2H7JA

Crystal structure of cathepsin s in complex with a nonpeptidic inhibitor.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
ILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of selective, nonpeptidic nitrile inhibitors of cathepsin s using the substrate activity screening method.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 70
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2h7jA00
2E00A 3HWNA 2IPPB 1PBHA 5CVMA 3OVZA 3MORA 3CBJA 2G8JA 1KHPA 4YVAA 1AU0A 3CH2X 2VHSA 4X6HA 2DCBA 2FRQA 4P6EA 1X9YA 3BC3A 4W5BA 3H8CA 2FTDA 4CZWA 3N3KA 2OULA 2G8EA 1MHWA 3F5VA 1AYVA 4KLBA 1DF0A 1ATKA 1POPA 2DJFB 1AU3A 3OVXA 2AUXA 1ITOA 3USVA 2NQGA 1AYUA 4FK5A 1QDQA 3P5WA 2XU4A 2DCAA 2NQDB 5K16A 2PBHA 2NQIA 4HWYA 3CH3X 3O1GA 1IWDA 2DC6A 2DCCA 2Y6EA 1YALA 2BDLA 3IHPA 5CHTA 5JH3A 3PBHA 2FO5A 5EF4A 2C0YA 4BPVA 1AU4A 4Q8GA 1BP4A 3BWKA 4MZSA 2HXZA 4CDDB 2O6XA 1CVZA 1PCIA 3PDFA 3RVWA 2XU5A 3RVVA 4OEMA 1TU6A 2HH5A 1EWPA 4XR7A 3KX1A 1GLOA 1CS8A 3H6SA 1ZIVA 2R9OA 3KKUA 2YJ9A 5J94A 1PXVA 1A6RA 5CHVA 4CDFB 4AXMA 4I05A 5A24A 3WXFA 1JQPA 1QOLA 3CBKA 1XKGA 3S3RA 2F7DA 3KSEA 1MIRA 1AU2A 1NL6A 4PADA 5EGWA 4QH6A 2DZYA 2ATOA 2F1GA 3N3GA 1CJLA 3PNRA 4G54A 1S4VA 2JQFR 4PP2E 4X6IA 4YYSA 1CPJA 1U9QX 1ME4A 1F2CA 4CDEB 1AIMA 1PPOA 3BOWA 5F02A 4QBBA 7PCKA 1FH0A 9PAPA 3ERVA 4FIPA 1HUCB 3M99A 2JQGR 2B1MA 3BPFA 2GHUA 2FT2A 1VSNA 3D6SA 1VJVA 2E03A 2GFOA 5CVOB 5CVNB 4QRXA 1BGOA 1GCBA 1K3BB 4AXLA 1CB5A 4YYQA 1NB3A 1NPZA 3BPMA 2OP3A 2P7UA 2R9CA 2DJGB 3QT4A 1NQCA 1EWMA 3NHEA 1CSBB 3KW9A 4YYRA 2E02A 1PIPA 3U8EA 3IUTA 1BY8A 2IBIA 5PADA 1YT7A 4RY2A 3O0UA 3LXSA 2FQ9A 3IMAA 1PE6A 1F29A 3WXGA 1CV8A 3H89A 4W4UA 4W5CA 3H7DA 2YJBA 4YYWA 1DEUA 4QRVA 1SNKA 1U5IA 3OF8A 4PI3A 2DZZA 1MEMA 1THEA 1PPNA 2YJ8A 3PW3A 1MDWA 3OF9A 1GMYA 3ZUAA 3KFQA 3IV2A 4FJCA 4MSXA 2E01A 4BQVA 4BS6A 1NB5A 1ME3A 1QXPA 2DC7A 3GCBA 4I07A 2PNSA 3E1ZB 2FYEA 1Y4HA 2G6DA 3MTNA 1CTEA 4ZUXU 1Y08A 4I04A 2AYNA 3B79A 3I06A 3QSDA 3S3QA 3V6EA 1CQDA 2ACTA 1EF7A 4YYUA 1M6DA 4N79A 2R6NA 1U9WA 2CB5A 3H8BA 3HHIA 2WBFX 3P5VA 3HHAA 3BCNA 1YK7A 2B1NA 8PCHA 3DF0A 3V6CA 4YV8A 1U9VA 2P86A 2G7YA 1GECE 3IEJA 4P6GA 3OISA 4BS5A 1F2AA 2CIOA 1TL9A 3I3TA 2AVWA 4XUIA 4WA6A 2AU1A 2XU1A 3F75A 3TNXA 4N8WA 2R9FA 4X6JA 2VHFA 1PPDA 4YYVA 3AI8A 1YK8A 2FRAA 1MEGA 1EWOA 1AECA 3HD3A 4BSQA 3MHSA 2BDZA 2NQAA 2DC9A 4OELA 1YVBA 3LFYA 1TLOA 3K24A 3P5XA 1KFUL 4DMYA 3K9MA 1KXRA 3KWBX 1F2BA 2HHNA 3MHHA 1QMYA 4PP1A 6PADA 2YJCA 1U9XA 2Y5BA 1KHQA 4CDCB 3KWZA 3C9EA 2R9NA 1BQIA 5JA7A 1Q6KA 1ZCMA 2OZ2A 1SP4B 1PADA 3P5UA 5FPWA 3RVXA 1NLJA 2XU3A 2DC8A 2AIMA 2DCDA 2FUDA 1STFE 2AS8A 1KFXL 4DMXA 2YJ2A 3QJ3A 4QRGA 2ARYA 4MZOA 4Q8HA 2PREA 1O0EA 4K7CA 1ICFA 2HD5A 4N4ZA 3IOQA 3WXEA 1MS6A 2R9MA 3N4CA 2AUZA 1EWLA 2H7JA 1PPPA 1AYWA 2P0RA 2PADA 2AYOA 3K8UA
chains in the Genus database with same CATH superfamily
2E00A 3HWNA 4BOQA 2IPPB 1PBHA 5CVMA 3OVZA 3MORA 3CBJA 2G8JA 1KHPA 5EZSA 4YVAA 1AU0A 3CH2X 2VHSA 4X6HA 3PRPA 2DCBA 2FRQA 4P6EA 1X9YA 2HWKA 3BC3A 4W5BA 3H8CA 2FTDA 1DKIA 4CZWA 3N3KA 2OULA 2G8EA 1MHWA 3F5VA 1AYVA 4KLBA 1DF0A 1ATKA 1POPA 2DJFB 4GUAA 1AU3A 3OVXA 2AUXA 1ITOA 3USVA 2NQGA 1AYUA 4FK5A 1QDQA 3P5WA 2XU4A 2DCAA 2NQDB 5K16A 2PBHA 2NQIA 4HWYA 3CH3X 3O1GA 1IWDA 2DC6A 2DCCA 2Y6EA 1YALA 3C0RA 2BDLA 3IHPA 5CHTA 5JH3A 3PBHA 2FO5A 5EF4A 2C0YA 4BPVA 1AU4A 4Q8GA 1BP4A 3BWKA 4IUMA 4MZSA 2JTCA 4BOUA 2HXZA 4CDDB 2O6XA 4PT5A 1CVZA 1PCIA 3PDFA 3RVWA 2J7QC 2XU5A 4IP3A 3RVVA 4OEMA 1TU6A 2HH5A 2AGAA 1EWPA 4XR7A 3KX1A 1GLOA 1CS8A 3H6SA 1ZIVA 2R9OA 3KKUA 2YJ9A 5J94A 1PXVA 1A6RA 5CHVA 4CDFB 4AXMA 4I05A 5A24A 3WXFA 4HXDB 4RF1A 1JQPA 1QOLA 3E9SA 3CBKA 1XKGA 4XZXA 5KO3A 4MM3B 3S3RA 2F7DA 3KSEA 1MIRA 1AU2A 5EZQA 1NL6A 4PADA 5EGWA 4QH6A 2DZYA 2ATOA 2F1GA 3MJ5A 3N3GA 1CJLA 3PNRA 4D8EA 4G54A 1S4VA 2JQFR 4PP2E 4X6IA 4YYSA 1CPJA 1U9QX 1ME4A 1F2CA 4CDEB 1AIMA 1PPOA 3BOWA 5F02A 4QBBA 7PCKA 1FH0A 9PAPA 3ERVA 4FIPA 1HUCB 4D8IA 2BU3A 3M99A 3RNVA 4D8BA 2JQGR 2B1MA 3BPFA 2GHUA 4M0WA 2FT2A 4BOZA 1VSNA 3D6SA 1VJVA 2E03A 2GFOA 5CVOB 5CVNB 4QRXA 2JRIA 1BGOA 1GCBA 1K3BB 4AXLA 1CB5A 4YYQA 1NB3A 3BPMA 1NPZA 2OP3A 2P7UA 2R9CA 3TRKA 2DJGB 3QT4A 1NQCA 1EWMA 3NHEA 1CSBB 3KW9A 4YYRA 2E02A 4P16A 1PIPA 3U8EA 3IUTA 1BY8A 2IBIA 5PADA 1YT7A 4RY2A 3O0UA 3LXSA 2FQ9A 2J7QA 1PE6A 3IMAA 1F29A 3WXGA 1CV8A 3H89A 3B21A 4W4UA 4W5CA 3H7DA 2YJBA 4OVZB 4YYWA 1DEUA 3MP2A 4QRVA 3ZNHA 1SNKA 1U5IA 3OF8A 4PI3A 2DZZA 1MEMA 3PHWA 1THEA 1PPNA 2YJ8A 4REZA 3TMPA 3PW3A 1MDWA 3OF9A 1GMYA 3ZUAA 3KFQA 3IV2A 4FJCA 4MSXA 2E01A 4BQVA 4BS6A 1NB5A 5JZEA 1ME3A 1QXPA 2DC7A 3GCBA 4I07A 2PNSA 3E1ZB 2FYEA 3W30A 1Y4HA 2G6DA 3MTNA 1CTEA 4ZUXU 1Y08A 4I04A 2AYNA 3B79A 3I06A 3QSDA 3S3QA 4A5UA 5E6JA 3V6EA 1CQDA 2ACTA 1EF7A 4YYUA 1UKFA 1M6DA 4N79A 2R6NA 2DOSA 1U9WA 2CB5A 2UZJA 3H8BA 3HHIA 2WBFX 3P5VA 3IFUA 3O65A 2FE8A 3HHAA 3BY4A 3BB7A 3BCNA 1YK7A 2B1NA 8PCHA 3DF0A 3V6CA 4YV8A 1U9VA 2P86A 4MI7A 2G7YA 1GECE 3IEJA 2Z84A 4P6GA 3PSEA 3OISA 4BS5A 1F2AA 2CIOA 4WURA 1TL9A 1PVJA 4RKXA 3I3TA 2AVWA 4XUIA 4WA6A 2AU1A 2XU1A 3F75A 3TNXA 4N8WA 4RF0A 2R9FA 4X6JA 2VHFA 3PHXA 1PPDA 3PRMA 4YYVA 3AI8A 1YK8A 2FRAA 1MEGA 1EWOA 1AECA 3HD3A 4BSQA 3MHSA 2BDZA 2NQAA 4OVZA 2DC9A 4OELA 3PT2A 1YVBA 3LFYA 4RNAA 1TLOA 3K24A 4R3DA 3P5XA 1KFUL 4DMYA 3K9MA 2BTWA 1KXRA 4BOPA 3KWBX 1F2BA 2HHNA 3MHHA 3W31A 1QMYA 4PP1A 6PADA 2YJCA 1U9XA 2Y5BA 1KHQA 3OQCA 4CDCB 3KWZA 3C9EA 2R9NA 1BQIA 2BTWB 5JA7A 1Q6KA 1ZCMA 2OZ2A 1SP4B 1PADA 3P5UA 5FPWA 3RVXA 1NLJA 2XU3A 2DC8A 2AIMA 2DCDA 4ZTBA 2FUDA 1STFE 2AS8A 1KFXL 4DMXA 2YJ2A 3QJ3A 4QRGA 2ARYA 4MZOA 4Q8HA 2PREA 4BOSA 1O0EA 4K7CA 3BBAA 1ICFA 2HD5A 4N4ZA 3IOQA 3WXEA 1MS6A 4OW0A 2R9MA 3PHUA 3N4CA 2AUZA 3MTVA 1EWLA 2H7JA 1PPPA 1AYWA 2P0RA 2PADA 1YZBA 2AYOA 3K8UA
chains in the Genus database with same CATH topology
2E00A 3HWNA 2IPPB 1PBHA 5CVMA 3OVZA 3MORA 3CBJA 2G8JA 1KHPA 4YVAA 1AU0A 3CH2X 2VHSA 4X6HA 2DCBA 2FRQA 4P6EA 1X9YA 3BC3A 4W5BA 3H8CA 2FTDA 4CZWA 3N3KA 2OULA 2G8EA 1MHWA 3F5VA 1AYVA 4KLBA 1DF0A 1ATKA 1POPA 2DJFB 1AU3A 3OVXA 2AUXA 2VFBA 1ITOA 3USVA 2NQGA 1AYUA 4FK5A 1QDQA 3P5WA 2XU4A 2DCAA 2NQDB 5K16A 2PBHA 2NQIA 4HWYA 3CH3X 3O1GA 1IWDA 2DC6A 2DCCA 2Y6EA 1YALA 2BDLA 3IHPA 5CHTA 5JH3A 3PBHA 2FO5A 5EF4A 2C0YA 4BPVA 1AU4A 4Q8GA 1BP4A 3BWKA 4MZSA 2HXZA 4CDDB 2O6XA 1CVZA 1PCIA 3PDFA 3RVWA 2XU5A 3RVVA 4OEMA 4GUZA 1TU6A 2HH5A 1W4TA 1EWPA 4XR7A 3KX1A 1GLOA 1CS8A 3H6SA 1ZIVA 2R9OA 3KKUA 2YJ9A 5J94A 1PXVA 1A6RA 5CHVA 4CDFB 4AXMA 4I05A 5A24A 3WXFA 1JQPA 1QOLA 3CBKA 1XKGA 3S3RA 2F7DA 4NV7A 3KSEA 1MIRA 1AU2A 1NL6A 4PADA 5EGWA 4QH6A 2DZYA 2ATOA 2F1GA 3N3GA 1CJLA 3PNRA 4G54A 1S4VA 2JQFR 4PP2E 4X6IA 3LTWA 4YYSA 1CPJA 1U9QX 1ME4A 1F2CA 4CDEB 1AIMA 1PPOA 3BOWA 5F02A 4QBBA 7PCKA 1FH0A 9PAPA 3ERVA 1GX3A 4FIPA 1HUCB 1W6FA 3M99A 4BGFA 2JQGR 2B1MA 3BPFA 2GHUA 2FT2A 1VSNA 3D6SA 1VJVA 2E03A 2GFOA 5CVOB 5CVNB 4QRXA 1BGOA 1GCBA 1K3BB 4AXLA 1CB5A 4B55A 4YYQA 1NB3A 3BPMA 1NPZA 2OP3A 2P7UA 2R9CA 2DJGB 3QT4A 1NQCA 1EWMA 3NHEA 1CSBB 3KW9A 4YYRA 2E02A 1PIPA 3U8EA 3IUTA 1BY8A 2IBIA 5PADA 1YT7A 4RY2A 3O0UA 3LXSA 2FQ9A 3IMAA 1PE6A 1F29A 3WXGA 1CV8A 3H89A 4W4UA 4W5CA 3H7DA 2YJBA 4YYWA 1DEUA 4QRVA 1SNKA 1U5IA 2VFCA 3OF8A 4PI3A 2DZZA 1MEMA 2BSZA 1THEA 1PPNA 2YJ8A 3PW3A 1MDWA 3OF9A 1GMYA 3ZUAA 3KFQA 3IV2A 4FJCA 4MSXA 2E01A 4BQVA 4BS6A 1NB5A 1ME3A 1QXPA 2DC7A 3GCBA 4I07A 2PNSA 3E1ZB 2FYEA 1Y4HA 2G6DA 3D9WA 3MTNA 1CTEA 4ZUXU 1Y08A 4NV8A 4I04A 2AYNA 3B79A 3I06A 3QSDA 3S3QA 3V6EA 1CQDA 2ACTA 1EF7A 4YYUA 1M6DA 4N79A 2R6NA 1U9WA 2CB5A 3H8BA 3HHIA 2WBFX 3P5VA 3HHAA 3BCNA 1YK7A 2B1NA 8PCHA 3DF0A 3V6CA 4YV8A 1U9VA 2P86A 2G7YA 1GECE 3IEJA 4P6GA 3OISA 4BS5A 1F2AA 2CIOA 1TL9A 3I3TA 2AVWA 4XUIA 4WA6A 2AU1A 2XU1A 3F75A 1E2TA 3TNXA 4N8WA 2R9FA 4X6JA 2VHFA 1PPDA 4YYVA 3AI8A 1YK8A 2FRAA 1MEGA 1EWOA 1AECA 3HD3A 4C5PA 4BSQA 3MHSA 2BDZA 2NQAA 2DC9A 4OELA 1YVBA 3LFYA 1TLOA 3K24A 3P5XA 1KFUL 4DMYA 3K9MA 1KXRA 3KWBX 1F2BA 2HHNA 3MHHA 1W5RA 1QMYA 4PP1A 6PADA 2YJCA 1U9XA 2Y5BA 1KHQA 4CDCB 3KWZA 3C9EA 2R9NA 1BQIA 5JA7A 1Q6KA 1ZCMA 2OZ2A 1SP4B 1PADA 3P5UA 5FPWA 3RVXA 1NLJA 2XU3A 2DC8A 2AIMA 2DCDA 2FUDA 1STFE 2AS8A 1KFXL 4DMXA 2YJ2A 3QJ3A 4QRGA 2ARYA 4MZOA 4Q8HA 2PREA 1O0EA 4K7CA 1ICFA 2HD5A 4N4ZA 3IOQA 3WXEA 1MS6A 2R9MA 3N4CA 2AUZA 1EWLA 2H7JA 1PPPA 1AYWA 2P0RA 2PADA 2AYOA 3K8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E00 A;  3HWN A;  2IPP B;  1PBH A;  5CVM A;  3OVZ A;  3MOR A;  3CBJ A;  2G8J A;  1KHP A;  4YVA A;  1AU0 A;  3CH2 X;  2VHS A;  4X6H A;  2DCB A;  2FRQ A;  4P6E A;  1X9Y A;  3BC3 A;  4W5B A;  3H8C A;  2FTD A;  4CZW A;  3N3K A;  2OUL A;  2G8E A;  1MHW A;  3F5V A;  1AYV A;  4KLB A;  1DF0 A;  1ATK A;  1POP A;  2DJF B;  1AU3 A;  3OVX A;  2AUX A;  1ITO A;  3USV A;  2NQG A;  1AYU A;  4FK5 A;  1QDQ A;  3P5W A;  2XU4 A;  2DCA A;  2NQD B;  5K16 A;  2PBH A;  2NQI A;  4HWY A;  3CH3 X;  3O1G A;  1IWD A;  2DC6 A;  2DCC A;  2Y6E A;  1YAL A;  2BDL A;  3IHP A;  5CHT A;  5JH3 A;  3PBH A;  2FO5 A;  5EF4 A;  2C0Y A;  4BPV A;  1AU4 A;  4Q8G A;  1BP4 A;  3BWK A;  4MZS A;  2HXZ A;  4CDD B;  2O6X A;  1CVZ A;  1PCI A;  3PDF A;  3RVW A;  2XU5 A;  3RVV A;  4OEM A;  1TU6 A;  2HH5 A;  1EWP A;  4XR7 A;  3KX1 A;  1GLO A;  1CS8 A;  3H6S A;  1ZIV A;  2R9O A;  3KKU A;  2YJ9 A;  5J94 A;  1PXV A;  1A6R A;  5CHV A;  4CDF B;  4AXM A;  4I05 A;  5A24 A;  3WXF A;  1JQP A;  1QOL A;  3CBK A;  1XKG A;  3S3R A;  2F7D A;  3KSE A;  1MIR A;  1AU2 A;  1NL6 A;  4PAD A;  5EGW A;  4QH6 A;  2DZY A;  2ATO A;  2F1G A;  3N3G A;  1CJL A;  3PNR A;  4G54 A;  1S4V A;  2JQF R;  4PP2 E;  4X6I A;  4YYS A;  1CPJ A;  1U9Q X;  1ME4 A;  1F2C A;  4CDE B;  1AIM A;  1PPO A;  3BOW A;  5F02 A;  4QBB A;  7PCK A;  1FH0 A;  9PAP A;  3ERV A;  4FIP A;  1HUC B;  3M99 A;  2JQG R;  2B1M A;  3BPF A;  2GHU A;  2FT2 A;  1VSN A;  3D6S A;  1VJV A;  2E03 A;  2GFO A;  5CVO B;  5CVN B;  4QRX A;  1BGO A;  1GCB A;  1K3B B;  4AXL A;  1CB5 A;  4YYQ A;  1NB3 A;  1NPZ A;  3BPM A;  2OP3 A;  2P7U A;  2R9C A;  2DJG B;  3QT4 A;  1NQC A;  1EWM A;  3NHE A;  1CSB B;  3KW9 A;  4YYR A;  2E02 A;  1PIP A;  3U8E A;  3IUT A;  1BY8 A;  2IBI A;  5PAD A;  1YT7 A;  4RY2 A;  3O0U A;  3LXS A;  2FQ9 A;  3IMA A;  1PE6 A;  1F29 A;  3WXG A;  1CV8 A;  3H89 A;  4W4U A;  4W5C A;  3H7D A;  2YJB A;  4YYW A;  1DEU A;  4QRV A;  1SNK A;  1U5I A;  3OF8 A;  4PI3 A;  2DZZ A;  1MEM A;  1THE A;  1PPN A;  2YJ8 A;  3PW3 A;  1MDW A;  3OF9 A;  1GMY A;  3ZUA A;  3KFQ A;  3IV2 A;  4FJC A;  4MSX A;  2E01 A;  4BQV A;  4BS6 A;  1NB5 A;  1ME3 A;  1QXP A;  2DC7 A;  3GCB A;  4I07 A;  2PNS A;  3E1Z B;  2FYE A;  1Y4H A;  2G6D A;  3MTN A;  1CTE A;  4ZUX U;  1Y08 A;  4I04 A;  2AYN A;  3B79 A;  3I06 A;  3QSD A;  3S3Q A;  3V6E A;  1CQD A;  2ACT A;  1EF7 A;  4YYU A;  1M6D A;  4N79 A;  2R6N A;  1U9W A;  2CB5 A;  3H8B A;  3HHI A;  2WBF X;  3P5V A;  3HHA A;  3BCN A;  1YK7 A;  2B1N A;  8PCH A;  3DF0 A;  3V6C A;  4YV8 A;  1U9V A;  2P86 A;  2G7Y A;  1GEC E;  3IEJ A;  4P6G A;  3OIS A;  4BS5 A;  1F2A A;  2CIO A;  1TL9 A;  3I3T A;  2AVW A;  4XUI A;  4WA6 A;  2AU1 A;  2XU1 A;  3F75 A;  3TNX A;  4N8W A;  2R9F A;  4X6J A;  2VHF A;  1PPD A;  4YYV A;  3AI8 A;  1YK8 A;  2FRA A;  1MEG A;  1EWO A;  1AEC A;  3HD3 A;  4BSQ A;  3MHS A;  2BDZ A;  2NQA A;  2DC9 A;  4OEL A;  1YVB A;  3LFY A;  1TLO A;  3K24 A;  3P5X A;  1KFU L;  4DMY A;  3K9M A;  1KXR A;  3KWB X;  1F2B A;  2HHN A;  3MHH A;  1QMY A;  4PP1 A;  6PAD A;  2YJC A;  1U9X A;  2Y5B A;  1KHQ A;  4CDC B;  3KWZ A;  3C9E A;  2R9N A;  1BQI A;  5JA7 A;  1Q6K A;  1ZCM A;  2OZ2 A;  1SP4 B;  1PAD A;  3P5U A;  5FPW A;  3RVX A;  1NLJ A;  2XU3 A;  2DC8 A;  2AIM A;  2DCD A;  2FUD A;  1STF E;  2AS8 A;  1KFX L;  4DMX A;  2YJ2 A;  3QJ3 A;  4QRG A;  2ARY A;  4MZO A;  4Q8H A;  2PRE A;  1O0E A;  4K7C A;  1ICF A;  2HD5 A;  4N4Z A;  3IOQ A;  3WXE A;  1MS6 A;  2R9M A;  3N4C A;  2AUZ A;  1EWL A;  2H7J A;  1PPP A;  1AYW A;  2P0R A;  2PAD A;  2AYO A;  3K8U A; 
#chains in the Genus database with same CATH topology
 2E00 A;  3HWN A;  4BOQ A;  2IPP B;  1PBH A;  5CVM A;  3OVZ A;  3MOR A;  3CBJ A;  2G8J A;  1KHP A;  5EZS A;  4YVA A;  1AU0 A;  3CH2 X;  2VHS A;  4X6H A;  3PRP A;  2DCB A;  2FRQ A;  4P6E A;  1X9Y A;  2HWK A;  3BC3 A;  4W5B A;  3H8C A;  2FTD A;  1DKI A;  4CZW A;  3N3K A;  2OUL A;  2G8E A;  1MHW A;  3F5V A;  1AYV A;  4KLB A;  1DF0 A;  1ATK A;  1POP A;  2DJF B;  4GUA A;  1AU3 A;  3OVX A;  2AUX A;  1ITO A;  3USV A;  2NQG A;  1AYU A;  4FK5 A;  1QDQ A;  3P5W A;  2XU4 A;  2DCA A;  2NQD B;  5K16 A;  2PBH A;  2NQI A;  4HWY A;  3CH3 X;  3O1G A;  1IWD A;  2DC6 A;  2DCC A;  2Y6E A;  1YAL A;  3C0R A;  2BDL A;  3IHP A;  5CHT A;  5JH3 A;  3PBH A;  2FO5 A;  5EF4 A;  2C0Y A;  4BPV A;  1AU4 A;  4Q8G A;  1BP4 A;  3BWK A;  4IUM A;  4MZS A;  2JTC A;  4BOU A;  2HXZ A;  4CDD B;  2O6X A;  4PT5 A;  1CVZ A;  1PCI A;  3PDF A;  3RVW A;  2J7Q C;  2XU5 A;  4IP3 A;  3RVV A;  4OEM A;  1TU6 A;  2HH5 A;  2AGA A;  1EWP A;  4XR7 A;  3KX1 A;  1GLO A;  1CS8 A;  3H6S A;  1ZIV A;  2R9O A;  3KKU A;  2YJ9 A;  5J94 A;  1PXV A;  1A6R A;  5CHV A;  4CDF B;  4AXM A;  4I05 A;  5A24 A;  3WXF A;  4HXD B;  4RF1 A;  1JQP A;  1QOL A;  3E9S A;  3CBK A;  1XKG A;  4XZX A;  5KO3 A;  4MM3 B;  3S3R A;  2F7D A;  3KSE A;  1MIR A;  1AU2 A;  5EZQ A;  1NL6 A;  4PAD A;  5EGW A;  4QH6 A;  2DZY A;  2ATO A;  2F1G A;  3MJ5 A;  3N3G A;  1CJL A;  3PNR A;  4D8E A;  4G54 A;  1S4V A;  2JQF R;  4PP2 E;  4X6I A;  4YYS A;  1CPJ A;  1U9Q X;  1ME4 A;  1F2C A;  4CDE B;  1AIM A;  1PPO A;  3BOW A;  5F02 A;  4QBB A;  7PCK A;  1FH0 A;  9PAP A;  3ERV A;  4FIP A;  1HUC B;  4D8I A;  2BU3 A;  3M99 A;  3RNV A;  4D8B A;  2JQG R;  2B1M A;  3BPF A;  2GHU A;  4M0W A;  2FT2 A;  4BOZ A;  1VSN A;  3D6S A;  1VJV A;  2E03 A;  2GFO A;  5CVO B;  5CVN B;  4QRX A;  2JRI A;  1BGO A;  1GCB A;  1K3B B;  4AXL A;  1CB5 A;  4YYQ A;  1NB3 A;  3BPM A;  1NPZ A;  2OP3 A;  2P7U A;  2R9C A;  3TRK A;  2DJG B;  3QT4 A;  1NQC A;  1EWM A;  3NHE A;  1CSB B;  3KW9 A;  4YYR A;  2E02 A;  4P16 A;  1PIP A;  3U8E A;  3IUT A;  1BY8 A;  2IBI A;  5PAD A;  1YT7 A;  4RY2 A;  3O0U A;  3LXS A;  2FQ9 A;  2J7Q A;  1PE6 A;  3IMA A;  1F29 A;  3WXG A;  1CV8 A;  3H89 A;  3B21 A;  4W4U A;  4W5C A;  3H7D A;  2YJB A;  4OVZ B;  4YYW A;  1DEU A;  3MP2 A;  4QRV A;  3ZNH A;  1SNK A;  1U5I A;  3OF8 A;  4PI3 A;  2DZZ A;  1MEM A;  3PHW A;  1THE A;  1PPN A;  2YJ8 A;  4REZ A;  3TMP A;  3PW3 A;  1MDW A;  3OF9 A;  1GMY A;  3ZUA A;  3KFQ A;  3IV2 A;  4FJC A;  4MSX A;  2E01 A;  4BQV A;  4BS6 A;  1NB5 A;  5JZE A;  1ME3 A;  1QXP A;  2DC7 A;  3GCB A;  4I07 A;  2PNS A;  3E1Z B;  2FYE A;  3W30 A;  1Y4H A;  2G6D A;  3MTN A;  1CTE A;  4ZUX U;  1Y08 A;  4I04 A;  2AYN A;  3B79 A;  3I06 A;  3QSD A;  3S3Q A;  4A5U A;  5E6J A;  3V6E A;  1CQD A;  2ACT A;  1EF7 A;  4YYU A;  1UKF A;  1M6D A;  4N79 A;  2R6N A;  2DOS A;  1U9W A;  2CB5 A;  2UZJ A;  3H8B A;  3HHI A;  2WBF X;  3P5V A;  3IFU A;  3O65 A;  2FE8 A;  3HHA A;  3BY4 A;  3BB7 A;  3BCN A;  1YK7 A;  2B1N A;  8PCH A;  3DF0 A;  3V6C A;  4YV8 A;  1U9V A;  2P86 A;  4MI7 A;  2G7Y A;  1GEC E;  3IEJ A;  2Z84 A;  4P6G A;  3PSE A;  3OIS A;  4BS5 A;  1F2A A;  2CIO A;  4WUR A;  1TL9 A;  1PVJ A;  4RKX A;  3I3T A;  2AVW A;  4XUI A;  4WA6 A;  2AU1 A;  2XU1 A;  3F75 A;  3TNX A;  4N8W A;  4RF0 A;  2R9F A;  4X6J A;  2VHF A;  3PHX A;  1PPD A;  3PRM A;  4YYV A;  3AI8 A;  1YK8 A;  2FRA A;  1MEG A;  1EWO A;  1AEC A;  3HD3 A;  4BSQ A;  3MHS A;  2BDZ A;  2NQA A;  4OVZ A;  2DC9 A;  4OEL A;  3PT2 A;  1YVB A;  3LFY A;  4RNA A;  1TLO A;  3K24 A;  4R3D A;  3P5X A;  1KFU L;  4DMY A;  3K9M A;  2BTW A;  1KXR A;  4BOP A;  3KWB X;  1F2B A;  2HHN A;  3MHH A;  3W31 A;  1QMY A;  4PP1 A;  6PAD A;  2YJC A;  1U9X A;  2Y5B A;  1KHQ A;  3OQC A;  4CDC B;  3KWZ A;  3C9E A;  2R9N A;  1BQI A;  2BTW B;  5JA7 A;  1Q6K A;  1ZCM A;  2OZ2 A;  1SP4 B;  1PAD A;  3P5U A;  5FPW A;  3RVX A;  1NLJ A;  2XU3 A;  2DC8 A;  2AIM A;  2DCD A;  4ZTB A;  2FUD A;  1STF E;  2AS8 A;  1KFX L;  4DMX A;  2YJ2 A;  3QJ3 A;  4QRG A;  2ARY A;  4MZO A;  4Q8H A;  2PRE A;  4BOS A;  1O0E A;  4K7C A;  3BBA A;  1ICF A;  2HD5 A;  4N4Z A;  3IOQ A;  3WXE A;  1MS6 A;  4OW0 A;  2R9M A;  3PHU A;  3N4C A;  2AUZ A;  3MTV A;  1EWL A;  2H7J A;  1PPP A;  1AYW A;  2P0R A;  2PAD A;  1YZB A;  2AYO A;  3K8U A; 
#chains in the Genus database with same CATH homology
 2E00 A;  3HWN A;  2IPP B;  1PBH A;  5CVM A;  3OVZ A;  3MOR A;  3CBJ A;  2G8J A;  1KHP A;  4YVA A;  1AU0 A;  3CH2 X;  2VHS A;  4X6H A;  2DCB A;  2FRQ A;  4P6E A;  1X9Y A;  3BC3 A;  4W5B A;  3H8C A;  2FTD A;  4CZW A;  3N3K A;  2OUL A;  2G8E A;  1MHW A;  3F5V A;  1AYV A;  4KLB A;  1DF0 A;  1ATK A;  1POP A;  2DJF B;  1AU3 A;  3OVX A;  2AUX A;  2VFB A;  1ITO A;  3USV A;  2NQG A;  1AYU A;  4FK5 A;  1QDQ A;  3P5W A;  2XU4 A;  2DCA A;  2NQD B;  5K16 A;  2PBH A;  2NQI A;  4HWY A;  3CH3 X;  3O1G A;  1IWD A;  2DC6 A;  2DCC A;  2Y6E A;  1YAL A;  2BDL A;  3IHP A;  5CHT A;  5JH3 A;  3PBH A;  2FO5 A;  5EF4 A;  2C0Y A;  4BPV A;  1AU4 A;  4Q8G A;  1BP4 A;  3BWK A;  4MZS A;  2HXZ A;  4CDD B;  2O6X A;  1CVZ A;  1PCI A;  3PDF A;  3RVW A;  2XU5 A;  3RVV A;  4OEM A;  4GUZ A;  1TU6 A;  2HH5 A;  1W4T A;  1EWP A;  4XR7 A;  3KX1 A;  1GLO A;  1CS8 A;  3H6S A;  1ZIV A;  2R9O A;  3KKU A;  2YJ9 A;  5J94 A;  1PXV A;  1A6R A;  5CHV A;  4CDF B;  4AXM A;  4I05 A;  5A24 A;  3WXF A;  1JQP A;  1QOL A;  3CBK A;  1XKG A;  3S3R A;  2F7D A;  4NV7 A;  3KSE A;  1MIR A;  1AU2 A;  1NL6 A;  4PAD A;  5EGW A;  4QH6 A;  2DZY A;  2ATO A;  2F1G A;  3N3G A;  1CJL A;  3PNR A;  4G54 A;  1S4V A;  2JQF R;  4PP2 E;  4X6I A;  3LTW A;  4YYS A;  1CPJ A;  1U9Q X;  1ME4 A;  1F2C A;  4CDE B;  1AIM A;  1PPO A;  3BOW A;  5F02 A;  4QBB A;  7PCK A;  1FH0 A;  9PAP A;  3ERV A;  1GX3 A;  4FIP A;  1HUC B;  1W6F A;  3M99 A;  4BGF A;  2JQG R;  2B1M A;  3BPF A;  2GHU A;  2FT2 A;  1VSN A;  3D6S A;  1VJV A;  2E03 A;  2GFO A;  5CVO B;  5CVN B;  4QRX A;  1BGO A;  1GCB A;  1K3B B;  4AXL A;  1CB5 A;  4B55 A;  4YYQ A;  1NB3 A;  3BPM A;  1NPZ A;  2OP3 A;  2P7U A;  2R9C A;  2DJG B;  3QT4 A;  1NQC A;  1EWM A;  3NHE A;  1CSB B;  3KW9 A;  4YYR A;  2E02 A;  1PIP A;  3U8E A;  3IUT A;  1BY8 A;  2IBI A;  5PAD A;  1YT7 A;  4RY2 A;  3O0U A;  3LXS A;  2FQ9 A;  3IMA A;  1PE6 A;  1F29 A;  3WXG A;  1CV8 A;  3H89 A;  4W4U A;  4W5C A;  3H7D A;  2YJB A;  4YYW A;  1DEU A;  4QRV A;  1SNK A;  1U5I A;  2VFC A;  3OF8 A;  4PI3 A;  2DZZ A;  1MEM A;  2BSZ A;  1THE A;  1PPN A;  2YJ8 A;  3PW3 A;  1MDW A;  3OF9 A;  1GMY A;  3ZUA A;  3KFQ A;  3IV2 A;  4FJC A;  4MSX A;  2E01 A;  4BQV A;  4BS6 A;  1NB5 A;  1ME3 A;  1QXP A;  2DC7 A;  3GCB A;  4I07 A;  2PNS A;  3E1Z B;  2FYE A;  1Y4H A;  2G6D A;  3D9W A;  3MTN A;  1CTE A;  4ZUX U;  1Y08 A;  4NV8 A;  4I04 A;  2AYN A;  3B79 A;  3I06 A;  3QSD A;  3S3Q A;  3V6E A;  1CQD A;  2ACT A;  1EF7 A;  4YYU A;  1M6D A;  4N79 A;  2R6N A;  1U9W A;  2CB5 A;  3H8B A;  3HHI A;  2WBF X;  3P5V A;  3HHA A;  3BCN A;  1YK7 A;  2B1N A;  8PCH A;  3DF0 A;  3V6C A;  4YV8 A;  1U9V A;  2P86 A;  2G7Y A;  1GEC E;  3IEJ A;  4P6G A;  3OIS A;  4BS5 A;  1F2A A;  2CIO A;  1TL9 A;  3I3T A;  2AVW A;  4XUI A;  4WA6 A;  2AU1 A;  2XU1 A;  3F75 A;  1E2T A;  3TNX A;  4N8W A;  2R9F A;  4X6J A;  2VHF A;  1PPD A;  4YYV A;  3AI8 A;  1YK8 A;  2FRA A;  1MEG A;  1EWO A;  1AEC A;  3HD3 A;  4C5P A;  4BSQ A;  3MHS A;  2BDZ A;  2NQA A;  2DC9 A;  4OEL A;  1YVB A;  3LFY A;  1TLO A;  3K24 A;  3P5X A;  1KFU L;  4DMY A;  3K9M A;  1KXR A;  3KWB X;  1F2B A;  2HHN A;  3MHH A;  1W5R A;  1QMY A;  4PP1 A;  6PAD A;  2YJC A;  1U9X A;  2Y5B A;  1KHQ A;  4CDC B;  3KWZ A;  3C9E A;  2R9N A;  1BQI A;  5JA7 A;  1Q6K A;  1ZCM A;  2OZ2 A;  1SP4 B;  1PAD A;  3P5U A;  5FPW A;  3RVX A;  1NLJ A;  2XU3 A;  2DC8 A;  2AIM A;  2DCD A;  2FUD A;  1STF E;  2AS8 A;  1KFX L;  4DMX A;  2YJ2 A;  3QJ3 A;  4QRG A;  2ARY A;  4MZO A;  4Q8H A;  2PRE A;  1O0E A;  4K7C A;  1ICF A;  2HD5 A;  4N4Z A;  3IOQ A;  3WXE A;  1MS6 A;  2R9M A;  3N4C A;  2AUZ A;  1EWL A;  2H7J A;  1PPP A;  1AYW A;  2P0R A;  2PAD A;  2AYO A;  3K8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...