA 1AU3A 2YJ9A 3CH2X 3KSEA 3HWNA 3S3QA 1CQDA 1CV8A 4FK5A 2NQDB 2IPPB 2HH5A 1PXVA 1YT7A 1ZCMA 1KXRA 4KLBA 2G8EA 4K7CA 5JH3A 3F75A 1NB3A 3NHEA 4W5BA 4YYQA 3H8CA 4BS6A 1K3BB 4CDFB 4N8WA 3P5VA 3HD3A 1CPJA 2R6NA 1TLOA 1PCIA 3USVA 1KHPA 5CVMA 3P5UA 3OVZA 2PNSA 4XR7A 3N4CA 1EWLA 2AUZA 3H6SA 2F1GA 1PPDA 4QRXA 1Y4HA 4RY2A 5EF4A 1GMYA 2NQAA 3BWKA 1MS6A 2R9NA 1EWOA 2G8JA 2Y5BA 2YJ2A 3P5WA 3MHHA 2Y6EA 3KWBX 1QOLA 3KKUA 1YK8A 2CB5A 2F7DA 1MIRA 2HXZA 5CVOB 1ATKA 3U8EA 4QH6A 4OELA 1YK7A 3V6CA 3KW9A 1MEMA 3BC3A 3DF0A 3N3KA 3IV2A 1KFUL 4Q8GA 3WXEA 3IUTA 2NQIA 1EF7A 3HHIA 4CDEB 1NPZA 4FIPA 1TU6A 2FT2A 1CB5A 1BY8A 4MZSA 4CZWA 1GECE 3QJ3A 3BOWA 1AU2A 3O0UA 2FO5A 3LFYA 1U9QX 3OISA 1A6RA 3S3RA 4BPVA 3AI8A 4Q8HA 3H7DA 3RVXA 9PAPA 3D6SA 4BSQA 4QBBA 1NLJA 1YVBA 4PP2E 4P6EA 2FRAA 4AXMA 3WXGA 3HHAA 1QXPA 2DJGB 4QRGA 2HHNA 1STFE 4YYUA 3B79A 3K9MA 2PREA 1NL6A 2H7JA 2DC7A 4YV8A 2DCDA 4DMXA 8PCHA 1SNKA 3H89A 3C9EA 4PI3A 4MSXA 3H8BA 2FYEA 3K8UA 2JQGR 1F29A 2YJ8A 1PBHA 1AYUA 5FPWA 2R9OA 2DZZA 1AYVA 1MDWA 2B1NA 3CBJA 2ATOA 1AU4A 1U5IA 4CDDB 1QMYA 2P7UA 2B1MA 3IMAA 4N4ZA 1THEA 3ZUAA 4QRVA 1PADA 3WXFA 2BDLA 4N79A 1CJLA 3IOQA 2P0RA 3OF9A 6PADA 1F2CA 2DC6A 2AYOA 5CHTA 3ERVA 2G6DA 3CBKA 1JQPA 4X6HA 2OULA 1PPNA 2VHSA 1BP4A 3N3GA 1AECA 1U9VA 3M99A 2GFOA 3F5VA 4WA6A 4I05A 1MHWA 2FTDA 3OVXA 2AS8A 4YVAA 1NB5A 4I07A 4BQVA 1VJVA 4OEMA 1HUCB 3MORA 2R9CA 4ZUXU 1XKGA 1CS8A 1F2AA 2XU1A 2G7YA 3MTNA 3E1ZB 4X6IA 2DCCA 3RVVA 1TL9A 3BPMA 3PNRA 3QT4A 2VHFA 2DCAA 2R9FA 5F02A 1VSNA 4CDCB 1EWPA 3I06A 1NQCA 1DF0A 4I04A 2HD5A 4MZOA 5CHVA 2C0YA 5JA7A 4FJCA 4YYRA 2ARYA 5K16A 4PP1A 2IBIA 2CIOA 4DMYA 1ICFA 1AYWA
chains in the Genus database with same CATH superfamily
3PW3A 3V6EA 2J7QA 1CVZA 2O6XA 1PIPA 7PCKA 4AXLA 3RVWA 3P5XA 3LXSA 2E01A 5A24A 3GCBA 3PBHA 3QSDA 1O0EA 2XU3A 1X9YA 5PADA 4XUIA 2E02A 2OP3A 3PDFA 4PADA 2AVWA 5EGWA 4P6GA 1KHQA 4X6JA 1ITOA 1EWMA 1ZIVA 2DZYA 1YALA 1POPA 2PBHA 2FUDA 2FQ9A 4BS5A 4BOSA 3TNXA 2DJFB 1AIMA 1DKIA 4D8BA 1U9WA 1FH0A 1M6DA 2AUXA 1AU0A 5EZSA 2AYNA 2PADA 3MTVA 2OZ2A 1Y08A 4RF0A 3O1GA 4G54A 1GCBA 5J94A 2ACTA 1GLOA 2YJBA 1KFXL 2XU5A 5JZEA 1BQIA 5KO3A 1Q6KA 1DEUA 1QDQA 2E00A 1S4VA 3I3TA 1F2BA 3K24A 2DC9A 1MEGA 3BCNA 3IEJA 2WBFX 2AU1A 1BGOA 4W5CA 4W4UA 4BOQA 2GHUA 3BPFA 1PPOA 3KWZA 1PE6A 3CH3X 2BTWA 2FRQA 2FE8A 3O65A 3RNVA 3KX1A 3PHWA 2JTCA 1ME3A 1SP4B 1ME4A 2E03A 3C0RA 4GUAA 3E9SA 3ZNHA 2BDZA 4HWYA 4MM3B 1U9XA 2YJCA 1PPPA 2JQFR 4A5UA 4MI7A 2NQGA 2R9MA 5CVNB 1CTEA 3OF8A 3PHUA 3KFQA 2P86A 2XU4A 2UZJA 4YYVA 4OVZA 2DC8A 3MHSA 2DCBA 3MJ5A 3IHPA 1IWDA 2AIMA 1CSBB 4YYWA 4BOUA 4YYSA 1AU3A 2YJ9A 3CH2X 3BB7A 3HWNA 3KSEA 3S3QA 4BOZA 1CQDA 1CV8A 4FK5A 3TMPA 2NQDB 4BOPA 2IPPB 2HH5A 1PXVA 4R3DA 4IUMA 1YT7A 4P16A 1ZCMA 1KXRA 4KLBA 2G8EA 4K7CA 3W31A 5JH3A 3F75A 1NB3A 3NHEA 4W5BA 4YYQA 3H8CA 4BS6A 1K3BB 4PT5A 4CDFB 4N8WA 3P5VA 4ZTBA 3HD3A 1CPJA 2R6NA 1TLOA 1PCIA 3USVA 1KHPA 5CVMA 3P5UA 3OVZA 2PNSA 4XR7A 3N4CA 1EWLA 2AUZA 3H6SA 3PHXA 2F1GA 1PPDA 4QRXA 1Y4HA 1PVJA 4RY2A 5EF4A 1GMYA 2NQAA 3BWKA 1MS6A 2R9NA 1EWOA 2J7QC 2G8JA 5E6JA 2Y5BA 2YJ2A 3P5WA 3MHHA 2Y6EA 3KWBX 1QOLA 3KKUA 1YK8A 2CB5A 2F7DA 1MIRA 2AGAA 1UKFA 2HXZA 5CVOB 3BBAA 1ATKA 3IFUA 3U8EA 2HWKA 3PRMA 4QH6A 2BTWB 4OELA 1YK7A 3PRPA 3KW9A 3V6CA 1MEMA 3BC3A 3DF0A 3N3KA 4RKXA 3IV2A 1KFUL 3BY4A 4Q8GA 3WXEA 3IUTA 2NQIA 1EF7A 3HHIA 4CDEB 1NPZA 4FIPA 1TU6A 2FT2A 4D8IA 1CB5A 4RNAA 1BY8A 3PT2A 4OVZB 4MZSA 4CZWA 1GECE 3QJ3A 3BOWA 1AU2A 3O0UA 2FO5A 3LFYA 1U9QX 3W30A 3OISA 1A6RA 3S3RA 4BPVA 3AI8A 4Q8HA 3H7DA 3RVXA 9PAPA 3D6SA 4BSQA 4QBBA 1NLJA 1YVBA 4PP2E 4P6EA 2FRAA 4AXMA 3WXGA 3HHAA 1QXPA 2Z84A 2DJGB 4QRGA 4WURA 2HHNA 1STFE 4YYUA 4RF1A 3B79A 3K9MA 2PREA 1NL6A 2H7JA 2DC7A 4YV8A 2DCDA 4DMXA 8PCHA 1SNKA 3H89A 3C9EA 4PI3A 4MSXA 3H8BA 1YZBA 2FYEA 3K8UA 2JQGR 1F29A 2JRIA 2YJ8A 1PBHA 1AYUA 2BU3A 5FPWA 2R9OA 2DZZA 4REZA 1AYVA 3B21A 1MDWA 2B1NA 3CBJA 4IP3A 2ATOA 3TRKA 1AU4A 1U5IA 4CDDB 1QMYA 2P7UA 2B1MA 3IMAA 4N4ZA 1THEA 3ZUAA 4QRVA 1PADA 3WXFA 5EZQA 2BDLA 4N79A 1CJLA 3IOQA 2P0RA 3OF9A 6PADA 1F2CA 2DC6A 2AYOA 5CHTA 3ERVA 2G6DA 3CBKA 1JQPA 4X6HA 2OULA 1PPNA 2VHSA 1BP4A 3N3GA 1AECA 1U9VA 3M99A 4HXDB 2GFOA 3F5VA 4WA6A 4I05A 1MHWA 2FTDA 3OVXA 2AS8A 4YVAA 1NB5A 4I07A 4BQVA 1VJVA 4D8EA 4OEMA 1HUCB 3MORA 2R9CA 4ZUXU 1XKGA 1CS8A 1F2AA 2XU1A 2G7YA 3MTNA 3E1ZB 4X6IA 2DCCA 3RVVA 1TL9A 3BPMA 3PNRA 3QT4A 2VHFA 4M0WA 2DCAA 4XZXA 2R9FA 3PSEA 5F02A 1VSNA 4CDCB 1EWPA 3I06A 3OQCA 1NQCA 4OW0A 1DF0A 2DOSA 4I04A 2HD5A 4MZOA 5CHVA 2C0YA 5JA7A 4FJCA 4YYRA 2ARYA 5K16A 3MP2A 4PP1A 2IBIA 2CIOA 4DMYA 1ICFA 1AYWA
chains in the Genus database with same CATH topology
3PW3A 3V6EA 1CVZA 2O6XA 1PIPA 7PCKA 4AXLA 3RVWA 3P5XA 3LXSA 2E01A 5A24A 3GCBA 3PBHA 3QSDA 1O0EA 2XU3A 1X9YA 1E2TA 5PADA 4XUIA 2E02A 2OP3A 3PDFA 4PADA 2AVWA 5EGWA 4P6GA 1KHQA 4BGFA 4X6JA 1ITOA 1EWMA 1ZIVA 2DZYA 1YALA 1POPA 2PBHA 2FUDA 2FQ9A 4BS5A 3TNXA 2DJFB 1AIMA 1U9WA 1FH0A 1M6DA 2AUXA 1AU0A 2AYNA 2PADA 2OZ2A 1Y08A 3O1GA 4G54A 1GCBA 4NV8A 5J94A 2ACTA 1GLOA 2YJBA 1KFXL 2XU5A 1BQIA 1Q6KA 1DEUA 1QDQA 2E00A 1S4VA 3I3TA 1F2BA 3K24A 2DC9A 1MEGA 3D9WA 3BCNA 3IEJA 2WBFX 2AU1A 1BGOA 4W5CA 4W4UA 2GHUA 3BPFA 1PPOA 3KWZA 1PE6A 3CH3X 2FRQA 3KX1A 1ME3A 1SP4B 1ME4A 2E03A 2BDZA 4HWYA 1U9XA 2YJCA 1PPPA 2JQFR 2NQGA 2R9MA 5CVNB 1CTEA 3OF8A 3KFQA 2P86A 2XU4A 4YYVA 2DC8A 3MHSA 2DCBA 3IHPA 1IWDA 2AIMA 1CSBB 4YYWA 4YYSA 1AU3A 2YJ9A 3CH2X 3KSEA 3HWNA 3S3QA 1CQDA 1CV8A 4FK5A 2NQDB 2IPPB 2HH5A 1PXVA 1YT7A 1ZCMA 1KXRA 4KLBA 2G8EA 4K7CA 5JH3A 3F75A 1NB3A 3NHEA 4W5BA 4YYQA 3H8CA 4BS6A 2BSZA 1K3BB 4CDFB 4N8WA 3P5VA 1W5RA 3HD3A 1CPJA 2R6NA 1TLOA 1PCIA 3USVA 1KHPA 5CVMA 3P5UA 3OVZA 2PNSA 4XR7A 3N4CA 1EWLA 2AUZA 3H6SA 2F1GA 1PPDA 4QRXA 1Y4HA 4RY2A 5EF4A 1GMYA 2NQAA 3BWKA 1MS6A 2R9NA 1EWOA 2G8JA 2Y5BA 2YJ2A 3P5WA 3MHHA 2Y6EA 3KWBX 1QOLA 3KKUA 1YK8A 2CB5A 2F7DA 1MIRA 2HXZA 5CVOB 1ATKA 3U8EA 4QH6A 4OELA 1YK7A 3V6CA 3KW9A 1MEMA 3BC3A 3DF0A 3N3KA 3IV2A 1KFUL 4Q8GA 3WXEA 3IUTA 2NQIA 1EF7A 3HHIA 4GUZA 4CDEB 1NPZA 4FIPA 1TU6A 2FT2A 1CB5A 1BY8A 4MZSA 4CZWA 1GECE 3QJ3A 3BOWA 1AU2A 3O0UA 2FO5A 3LFYA 1U9QX 3OISA 1A6RA 3S3RA 4BPVA 3AI8A 3LTWA 4Q8HA 3H7DA 3RVXA 9PAPA 3D6SA 4BSQA 4QBBA 1NLJA 1YVBA 4PP2E 4P6EA 2FRAA 4AXMA 3WXGA 3HHAA 1QXPA 4C5PA 2DJGB 4QRGA 2HHNA 1STFE 4YYUA 3B79A 3K9MA 1W4TA 2PREA 1NL6A 2H7JA 2DC7A 4YV8A 4B55A 2DCDA 4DMXA 8PCHA 1SNKA 3H89A 3C9EA 4PI3A 4MSXA 3H8BA 2FYEA 3K8UA 2JQGR 1F29A 2YJ8A 1PBHA 1AYUA 5FPWA 2R9OA 2DZZA 1AYVA 1MDWA 2B1NA 2VFCA 3CBJA 2ATOA 1AU4A 1U5IA 4CDDB 1QMYA 2P7UA 2B1MA 3IMAA 4N4ZA 1THEA 3ZUAA 4QRVA 1PADA 3WXFA 2BDLA 4N79A 1CJLA 3IOQA 2P0RA 3OF9A 6PADA 1F2CA 2DC6A 2AYOA 5CHTA 3ERVA 2G6DA 3CBKA 1JQPA 4X6HA 2OULA 1PPNA 4NV7A 2VHSA 1BP4A 3N3GA 1AECA 1U9VA 3M99A 2GFOA 3F5VA 4WA6A 4I05A 1MHWA 2FTDA 3OVXA 2AS8A 4YVAA 1NB5A 4I07A 4BQVA 1VJVA 4OEMA 1HUCB 3MORA 2R9CA 4ZUXU 1XKGA 2VFBA 1CS8A 1F2AA 2XU1A 2G7YA 3MTNA 3E1ZB 4X6IA 2DCCA 3RVVA 1GX3A 1TL9A 3BPMA 3PNRA 3QT4A 2VHFA 2DCAA 2R9FA 5F02A 1VSNA 4CDCB 1EWPA 3I06A 1NQCA 1DF0A 4I04A 2HD5A 4MZOA 5CHVA 2C0YA 5JA7A 4FJCA 4YYRA 1W6FA 2ARYA 5K16A 4PP1A 2IBIA 2CIOA 4DMYA 1ICFA 1AYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PW3 A;  3V6E A;  1CVZ A;  2O6X A;  1PIP A;  7PCK A;  4AXL A;  3RVW A;  3P5X A;  3LXS A;  2E01 A;  5A24 A;  3GCB A;  3PBH A;  3QSD A;  1O0E A;  2XU3 A;  1X9Y A;  5PAD A;  4XUI A;  2E02 A;  2OP3 A;  3PDF A;  4PAD A;  2AVW A;  5EGW A;  4P6G A;  1KHQ A;  4X6J A;  1ITO A;  1EWM A;  1ZIV A;  2DZY A;  1YAL A;  1POP A;  2PBH A;  2FUD A;  2FQ9 A;  4BS5 A;  3TNX A;  2DJF B;  1AIM A;  1U9W A;  1FH0 A;  1M6D A;  2AUX A;  1AU0 A;  2AYN A;  2PAD A;  2OZ2 A;  1Y08 A;  3O1G A;  4G54 A;  1GCB A;  5J94 A;  2ACT A;  1GLO A;  2YJB A;  1KFX L;  2XU5 A;  1BQI A;  1Q6K A;  1DEU A;  1QDQ A;  2E00 A;  1S4V A;  3I3T A;  1F2B A;  3K24 A;  2DC9 A;  1MEG A;  3BCN A;  3IEJ A;  2WBF X;  2AU1 A;  1BGO A;  4W5C A;  4W4U A;  2GHU A;  3BPF A;  1PPO A;  3KWZ A;  1PE6 A;  3CH3 X;  2FRQ A;  3KX1 A;  1ME3 A;  1SP4 B;  1ME4 A;  2E03 A;  2BDZ A;  4HWY A;  1U9X A;  2YJC A;  1PPP A;  2JQF R;  2NQG A;  2R9M A;  5CVN B;  1CTE A;  3OF8 A;  3KFQ A;  2P86 A;  2XU4 A;  4YYV A;  2DC8 A;  3MHS A;  2DCB A;  3IHP A;  1IWD A;  2AIM A;  1CSB B;  4YYW A;  4YYS A;  1AU3 A;  2YJ9 A;  3CH2 X;  3KSE A;  3HWN A;  3S3Q A;  1CQD A;  1CV8 A;  4FK5 A;  2NQD B;  2IPP B;  2HH5 A;  1PXV A;  1YT7 A;  1ZCM A;  1KXR A;  4KLB A;  2G8E A;  4K7C A;  5JH3 A;  3F75 A;  1NB3 A;  3NHE A;  4W5B A;  4YYQ A;  3H8C A;  4BS6 A;  1K3B B;  4CDF B;  4N8W A;  3P5V A;  3HD3 A;  1CPJ A;  2R6N A;  1TLO A;  1PCI A;  3USV A;  1KHP A;  5CVM A;  3P5U A;  3OVZ A;  2PNS A;  4XR7 A;  3N4C A;  1EWL A;  2AUZ A;  3H6S A;  2F1G A;  1PPD A;  4QRX A;  1Y4H A;  4RY2 A;  5EF4 A;  1GMY A;  2NQA A;  3BWK A;  1MS6 A;  2R9N A;  1EWO A;  2G8J A;  2Y5B A;  2YJ2 A;  3P5W A;  3MHH A;  2Y6E A;  3KWB X;  1QOL A;  3KKU A;  1YK8 A;  2CB5 A;  2F7D A;  1MIR A;  2HXZ A;  5CVO B;  1ATK A;  3U8E A;  4QH6 A;  4OEL A;  1YK7 A;  3V6C A;  3KW9 A;  1MEM A;  3BC3 A;  3DF0 A;  3N3K A;  3IV2 A;  1KFU L;  4Q8G A;  3WXE A;  3IUT A;  2NQI A;  1EF7 A;  3HHI A;  4CDE B;  1NPZ A;  4FIP A;  1TU6 A;  2FT2 A;  1CB5 A;  1BY8 A;  4MZS A;  4CZW A;  1GEC E;  3QJ3 A;  3BOW A;  1AU2 A;  3O0U A;  2FO5 A;  3LFY A;  1U9Q X;  3OIS A;  1A6R A;  3S3R A;  4BPV A;  3AI8 A;  4Q8H A;  3H7D A;  3RVX A;  9PAP A;  3D6S A;  4BSQ A;  4QBB A;  1NLJ A;  1YVB A;  4PP2 E;  4P6E A;  2FRA A;  4AXM A;  3WXG A;  3HHA A;  1QXP A;  2DJG B;  4QRG A;  2HHN A;  1STF E;  4YYU A;  3B79 A;  3K9M A;  2PRE A;  1NL6 A;  2H7J A;  2DC7 A;  4YV8 A;  2DCD A;  4DMX A;  8PCH A;  1SNK A;  3H89 A;  3C9E A;  4PI3 A;  4MSX A;  3H8B A;  2FYE A;  3K8U A;  2JQG R;  1F29 A;  2YJ8 A;  1PBH A;  1AYU A;  5FPW A;  2R9O A;  2DZZ A;  1AYV A;  1MDW A;  2B1N A;  3CBJ A;  2ATO A;  1AU4 A;  1U5I A;  4CDD B;  1QMY A;  2P7U A;  2B1M A;  3IMA A;  4N4Z A;  1THE A;  3ZUA A;  4QRV A;  1PAD A;  3WXF A;  2BDL A;  4N79 A;  1CJL A;  3IOQ A;  2P0R A;  3OF9 A;  6PAD A;  1F2C A;  2DC6 A;  2AYO A;  5CHT A;  3ERV A;  2G6D A;  3CBK A;  1JQP A;  4X6H A;  2OUL A;  1PPN A;  2VHS A;  1BP4 A;  3N3G A;  1AEC A;  1U9V A;  3M99 A;  2GFO A;  3F5V A;  4WA6 A;  4I05 A;  1MHW A;  2FTD A;  3OVX A;  2AS8 A;  4YVA A;  1NB5 A;  4I07 A;  4BQV A;  1VJV A;  4OEM A;  1HUC B;  3MOR A;  2R9C A;  4ZUX U;  1XKG A;  1CS8 A;  1F2A A;  2XU1 A;  2G7Y A;  3MTN A;  3E1Z B;  4X6I A;  2DCC A;  3RVV A;  1TL9 A;  3BPM A;  3PNR A;  3QT4 A;  2VHF A;  2DCA A;  2R9F A;  5F02 A;  1VSN A;  4CDC B;  1EWP A;  3I06 A;  1NQC A;  1DF0 A;  4I04 A;  2HD5 A;  4MZO A;  5CHV A;  2C0Y A;  5JA7 A;  4FJC A;  4YYR A;  2ARY A;  5K16 A;  4PP1 A;  2IBI A;  2CIO A;  4DMY A;  1ICF A;  1AYW A; 
#chains in the Genus database with same CATH topology
 3PW3 A;  3V6E A;  2J7Q A;  1CVZ A;  2O6X A;  1PIP A;  7PCK A;  4AXL A;  3RVW A;  3P5X A;  3LXS A;  2E01 A;  5A24 A;  3GCB A;  3PBH A;  3QSD A;  1O0E A;  2XU3 A;  1X9Y A;  5PAD A;  4XUI A;  2E02 A;  2OP3 A;  3PDF A;  4PAD A;  2AVW A;  5EGW A;  4P6G A;  1KHQ A;  4X6J A;  1ITO A;  1EWM A;  1ZIV A;  2DZY A;  1YAL A;  1POP A;  2PBH A;  2FUD A;  2FQ9 A;  4BS5 A;  4BOS A;  3TNX A;  2DJF B;  1AIM A;  1DKI A;  4D8B A;  1U9W A;  1FH0 A;  1M6D A;  2AUX A;  1AU0 A;  5EZS A;  2AYN A;  2PAD A;  3MTV A;  2OZ2 A;  1Y08 A;  4RF0 A;  3O1G A;  4G54 A;  1GCB A;  5J94 A;  2ACT A;  1GLO A;  2YJB A;  1KFX L;  2XU5 A;  5JZE A;  1BQI A;  5KO3 A;  1Q6K A;  1DEU A;  1QDQ A;  2E00 A;  1S4V A;  3I3T A;  1F2B A;  3K24 A;  2DC9 A;  1MEG A;  3BCN A;  3IEJ A;  2WBF X;  2AU1 A;  1BGO A;  4W5C A;  4W4U A;  4BOQ A;  2GHU A;  3BPF A;  1PPO A;  3KWZ A;  1PE6 A;  3CH3 X;  2BTW A;  2FRQ A;  2FE8 A;  3O65 A;  3RNV A;  3KX1 A;  3PHW A;  2JTC A;  1ME3 A;  1SP4 B;  1ME4 A;  2E03 A;  3C0R A;  4GUA A;  3E9S A;  3ZNH A;  2BDZ A;  4HWY A;  4MM3 B;  1U9X A;  2YJC A;  1PPP A;  2JQF R;  4A5U A;  4MI7 A;  2NQG A;  2R9M A;  5CVN B;  1CTE A;  3OF8 A;  3PHU A;  3KFQ A;  2P86 A;  2XU4 A;  2UZJ A;  4YYV A;  4OVZ A;  2DC8 A;  3MHS A;  2DCB A;  3MJ5 A;  3IHP A;  1IWD A;  2AIM A;  1CSB B;  4YYW A;  4BOU A;  4YYS A;  1AU3 A;  2YJ9 A;  3CH2 X;  3BB7 A;  3HWN A;  3KSE A;  3S3Q A;  4BOZ A;  1CQD A;  1CV8 A;  4FK5 A;  3TMP A;  2NQD B;  4BOP A;  2IPP B;  2HH5 A;  1PXV A;  4R3D A;  4IUM A;  1YT7 A;  4P16 A;  1ZCM A;  1KXR A;  4KLB A;  2G8E A;  4K7C A;  3W31 A;  5JH3 A;  3F75 A;  1NB3 A;  3NHE A;  4W5B A;  4YYQ A;  3H8C A;  4BS6 A;  1K3B B;  4PT5 A;  4CDF B;  4N8W A;  3P5V A;  4ZTB A;  3HD3 A;  1CPJ A;  2R6N A;  1TLO A;  1PCI A;  3USV A;  1KHP A;  5CVM A;  3P5U A;  3OVZ A;  2PNS A;  4XR7 A;  3N4C A;  1EWL A;  2AUZ A;  3H6S A;  3PHX A;  2F1G A;  1PPD A;  4QRX A;  1Y4H A;  1PVJ A;  4RY2 A;  5EF4 A;  1GMY A;  2NQA A;  3BWK A;  1MS6 A;  2R9N A;  1EWO A;  2J7Q C;  2G8J A;  5E6J A;  2Y5B A;  2YJ2 A;  3P5W A;  3MHH A;  2Y6E A;  3KWB X;  1QOL A;  3KKU A;  1YK8 A;  2CB5 A;  2F7D A;  1MIR A;  2AGA A;  1UKF A;  2HXZ A;  5CVO B;  3BBA A;  1ATK A;  3IFU A;  3U8E A;  2HWK A;  3PRM A;  4QH6 A;  2BTW B;  4OEL A;  1YK7 A;  3PRP A;  3KW9 A;  3V6C A;  1MEM A;  3BC3 A;  3DF0 A;  3N3K A;  4RKX A;  3IV2 A;  1KFU L;  3BY4 A;  4Q8G A;  3WXE A;  3IUT A;  2NQI A;  1EF7 A;  3HHI A;  4CDE B;  1NPZ A;  4FIP A;  1TU6 A;  2FT2 A;  4D8I A;  1CB5 A;  4RNA A;  1BY8 A;  3PT2 A;  4OVZ B;  4MZS A;  4CZW A;  1GEC E;  3QJ3 A;  3BOW A;  1AU2 A;  3O0U A;  2FO5 A;  3LFY A;  1U9Q X;  3W30 A;  3OIS A;  1A6R A;  3S3R A;  4BPV A;  3AI8 A;  4Q8H A;  3H7D A;  3RVX A;  9PAP A;  3D6S A;  4BSQ A;  4QBB A;  1NLJ A;  1YVB A;  4PP2 E;  4P6E A;  2FRA A;  4AXM A;  3WXG A;  3HHA A;  1QXP A;  2Z84 A;  2DJG B;  4QRG A;  4WUR A;  2HHN A;  1STF E;  4YYU A;  4RF1 A;  3B79 A;  3K9M A;  2PRE A;  1NL6 A;  2H7J A;  2DC7 A;  4YV8 A;  2DCD A;  4DMX A;  8PCH A;  1SNK A;  3H89 A;  3C9E A;  4PI3 A;  4MSX A;  3H8B A;  1YZB A;  2FYE A;  3K8U A;  2JQG R;  1F29 A;  2JRI A;  2YJ8 A;  1PBH A;  1AYU A;  2BU3 A;  5FPW A;  2R9O A;  2DZZ A;  4REZ A;  1AYV A;  3B21 A;  1MDW A;  2B1N A;  3CBJ A;  4IP3 A;  2ATO A;  3TRK A;  1AU4 A;  1U5I A;  4CDD B;  1QMY A;  2P7U A;  2B1M A;  3IMA A;  4N4Z A;  1THE A;  3ZUA A;  4QRV A;  1PAD A;  3WXF A;  5EZQ A;  2BDL A;  4N79 A;  1CJL A;  3IOQ A;  2P0R A;  3OF9 A;  6PAD A;  1F2C A;  2DC6 A;  2AYO A;  5CHT A;  3ERV A;  2G6D A;  3CBK A;  1JQP A;  4X6H A;  2OUL A;  1PPN A;  2VHS A;  1BP4 A;  3N3G A;  1AEC A;  1U9V A;  3M99 A;  4HXD B;  2GFO A;  3F5V A;  4WA6 A;  4I05 A;  1MHW A;  2FTD A;  3OVX A;  2AS8 A;  4YVA A;  1NB5 A;  4I07 A;  4BQV A;  1VJV A;  4D8E A;  4OEM A;  1HUC B;  3MOR A;  2R9C A;  4ZUX U;  1XKG A;  1CS8 A;  1F2A A;  2XU1 A;  2G7Y A;  3MTN A;  3E1Z B;  4X6I A;  2DCC A;  3RVV A;  1TL9 A;  3BPM A;  3PNR A;  3QT4 A;  2VHF A;  4M0W A;  2DCA A;  4XZX A;  2R9F A;  3PSE A;  5F02 A;  1VSN A;  4CDC B;  1EWP A;  3I06 A;  3OQC A;  1NQC A;  4OW0 A;  1DF0 A;  2DOS A;  4I04 A;  2HD5 A;  4MZO A;  5CHV A;  2C0Y A;  5JA7 A;  4FJC A;  4YYR A;  2ARY A;  5K16 A;  3MP2 A;  4PP1 A;  2IBI A;  2CIO A;  4DMY A;  1ICF A;  1AYW A; 
#chains in the Genus database with same CATH homology
 3PW3 A;  3V6E A;  1CVZ A;  2O6X A;  1PIP A;  7PCK A;  4AXL A;  3RVW A;  3P5X A;  3LXS A;  2E01 A;  5A24 A;  3GCB A;  3PBH A;  3QSD A;  1O0E A;  2XU3 A;  1X9Y A;  1E2T A;  5PAD A;  4XUI A;  2E02 A;  2OP3 A;  3PDF A;  4PAD A;  2AVW A;  5EGW A;  4P6G A;  1KHQ A;  4BGF A;  4X6J A;  1ITO A;  1EWM A;  1ZIV A;  2DZY A;  1YAL A;  1POP A;  2PBH A;  2FUD A;  2FQ9 A;  4BS5 A;  3TNX A;  2DJF B;  1AIM A;  1U9W A;  1FH0 A;  1M6D A;  2AUX A;  1AU0 A;  2AYN A;  2PAD A;  2OZ2 A;  1Y08 A;  3O1G A;  4G54 A;  1GCB A;  4NV8 A;  5J94 A;  2ACT A;  1GLO A;  2YJB A;  1KFX L;  2XU5 A;  1BQI A;  1Q6K A;  1DEU A;  1QDQ A;  2E00 A;  1S4V A;  3I3T A;  1F2B A;  3K24 A;  2DC9 A;  1MEG A;  3D9W A;  3BCN A;  3IEJ A;  2WBF X;  2AU1 A;  1BGO A;  4W5C A;  4W4U A;  2GHU A;  3BPF A;  1PPO A;  3KWZ A;  1PE6 A;  3CH3 X;  2FRQ A;  3KX1 A;  1ME3 A;  1SP4 B;  1ME4 A;  2E03 A;  2BDZ A;  4HWY A;  1U9X A;  2YJC A;  1PPP A;  2JQF R;  2NQG A;  2R9M A;  5CVN B;  1CTE A;  3OF8 A;  3KFQ A;  2P86 A;  2XU4 A;  4YYV A;  2DC8 A;  3MHS A;  2DCB A;  3IHP A;  1IWD A;  2AIM A;  1CSB B;  4YYW A;  4YYS A;  1AU3 A;  2YJ9 A;  3CH2 X;  3KSE A;  3HWN A;  3S3Q A;  1CQD A;  1CV8 A;  4FK5 A;  2NQD B;  2IPP B;  2HH5 A;  1PXV A;  1YT7 A;  1ZCM A;  1KXR A;  4KLB A;  2G8E A;  4K7C A;  5JH3 A;  3F75 A;  1NB3 A;  3NHE A;  4W5B A;  4YYQ A;  3H8C A;  4BS6 A;  2BSZ A;  1K3B B;  4CDF B;  4N8W A;  3P5V A;  1W5R A;  3HD3 A;  1CPJ A;  2R6N A;  1TLO A;  1PCI A;  3USV A;  1KHP A;  5CVM A;  3P5U A;  3OVZ A;  2PNS A;  4XR7 A;  3N4C A;  1EWL A;  2AUZ A;  3H6S A;  2F1G A;  1PPD A;  4QRX A;  1Y4H A;  4RY2 A;  5EF4 A;  1GMY A;  2NQA A;  3BWK A;  1MS6 A;  2R9N A;  1EWO A;  2G8J A;  2Y5B A;  2YJ2 A;  3P5W A;  3MHH A;  2Y6E A;  3KWB X;  1QOL A;  3KKU A;  1YK8 A;  2CB5 A;  2F7D A;  1MIR A;  2HXZ A;  5CVO B;  1ATK A;  3U8E A;  4QH6 A;  4OEL A;  1YK7 A;  3V6C A;  3KW9 A;  1MEM A;  3BC3 A;  3DF0 A;  3N3K A;  3IV2 A;  1KFU L;  4Q8G A;  3WXE A;  3IUT A;  2NQI A;  1EF7 A;  3HHI A;  4GUZ A;  4CDE B;  1NPZ A;  4FIP A;  1TU6 A;  2FT2 A;  1CB5 A;  1BY8 A;  4MZS A;  4CZW A;  1GEC E;  3QJ3 A;  3BOW A;  1AU2 A;  3O0U A;  2FO5 A;  3LFY A;  1U9Q X;  3OIS A;  1A6R A;  3S3R A;  4BPV A;  3AI8 A;  3LTW A;  4Q8H A;  3H7D A;  3RVX A;  9PAP A;  3D6S A;  4BSQ A;  4QBB A;  1NLJ A;  1YVB A;  4PP2 E;  4P6E A;  2FRA A;  4AXM A;  3WXG A;  3HHA A;  1QXP A;  4C5P A;  2DJG B;  4QRG A;  2HHN A;  1STF E;  4YYU A;  3B79 A;  3K9M A;  1W4T A;  2PRE A;  1NL6 A;  2H7J A;  2DC7 A;  4YV8 A;  4B55 A;  2DCD A;  4DMX A;  8PCH A;  1SNK A;  3H89 A;  3C9E A;  4PI3 A;  4MSX A;  3H8B A;  2FYE A;  3K8U A;  2JQG R;  1F29 A;  2YJ8 A;  1PBH A;  1AYU A;  5FPW A;  2R9O A;  2DZZ A;  1AYV A;  1MDW A;  2B1N A;  2VFC A;  3CBJ A;  2ATO A;  1AU4 A;  1U5I A;  4CDD B;  1QMY A;  2P7U A;  2B1M A;  3IMA A;  4N4Z A;  1THE A;  3ZUA A;  4QRV A;  1PAD A;  3WXF A;  2BDL A;  4N79 A;  1CJL A;  3IOQ A;  2P0R A;  3OF9 A;  6PAD A;  1F2C A;  2DC6 A;  2AYO A;  5CHT A;  3ERV A;  2G6D A;  3CBK A;  1JQP A;  4X6H A;  2OUL A;  1PPN A;  4NV7 A;  2VHS A;  1BP4 A;  3N3G A;  1AEC A;  1U9V A;  3M99 A;  2GFO A;  3F5V A;  4WA6 A;  4I05 A;  1MHW A;  2FTD A;  3OVX A;  2AS8 A;  4YVA A;  1NB5 A;  4I07 A;  4BQV A;  1VJV A;  4OEM A;  1HUC B;  3MOR A;  2R9C A;  4ZUX U;  1XKG A;  2VFB A;  1CS8 A;  1F2A A;  2XU1 A;  2G7Y A;  3MTN A;  3E1Z B;  4X6I A;  2DCC A;  3RVV A;  1GX3 A;  1TL9 A;  3BPM A;  3PNR A;  3QT4 A;  2VHF A;  2DCA A;  2R9F A;  5F02 A;  1VSN A;  4CDC B;  1EWP A;  3I06 A;  1NQC A;  1DF0 A;  4I04 A;  2HD5 A;  4MZO A;  5CHV A;  2C0Y A;  5JA7 A;  4FJC A;  4YYR A;  1W6F A;  2ARY A;  5K16 A;  4PP1 A;  2IBI A;  2CIO A;  4DMY A;  1ICF A;  1AYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...