2H7JA

Crystal structure of cathepsin s in complex with a nonpeptidic inhibitor.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of selective, nonpeptidic nitrile inhibitors of cathepsin s using the substrate activity screening method.
pubmed doi rcsb
molecule keywords Cathepsin S
molecule tags Hydrolase
source organism Homo sapiens
total genus 70
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2h7jA00
9PAPA 1YALA 4BS5A 1THEA 3QSDA 3KWBX 3HWNA 2E00A 3KFQA 1YT7A 1U9VA 2CIOA 3OF9A 2CB5A 4XR7A 1KHPA 4FK5A 4CDEB 2FYEA 1QOLA 1Y4HA 2Y5BA 1U5IA 2F1GA 1GLOA 3IV2A 1PE6A 1GCBA 2R9MA 2YJ9A 1EWLA 4AXLA 2ACTA 1ATKA 2Y6EA 6PADA 4BSQA 2YJ8A 2PBHA 2XU3A 3KWZA 2E03A 3CH3X 4OELA 1MS6A 1ME4A 4XUIA 3PNRA 3H89A 2G7YA 4OEMA 2G8EA 3PBHA 1AYUA 3B79A 3IMAA 1Y08A 3N3GA 2FT2A 3BC3A 4QBBA 3S3QA 1F29A 2AUXA 4DMXA 1KFXL 3LFYA 1YK8A 2XU1A 1F2CA 1MIRA 2R6NA 2DC9A 1GMYA 2AU1A 4CDCB 4AXMA 1AYWA 3OVZA 2E02A 4QRXA 3ERVA 1CQDA 2XU4A 4K7CA 1CJLA 1AECA 4CDDB 1TU6A 3H7DA 5JH3A 1ZIVA 3KKUA 3IOQA 4I07A 2HXZA 4KLBA 8PCHA 2DC7A 1AU2A 1SP4B 3O0UA 2DCCA 3PDFA 1S4VA 3U8EA 4CDFB 3P5WA 2H7JA 1MHWA 4BS6A 2PADA 2GHUA 3RVVA 3M99A 1U9XA 3RVWA 5FPWA 4Q8HA 3E1ZB 2AUZA 1POPA 4Q8GA 3HHIA 2FUDA 1QXPA 2XU5A 3TNXA 3K24A 2DJFB 2HD5A 3IUTA 1YK7A 1CSBB 4PP2E 2YJBA 3CBKA 2GFOA 4PI3A 3WXEA 1PIPA 4MZSA 2G6DA 1DF0A 4PADA 3NHEA 2DC6A 3I3TA 4YYVA 1NPZA 1BY8A 1AU3A 3K9MA 5PADA 3H8BA 1SNKA 3RVXA 2FTDA 1KFUL 5CVMA 4QRGA 1QDQA 1GECE 3K8UA 1X9YA 1ICFA 2YJCA 3PW3A 3USVA 1PPOA 3QT4A 1VSNA 2AYOA 2JQFR 1NLJA 1AU0A 2WBFX 2FRAA 2AVWA 4YYWA 3CH2X 1ITOA 1MDWA 2OULA 2FO5A 1F2AA 2IPPB 1NL6A 3QJ3A 5CVOB 4YYRA 3N4CA 4YVAA 5CHTA 4N79A 5J94A 1BP4A 1NB3A 1PPPA 2O6XA 4MSXA 5EF4A 2DCBA 2R9NA 1K3BB 2DCDA 1JQPA 1A6RA 3BCNA 3LXSA 3OISA 2IBIA 1BGOA 3C9EA 3P5VA 3CBJA 4CZWA 5JA7A 3BOWA 3H8CA 2NQAA 3O1GA 3DF0A 1MEMA 1EF7A 1CTEA 3AI8A 4I05A 2PREA 5K16A 3N3KA 4QH6A 1AU4A 4YYQA 1FH0A 2AS8A 3GCBA 1PPDA 1PBHA 1ZCMA 1PXVA 3WXGA 3BPMA 1AIMA 2OZ2A 3V6EA 3KSEA 3MHHA 2PNSA 1BQIA 2E01A 4BQVA 2VHSA 1U9WA 2G8JA 1XKGA 1HUCB 3KW9A 1STFE 2FRQA 2BDZA 4FJCA 2JQGR 2R9FA 1EWMA 2C0YA 2ARYA 4HWYA 7PCKA 3P5UA 2AIMA 4FIPA 5CVNB 1EWPA 3D6SA 1IWDA 1NQCA 3I06A 1CV8A 1U9QX 3HHAA 1YVBA 1Q6KA 4W5CA 2ATOA 4X6IA 1TLOA 3BWKA 4P6GA 2B1NA 4W5BA 1VJVA 4N4ZA 1CVZA 1ME3A 1KXRA 2F7DA 4I04A 4BPVA 3F75A 1QMYA 3BPFA 2HHNA 3ZUAA 1TL9A 3V6CA 4YYUA 1DEUA 2DZZA 2AYNA 2P0RA 3KX1A 4W4UA 1PCIA 2NQDB 2DZYA 1PADA 2DC8A 3MORA 3WXFA 4DMYA 3MTNA 2NQGA 4PP1A 4ZUXU 3HD3A 1O0EA 4X6JA 1AYVA 2R9CA 1PPNA 4QRVA 1CS8A 1EWOA 1CB5A 4YYSA 3OVXA 1CPJA 2OP3A 2HH5A 3S3RA 2NQIA 3MHSA 5EGWA 1KHQA 2P7UA 4X6HA 3IHPA 2P86A 2DJGB 3IEJA 4YV8A 3F5VA 4G54A 2DCAA 2YJ2A 4WA6A 5A24A 1M6DA 4P6EA 2FQ9A 1NB5A 2B1MA 5CHVA 3H6SA 4RY2A 3P5XA 4MZOA 2BDLA 2VHFA 4N8WA 1F2BA 5F02A 3OF8A 1MEGA 2R9OA
chains in the Genus database with same CATH superfamily
9PAPA 1YALA 4BS5A 1THEA 3QSDA 3KWBX 4RKXA 3HWNA 3IFUA 2E00A 3KFQA 1YT7A 1U9VA 2CIOA 3OF9A 2CB5A 4XR7A 1KHPA 4FK5A 2BTWA 2AGAA 4CDEB 2FYEA 1QOLA 1Y4HA 2Y5BA 1U5IA 2F1GA 3MTVA 1GLOA 3IV2A 1PE6A 1GCBA 2J7QA 2R9MA 2YJ9A 1EWLA 4AXLA 4RNAA 2ACTA 1ATKA 2Y6EA 6PADA 4BSQA 2YJ8A 1UKFA 2PBHA 2XU3A 2BU3A 3KWZA 2E03A 3CH3X 4OELA 3W30A 1MS6A 1ME4A 4XUIA 3PNRA 3H89A 2G7YA 3PHWA 2G8EA 3PBHA 4IP3A 4OEMA 1AYUA 3B79A 3PHUA 3IMAA 1Y08A 3N3GA 2FT2A 3BC3A 4BOUA 4QBBA 4OVZA 3S3QA 1F29A 3RNVA 2AUXA 4DMXA 1KFXL 3LFYA 1YK8A 4P16A 2XU1A 1F2CA 1MIRA 2R6NA 4PT5A 2DC9A 1GMYA 3PHXA 2AU1A 4CDCB 4AXMA 2UZJA 1AYWA 4BOPA 3OVZA 5KO3A 2E02A 4QRXA 3ERVA 1CQDA 2XU4A 4K7CA 1CJLA 1AECA 4CDDB 1TU6A 3H7DA 5JH3A 4RF0A 1ZIVA 3KKUA 3IOQA 4M0WA 4I07A 2HXZA 3BBAA 5E6JA 4KLBA 8PCHA 2DC7A 4D8BA 1AU2A 3W31A 1SP4B 2Z84A 3O0UA 2DCCA 2FE8A 3PDFA 1S4VA 3U8EA 4CDFB 3P5WA 2H7JA 4OVZB 4REZA 1MHWA 2JRIA 4BS6A 2PADA 2GHUA 4XZXA 3RVVA 3M99A 3MP2A 1U9XA 3RVWA 5FPWA 4Q8HA 3E1ZB 2AUZA 1POPA 4Q8GA 3HHIA 2FUDA 1QXPA 2XU5A 4RF1A 3TNXA 3K24A 3B21A 2DJFB 2HD5A 3IUTA 1YK7A 1CSBB 4PP2E 2YJBA 3CBKA 2GFOA 4PI3A 3WXEA 1PIPA 4MZSA 2G6DA 1DF0A 4PADA 3NHEA 2DC6A 3I3TA 4YYVA 1NPZA 1BY8A 2J7QC 1AU3A 5JZEA 3K9MA 5PADA 3H8BA 1SNKA 3RVXA 2FTDA 1YZBA 1KFUL 1DKIA 5CVMA 4QRGA 1QDQA 1GECE 3ZNHA 3K8UA 1X9YA 1ICFA 2YJCA 3PW3A 4BOQA 3USVA 3E9SA 1PPOA 1VSNA 3QT4A 2AYOA 2JQFR 1NLJA 4R3DA 1AU0A 2WBFX 2FRAA 2AVWA 3OQCA 4YYWA 4MM3B 4D8IA 3CH2X 1ITOA 1MDWA 2OULA 2FO5A 1F2AA 2IPPB 2JTCA 4BOSA 1NL6A 2HWKA 3QJ3A 5CVOB 4YYRA 3N4CA 4YVAA 5CHTA 4N79A 5J94A 1BP4A 1NB3A 1PPPA 2O6XA 4MSXA 4A5UA 5EF4A 2DCBA 2R9NA 1K3BB 2DCDA 1JQPA 1A6RA 3BCNA 3LXSA 3OISA 2IBIA 1BGOA 3C9EA 3P5VA 3CBJA 4CZWA 5JA7A 3BOWA 3H8CA 3O1GA 3MJ5A 2NQAA 3DF0A 1MEMA 1EF7A 1CTEA 3AI8A 4I05A 3C0RA 2PREA 5K16A 3N3KA 4QH6A 1AU4A 3O65A 4YYQA 1FH0A 2AS8A 3GCBA 1PPDA 1PBHA 1ZCMA 1PXVA 3WXGA 3BPMA 3PSEA 4WURA 1AIMA 2OZ2A 3V6EA 3KSEA 3MHHA 2PNSA 1BQIA 2E01A 4MI7A 4BQVA 2VHSA 1U9WA 2G8JA 1XKGA 1HUCB 3KW9A 1STFE 2FRQA 2BDZA 4FJCA 2JQGR 2R9FA 1EWMA 2C0YA 2ARYA 4HWYA 7PCKA 3P5UA 2AIMA 4FIPA 5CVNB 1EWPA 3D6SA 1IWDA 1NQCA 3I06A 1CV8A 1U9QX 3HHAA 1YVBA 4GUAA 1Q6KA 4W5CA 2ATOA 4X6IA 1TLOA 3BWKA 4P6GA 2B1NA 4W5BA 1VJVA 4N4ZA 5EZSA 1CVZA 1ME3A 1KXRA 5EZQA 2F7DA 4I04A 3TRKA 4BPVA 3F75A 3PRPA 1QMYA 3BPFA 2HHNA 3ZUAA 1TL9A 3V6CA 4YYUA 1DEUA 2DZZA 2DOSA 2AYNA 1PVJA 2P0RA 3KX1A 4W4UA 1PCIA 2NQDB 2DZYA 1PADA 2DC8A 3MORA 3PT2A 4BOZA 3WXFA 4DMYA 3MTNA 2NQGA 4PP1A 2BTWB 4ZUXU 4HXDB 3HD3A 1O0EA 4X6JA 1AYVA 3BB7A 2R9CA 1PPNA 4QRVA 1CS8A 3BY4A 1EWOA 3TMPA 1CB5A 4OW0A 4YYSA 4D8EA 3OVXA 1CPJA 2OP3A 3PRMA 2HH5A 3S3RA 2NQIA 3MHSA 5EGWA 1KHQA 2P7UA 4X6HA 3IHPA 2P86A 2DJGB 3IEJA 4YV8A 3F5VA 4G54A 2DCAA 4ZTBA 2YJ2A 4WA6A 5A24A 1M6DA 4P6EA 2FQ9A 1NB5A 2B1MA 5CHVA 3H6SA 4RY2A 3P5XA 4MZOA 4IUMA 2BDLA 2VHFA 4N8WA 1F2BA 5F02A 3OF8A 1MEGA 2R9OA
chains in the Genus database with same CATH topology
9PAPA 1YALA 4BS5A 1THEA 3QSDA 3KWBX 3HWNA 2E00A 3KFQA 1YT7A 1U9VA 2CIOA 3OF9A 2CB5A 4XR7A 1KHPA 4FK5A 4CDEB 2FYEA 1QOLA 1Y4HA 2Y5BA 1U5IA 2F1GA 1GLOA 3IV2A 1PE6A 1GCBA 2R9MA 2YJ9A 1EWLA 4AXLA 2ACTA 1ATKA 2Y6EA 6PADA 4BSQA 2YJ8A 2PBHA 2XU3A 3KWZA 2E03A 3CH3X 4OELA 1MS6A 1ME4A 4XUIA 3PNRA 3H89A 2G7YA 4OEMA 2G8EA 3PBHA 1AYUA 3B79A 3IMAA 1W6FA 1Y08A 3N3GA 2FT2A 3BC3A 4QBBA 3S3QA 1F29A 2AUXA 4DMXA 3D9WA 1KFXL 3LFYA 1YK8A 2XU1A 1F2CA 1MIRA 2R6NA 2DC9A 1GMYA 2AU1A 4CDCB 4AXMA 1AYWA 3OVZA 2E02A 4QRXA 3ERVA 1CQDA 2XU4A 4K7CA 1CJLA 1AECA 4CDDB 1TU6A 3H7DA 5JH3A 1ZIVA 3KKUA 3IOQA 4I07A 2HXZA 4BGFA 4KLBA 8PCHA 2DC7A 1AU2A 1SP4B 3O0UA 2DCCA 3PDFA 1S4VA 3U8EA 3LTWA 4CDFB 3P5WA 2H7JA 1MHWA 4BS6A 2PADA 2GHUA 3RVVA 3M99A 1U9XA 3RVWA 5FPWA 4Q8HA 3E1ZB 2AUZA 1POPA 4Q8GA 3HHIA 2FUDA 1QXPA 2XU5A 3TNXA 3K24A 2VFCA 2DJFB 2HD5A 3IUTA 1YK7A 1CSBB 4PP2E 4NV7A 2YJBA 3CBKA 2GFOA 4PI3A 3WXEA 1PIPA 4MZSA 2G6DA 1DF0A 4PADA 3NHEA 2DC6A 3I3TA 4YYVA 1NPZA 1BY8A 1AU3A 3K9MA 5PADA 3H8BA 1SNKA 3RVXA 2FTDA 1KFUL 5CVMA 4QRGA 1QDQA 1GECE 3K8UA 1X9YA 1ICFA 2YJCA 3PW3A 3USVA 1PPOA 3QT4A 1VSNA 2AYOA 2JQFR 1NLJA 1AU0A 2WBFX 2FRAA 2AVWA 4YYWA 3CH2X 1ITOA 1MDWA 2OULA 2FO5A 1F2AA 2IPPB 1NL6A 3QJ3A 5CVOB 4YYRA 3N4CA 4YVAA 5CHTA 4N79A 5J94A 1BP4A 1NB3A 1PPPA 2O6XA 4MSXA 5EF4A 2DCBA 2R9NA 1K3BB 2DCDA 1JQPA 1W4TA 1A6RA 3BCNA 3LXSA 3OISA 2IBIA 1BGOA 3C9EA 3P5VA 3CBJA 4CZWA 5JA7A 3BOWA 3H8CA 2NQAA 3O1GA 3DF0A 1MEMA 1EF7A 1CTEA 1GX3A 1E2TA 3AI8A 4I05A 2PREA 5K16A 2VFBA 3N3KA 4QH6A 1AU4A 4YYQA 1FH0A 2AS8A 3GCBA 1PPDA 1PBHA 1ZCMA 1PXVA 3WXGA 3BPMA 1AIMA 2OZ2A 3V6EA 3KSEA 3MHHA 2PNSA 1BQIA 2E01A 4BQVA 2VHSA 1U9WA 2G8JA 1XKGA 1W5RA 4C5PA 1HUCB 3KW9A 1STFE 2FRQA 2BDZA 4FJCA 2JQGR 2R9FA 1EWMA 2C0YA 2ARYA 4HWYA 7PCKA 3P5UA 2AIMA 4FIPA 5CVNB 1EWPA 3D6SA 1IWDA 1NQCA 3I06A 1CV8A 1U9QX 3HHAA 1YVBA 1Q6KA 4W5CA 2ATOA 4X6IA 1TLOA 3BWKA 4P6GA 2B1NA 4W5BA 1VJVA 4N4ZA 1CVZA 1ME3A 1KXRA 2F7DA 4I04A 4BPVA 3F75A 1QMYA 3BPFA 2HHNA 3ZUAA 1TL9A 3V6CA 4YYUA 1DEUA 2DZZA 4B55A 2AYNA 2P0RA 3KX1A 4W4UA 1PCIA 2NQDB 2DZYA 1PADA 2DC8A 3MORA 3WXFA 4DMYA 3MTNA 2NQGA 4PP1A 4ZUXU 3HD3A 1O0EA 4X6JA 1AYVA 2R9CA 1PPNA 4QRVA 1CS8A 1EWOA 1CB5A 4YYSA 3OVXA 1CPJA 2OP3A 2HH5A 3S3RA 2NQIA 3MHSA 5EGWA 1KHQA 2P7UA 4X6HA 3IHPA 2P86A 2DJGB 2BSZA 3IEJA 4YV8A 3F5VA 4G54A 2DCAA 2YJ2A 4WA6A 5A24A 1M6DA 4P6EA 2FQ9A 1NB5A 2B1MA 5CHVA 3H6SA 4RY2A 3P5XA 4MZOA 2BDLA 4NV8A 2VHFA 4N8WA 1F2BA 5F02A 4GUZA 3OF8A 1MEGA 2R9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9PAP A;  1YAL A;  4BS5 A;  1THE A;  3QSD A;  3KWB X;  3HWN A;  2E00 A;  3KFQ A;  1YT7 A;  1U9V A;  2CIO A;  3OF9 A;  2CB5 A;  4XR7 A;  1KHP A;  4FK5 A;  4CDE B;  2FYE A;  1QOL A;  1Y4H A;  2Y5B A;  1U5I A;  2F1G A;  1GLO A;  3IV2 A;  1PE6 A;  1GCB A;  2R9M A;  2YJ9 A;  1EWL A;  4AXL A;  2ACT A;  1ATK A;  2Y6E A;  6PAD A;  4BSQ A;  2YJ8 A;  2PBH A;  2XU3 A;  3KWZ A;  2E03 A;  3CH3 X;  4OEL A;  1MS6 A;  1ME4 A;  4XUI A;  3PNR A;  3H89 A;  2G7Y A;  4OEM A;  2G8E A;  3PBH A;  1AYU A;  3B79 A;  3IMA A;  1Y08 A;  3N3G A;  2FT2 A;  3BC3 A;  4QBB A;  3S3Q A;  1F29 A;  2AUX A;  4DMX A;  1KFX L;  3LFY A;  1YK8 A;  2XU1 A;  1F2C A;  1MIR A;  2R6N A;  2DC9 A;  1GMY A;  2AU1 A;  4CDC B;  4AXM A;  1AYW A;  3OVZ A;  2E02 A;  4QRX A;  3ERV A;  1CQD A;  2XU4 A;  4K7C A;  1CJL A;  1AEC A;  4CDD B;  1TU6 A;  3H7D A;  5JH3 A;  1ZIV A;  3KKU A;  3IOQ A;  4I07 A;  2HXZ A;  4KLB A;  8PCH A;  2DC7 A;  1AU2 A;  1SP4 B;  3O0U A;  2DCC A;  3PDF A;  1S4V A;  3U8E A;  4CDF B;  3P5W A;  2H7J A;  1MHW A;  4BS6 A;  2PAD A;  2GHU A;  3RVV A;  3M99 A;  1U9X A;  3RVW A;  5FPW A;  4Q8H A;  3E1Z B;  2AUZ A;  1POP A;  4Q8G A;  3HHI A;  2FUD A;  1QXP A;  2XU5 A;  3TNX A;  3K24 A;  2DJF B;  2HD5 A;  3IUT A;  1YK7 A;  1CSB B;  4PP2 E;  2YJB A;  3CBK A;  2GFO A;  4PI3 A;  3WXE A;  1PIP A;  4MZS A;  2G6D A;  1DF0 A;  4PAD A;  3NHE A;  2DC6 A;  3I3T A;  4YYV A;  1NPZ A;  1BY8 A;  1AU3 A;  3K9M A;  5PAD A;  3H8B A;  1SNK A;  3RVX A;  2FTD A;  1KFU L;  5CVM A;  4QRG A;  1QDQ A;  1GEC E;  3K8U A;  1X9Y A;  1ICF A;  2YJC A;  3PW3 A;  3USV A;  1PPO A;  3QT4 A;  1VSN A;  2AYO A;  2JQF R;  1NLJ A;  1AU0 A;  2WBF X;  2FRA A;  2AVW A;  4YYW A;  3CH2 X;  1ITO A;  1MDW A;  2OUL A;  2FO5 A;  1F2A A;  2IPP B;  1NL6 A;  3QJ3 A;  5CVO B;  4YYR A;  3N4C A;  4YVA A;  5CHT A;  4N79 A;  5J94 A;  1BP4 A;  1NB3 A;  1PPP A;  2O6X A;  4MSX A;  5EF4 A;  2DCB A;  2R9N A;  1K3B B;  2DCD A;  1JQP A;  1A6R A;  3BCN A;  3LXS A;  3OIS A;  2IBI A;  1BGO A;  3C9E A;  3P5V A;  3CBJ A;  4CZW A;  5JA7 A;  3BOW A;  3H8C A;  2NQA A;  3O1G A;  3DF0 A;  1MEM A;  1EF7 A;  1CTE A;  3AI8 A;  4I05 A;  2PRE A;  5K16 A;  3N3K A;  4QH6 A;  1AU4 A;  4YYQ A;  1FH0 A;  2AS8 A;  3GCB A;  1PPD A;  1PBH A;  1ZCM A;  1PXV A;  3WXG A;  3BPM A;  1AIM A;  2OZ2 A;  3V6E A;  3KSE A;  3MHH A;  2PNS A;  1BQI A;  2E01 A;  4BQV A;  2VHS A;  1U9W A;  2G8J A;  1XKG A;  1HUC B;  3KW9 A;  1STF E;  2FRQ A;  2BDZ A;  4FJC A;  2JQG R;  2R9F A;  1EWM A;  2C0Y A;  2ARY A;  4HWY A;  7PCK A;  3P5U A;  2AIM A;  4FIP A;  5CVN B;  1EWP A;  3D6S A;  1IWD A;  1NQC A;  3I06 A;  1CV8 A;  1U9Q X;  3HHA A;  1YVB A;  1Q6K A;  4W5C A;  2ATO A;  4X6I A;  1TLO A;  3BWK A;  4P6G A;  2B1N A;  4W5B A;  1VJV A;  4N4Z A;  1CVZ A;  1ME3 A;  1KXR A;  2F7D A;  4I04 A;  4BPV A;  3F75 A;  1QMY A;  3BPF A;  2HHN A;  3ZUA A;  1TL9 A;  3V6C A;  4YYU A;  1DEU A;  2DZZ A;  2AYN A;  2P0R A;  3KX1 A;  4W4U A;  1PCI A;  2NQD B;  2DZY A;  1PAD A;  2DC8 A;  3MOR A;  3WXF A;  4DMY A;  3MTN A;  2NQG A;  4PP1 A;  4ZUX U;  3HD3 A;  1O0E A;  4X6J A;  1AYV A;  2R9C A;  1PPN A;  4QRV A;  1CS8 A;  1EWO A;  1CB5 A;  4YYS A;  3OVX A;  1CPJ A;  2OP3 A;  2HH5 A;  3S3R A;  2NQI A;  3MHS A;  5EGW A;  1KHQ A;  2P7U A;  4X6H A;  3IHP A;  2P86 A;  2DJG B;  3IEJ A;  4YV8 A;  3F5V A;  4G54 A;  2DCA A;  2YJ2 A;  4WA6 A;  5A24 A;  1M6D A;  4P6E A;  2FQ9 A;  1NB5 A;  2B1M A;  5CHV A;  3H6S A;  4RY2 A;  3P5X A;  4MZO A;  2BDL A;  2VHF A;  4N8W A;  1F2B A;  5F02 A;  3OF8 A;  1MEG A;  2R9O A; 
#chains in the Genus database with same CATH topology
 9PAP A;  1YAL A;  4BS5 A;  1THE A;  3QSD A;  3KWB X;  4RKX A;  3HWN A;  3IFU A;  2E00 A;  3KFQ A;  1YT7 A;  1U9V A;  2CIO A;  3OF9 A;  2CB5 A;  4XR7 A;  1KHP A;  4FK5 A;  2BTW A;  2AGA A;  4CDE B;  2FYE A;  1QOL A;  1Y4H A;  2Y5B A;  1U5I A;  2F1G A;  3MTV A;  1GLO A;  3IV2 A;  1PE6 A;  1GCB A;  2J7Q A;  2R9M A;  2YJ9 A;  1EWL A;  4AXL A;  4RNA A;  2ACT A;  1ATK A;  2Y6E A;  6PAD A;  4BSQ A;  2YJ8 A;  1UKF A;  2PBH A;  2XU3 A;  2BU3 A;  3KWZ A;  2E03 A;  3CH3 X;  4OEL A;  3W30 A;  1MS6 A;  1ME4 A;  4XUI A;  3PNR A;  3H89 A;  2G7Y A;  3PHW A;  2G8E A;  3PBH A;  4IP3 A;  4OEM A;  1AYU A;  3B79 A;  3PHU A;  3IMA A;  1Y08 A;  3N3G A;  2FT2 A;  3BC3 A;  4BOU A;  4QBB A;  4OVZ A;  3S3Q A;  1F29 A;  3RNV A;  2AUX A;  4DMX A;  1KFX L;  3LFY A;  1YK8 A;  4P16 A;  2XU1 A;  1F2C A;  1MIR A;  2R6N A;  4PT5 A;  2DC9 A;  1GMY A;  3PHX A;  2AU1 A;  4CDC B;  4AXM A;  2UZJ A;  1AYW A;  4BOP A;  3OVZ A;  5KO3 A;  2E02 A;  4QRX A;  3ERV A;  1CQD A;  2XU4 A;  4K7C A;  1CJL A;  1AEC A;  4CDD B;  1TU6 A;  3H7D A;  5JH3 A;  4RF0 A;  1ZIV A;  3KKU A;  3IOQ A;  4M0W A;  4I07 A;  2HXZ A;  3BBA A;  5E6J A;  4KLB A;  8PCH A;  2DC7 A;  4D8B A;  1AU2 A;  3W31 A;  1SP4 B;  2Z84 A;  3O0U A;  2DCC A;  2FE8 A;  3PDF A;  1S4V A;  3U8E A;  4CDF B;  3P5W A;  2H7J A;  4OVZ B;  4REZ A;  1MHW A;  2JRI A;  4BS6 A;  2PAD A;  2GHU A;  4XZX A;  3RVV A;  3M99 A;  3MP2 A;  1U9X A;  3RVW A;  5FPW A;  4Q8H A;  3E1Z B;  2AUZ A;  1POP A;  4Q8G A;  3HHI A;  2FUD A;  1QXP A;  2XU5 A;  4RF1 A;  3TNX A;  3K24 A;  3B21 A;  2DJF B;  2HD5 A;  3IUT A;  1YK7 A;  1CSB B;  4PP2 E;  2YJB A;  3CBK A;  2GFO A;  4PI3 A;  3WXE A;  1PIP A;  4MZS A;  2G6D A;  1DF0 A;  4PAD A;  3NHE A;  2DC6 A;  3I3T A;  4YYV A;  1NPZ A;  1BY8 A;  2J7Q C;  1AU3 A;  5JZE A;  3K9M A;  5PAD A;  3H8B A;  1SNK A;  3RVX A;  2FTD A;  1YZB A;  1KFU L;  1DKI A;  5CVM A;  4QRG A;  1QDQ A;  1GEC E;  3ZNH A;  3K8U A;  1X9Y A;  1ICF A;  2YJC A;  3PW3 A;  4BOQ A;  3USV A;  3E9S A;  1PPO A;  1VSN A;  3QT4 A;  2AYO A;  2JQF R;  1NLJ A;  4R3D A;  1AU0 A;  2WBF X;  2FRA A;  2AVW A;  3OQC A;  4YYW A;  4MM3 B;  4D8I A;  3CH2 X;  1ITO A;  1MDW A;  2OUL A;  2FO5 A;  1F2A A;  2IPP B;  2JTC A;  4BOS A;  1NL6 A;  2HWK A;  3QJ3 A;  5CVO B;  4YYR A;  3N4C A;  4YVA A;  5CHT A;  4N79 A;  5J94 A;  1BP4 A;  1NB3 A;  1PPP A;  2O6X A;  4MSX A;  4A5U A;  5EF4 A;  2DCB A;  2R9N A;  1K3B B;  2DCD A;  1JQP A;  1A6R A;  3BCN A;  3LXS A;  3OIS A;  2IBI A;  1BGO A;  3C9E A;  3P5V A;  3CBJ A;  4CZW A;  5JA7 A;  3BOW A;  3H8C A;  3O1G A;  3MJ5 A;  2NQA A;  3DF0 A;  1MEM A;  1EF7 A;  1CTE A;  3AI8 A;  4I05 A;  3C0R A;  2PRE A;  5K16 A;  3N3K A;  4QH6 A;  1AU4 A;  3O65 A;  4YYQ A;  1FH0 A;  2AS8 A;  3GCB A;  1PPD A;  1PBH A;  1ZCM A;  1PXV A;  3WXG A;  3BPM A;  3PSE A;  4WUR A;  1AIM A;  2OZ2 A;  3V6E A;  3KSE A;  3MHH A;  2PNS A;  1BQI A;  2E01 A;  4MI7 A;  4BQV A;  2VHS A;  1U9W A;  2G8J A;  1XKG A;  1HUC B;  3KW9 A;  1STF E;  2FRQ A;  2BDZ A;  4FJC A;  2JQG R;  2R9F A;  1EWM A;  2C0Y A;  2ARY A;  4HWY A;  7PCK A;  3P5U A;  2AIM A;  4FIP A;  5CVN B;  1EWP A;  3D6S A;  1IWD A;  1NQC A;  3I06 A;  1CV8 A;  1U9Q X;  3HHA A;  1YVB A;  4GUA A;  1Q6K A;  4W5C A;  2ATO A;  4X6I A;  1TLO A;  3BWK A;  4P6G A;  2B1N A;  4W5B A;  1VJV A;  4N4Z A;  5EZS A;  1CVZ A;  1ME3 A;  1KXR A;  5EZQ A;  2F7D A;  4I04 A;  3TRK A;  4BPV A;  3F75 A;  3PRP A;  1QMY A;  3BPF A;  2HHN A;  3ZUA A;  1TL9 A;  3V6C A;  4YYU A;  1DEU A;  2DZZ A;  2DOS A;  2AYN A;  1PVJ A;  2P0R A;  3KX1 A;  4W4U A;  1PCI A;  2NQD B;  2DZY A;  1PAD A;  2DC8 A;  3MOR A;  3PT2 A;  4BOZ A;  3WXF A;  4DMY A;  3MTN A;  2NQG A;  4PP1 A;  2BTW B;  4ZUX U;  4HXD B;  3HD3 A;  1O0E A;  4X6J A;  1AYV A;  3BB7 A;  2R9C A;  1PPN A;  4QRV A;  1CS8 A;  3BY4 A;  1EWO A;  3TMP A;  1CB5 A;  4OW0 A;  4YYS A;  4D8E A;  3OVX A;  1CPJ A;  2OP3 A;  3PRM A;  2HH5 A;  3S3R A;  2NQI A;  3MHS A;  5EGW A;  1KHQ A;  2P7U A;  4X6H A;  3IHP A;  2P86 A;  2DJG B;  3IEJ A;  4YV8 A;  3F5V A;  4G54 A;  2DCA A;  4ZTB A;  2YJ2 A;  4WA6 A;  5A24 A;  1M6D A;  4P6E A;  2FQ9 A;  1NB5 A;  2B1M A;  5CHV A;  3H6S A;  4RY2 A;  3P5X A;  4MZO A;  4IUM A;  2BDL A;  2VHF A;  4N8W A;  1F2B A;  5F02 A;  3OF8 A;  1MEG A;  2R9O A; 
#chains in the Genus database with same CATH homology
 9PAP A;  1YAL A;  4BS5 A;  1THE A;  3QSD A;  3KWB X;  3HWN A;  2E00 A;  3KFQ A;  1YT7 A;  1U9V A;  2CIO A;  3OF9 A;  2CB5 A;  4XR7 A;  1KHP A;  4FK5 A;  4CDE B;  2FYE A;  1QOL A;  1Y4H A;  2Y5B A;  1U5I A;  2F1G A;  1GLO A;  3IV2 A;  1PE6 A;  1GCB A;  2R9M A;  2YJ9 A;  1EWL A;  4AXL A;  2ACT A;  1ATK A;  2Y6E A;  6PAD A;  4BSQ A;  2YJ8 A;  2PBH A;  2XU3 A;  3KWZ A;  2E03 A;  3CH3 X;  4OEL A;  1MS6 A;  1ME4 A;  4XUI A;  3PNR A;  3H89 A;  2G7Y A;  4OEM A;  2G8E A;  3PBH A;  1AYU A;  3B79 A;  3IMA A;  1W6F A;  1Y08 A;  3N3G A;  2FT2 A;  3BC3 A;  4QBB A;  3S3Q A;  1F29 A;  2AUX A;  4DMX A;  3D9W A;  1KFX L;  3LFY A;  1YK8 A;  2XU1 A;  1F2C A;  1MIR A;  2R6N A;  2DC9 A;  1GMY A;  2AU1 A;  4CDC B;  4AXM A;  1AYW A;  3OVZ A;  2E02 A;  4QRX A;  3ERV A;  1CQD A;  2XU4 A;  4K7C A;  1CJL A;  1AEC A;  4CDD B;  1TU6 A;  3H7D A;  5JH3 A;  1ZIV A;  3KKU A;  3IOQ A;  4I07 A;  2HXZ A;  4BGF A;  4KLB A;  8PCH A;  2DC7 A;  1AU2 A;  1SP4 B;  3O0U A;  2DCC A;  3PDF A;  1S4V A;  3U8E A;  3LTW A;  4CDF B;  3P5W A;  2H7J A;  1MHW A;  4BS6 A;  2PAD A;  2GHU A;  3RVV A;  3M99 A;  1U9X A;  3RVW A;  5FPW A;  4Q8H A;  3E1Z B;  2AUZ A;  1POP A;  4Q8G A;  3HHI A;  2FUD A;  1QXP A;  2XU5 A;  3TNX A;  3K24 A;  2VFC A;  2DJF B;  2HD5 A;  3IUT A;  1YK7 A;  1CSB B;  4PP2 E;  4NV7 A;  2YJB A;  3CBK A;  2GFO A;  4PI3 A;  3WXE A;  1PIP A;  4MZS A;  2G6D A;  1DF0 A;  4PAD A;  3NHE A;  2DC6 A;  3I3T A;  4YYV A;  1NPZ A;  1BY8 A;  1AU3 A;  3K9M A;  5PAD A;  3H8B A;  1SNK A;  3RVX A;  2FTD A;  1KFU L;  5CVM A;  4QRG A;  1QDQ A;  1GEC E;  3K8U A;  1X9Y A;  1ICF A;  2YJC A;  3PW3 A;  3USV A;  1PPO A;  3QT4 A;  1VSN A;  2AYO A;  2JQF R;  1NLJ A;  1AU0 A;  2WBF X;  2FRA A;  2AVW A;  4YYW A;  3CH2 X;  1ITO A;  1MDW A;  2OUL A;  2FO5 A;  1F2A A;  2IPP B;  1NL6 A;  3QJ3 A;  5CVO B;  4YYR A;  3N4C A;  4YVA A;  5CHT A;  4N79 A;  5J94 A;  1BP4 A;  1NB3 A;  1PPP A;  2O6X A;  4MSX A;  5EF4 A;  2DCB A;  2R9N A;  1K3B B;  2DCD A;  1JQP A;  1W4T A;  1A6R A;  3BCN A;  3LXS A;  3OIS A;  2IBI A;  1BGO A;  3C9E A;  3P5V A;  3CBJ A;  4CZW A;  5JA7 A;  3BOW A;  3H8C A;  2NQA A;  3O1G A;  3DF0 A;  1MEM A;  1EF7 A;  1CTE A;  1GX3 A;  1E2T A;  3AI8 A;  4I05 A;  2PRE A;  5K16 A;  2VFB A;  3N3K A;  4QH6 A;  1AU4 A;  4YYQ A;  1FH0 A;  2AS8 A;  3GCB A;  1PPD A;  1PBH A;  1ZCM A;  1PXV A;  3WXG A;  3BPM A;  1AIM A;  2OZ2 A;  3V6E A;  3KSE A;  3MHH A;  2PNS A;  1BQI A;  2E01 A;  4BQV A;  2VHS A;  1U9W A;  2G8J A;  1XKG A;  1W5R A;  4C5P A;  1HUC B;  3KW9 A;  1STF E;  2FRQ A;  2BDZ A;  4FJC A;  2JQG R;  2R9F A;  1EWM A;  2C0Y A;  2ARY A;  4HWY A;  7PCK A;  3P5U A;  2AIM A;  4FIP A;  5CVN B;  1EWP A;  3D6S A;  1IWD A;  1NQC A;  3I06 A;  1CV8 A;  1U9Q X;  3HHA A;  1YVB A;  1Q6K A;  4W5C A;  2ATO A;  4X6I A;  1TLO A;  3BWK A;  4P6G A;  2B1N A;  4W5B A;  1VJV A;  4N4Z A;  1CVZ A;  1ME3 A;  1KXR A;  2F7D A;  4I04 A;  4BPV A;  3F75 A;  1QMY A;  3BPF A;  2HHN A;  3ZUA A;  1TL9 A;  3V6C A;  4YYU A;  1DEU A;  2DZZ A;  4B55 A;  2AYN A;  2P0R A;  3KX1 A;  4W4U A;  1PCI A;  2NQD B;  2DZY A;  1PAD A;  2DC8 A;  3MOR A;  3WXF A;  4DMY A;  3MTN A;  2NQG A;  4PP1 A;  4ZUX U;  3HD3 A;  1O0E A;  4X6J A;  1AYV A;  2R9C A;  1PPN A;  4QRV A;  1CS8 A;  1EWO A;  1CB5 A;  4YYS A;  3OVX A;  1CPJ A;  2OP3 A;  2HH5 A;  3S3R A;  2NQI A;  3MHS A;  5EGW A;  1KHQ A;  2P7U A;  4X6H A;  3IHP A;  2P86 A;  2DJG B;  2BSZ A;  3IEJ A;  4YV8 A;  3F5V A;  4G54 A;  2DCA A;  2YJ2 A;  4WA6 A;  5A24 A;  1M6D A;  4P6E A;  2FQ9 A;  1NB5 A;  2B1M A;  5CHV A;  3H6S A;  4RY2 A;  3P5X A;  4MZO A;  2BDL A;  4NV8 A;  2VHF A;  4N8W A;  1F2B A;  5F02 A;  4GUZ A;  3OF8 A;  1MEG A;  2R9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...