1MS6A

Dipeptide nitrile inhibitor bound to cathepsin s.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of dipeptide nitriles as reversible and potent Cathepsin S inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 70
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ms6A00
1NPZA 3CH2X 1MS6A 1NLJA 1AYVA 1YALA 2H7JA 1EWPA 3IOQA 1YVBA 2JQGR 2ACTA 3H7DA 3S3RA 1KFXL 2F7DA 4FJCA 3C9EA 3QSDA 4QRGA 2HH5A 2PNSA 2DC8A 2IPPB 1CSBB 3H8BA 1YK8A 4CDCB 3QJ3A 5CVOB 3I3TA 4Q8GA 4XR7A 3HHAA 3OVZA 4YYRA 4PP2E 4YV8A 4YVAA 3CH3X 2B1MA 4I07A 3LFYA 4PI3A 2DCDA 5EF4A 3MHHA 1GCBA 2NQAA 2OZ2A 4X6JA 4XUIA 1AU4A 4ZUXU 1PPDA 3H6SA 1IWDA 1YK7A 2AS8A 2FO5A 3ZUAA 3V6CA 3B79A 3K9MA 3H89A 3P5UA 4YYVA 1KFUL 3KW9A 6PADA 1VJVA 1PPOA 1CV8A 4KLBA 3N4CA 1CPJA 4OEMA 2FYEA 3O1GA 2DC7A 1CVZA 2AIMA 1K3BB 2R9CA 1EWLA 1QXPA 1ME3A 1ZIVA 1TU6A 2YJ8A 1TL9A 4N4ZA 3P5VA 3F75A 2FTDA 3CBJA 3U8EA 1ITOA 1VSNA 3PW3A 4Q8HA 4G54A 2G6DA 1PE6A 2R9NA 2F1GA 2PREA 2R9MA 4I04A 5F02A 3KSEA 1F29A 4P6EA 4W5CA 8PCHA 2PADA 4BS5A 1TLOA 5CHTA 3KWZA 3MORA 1M6DA 3RVWA 1NB5A 3AI8A 3DF0A 1U9XA 2DZYA 3KX1A 2G7YA 4QBBA 1XKGA 1MDWA 1THEA 4QH6A 3KKUA 4I05A 3O0UA 1X9YA 3IUTA 1DEUA 2VHFA 4DMYA 1O0EA 1FH0A 2DZZA 3BPMA 3KFQA 3IEJA 2AYNA 4YYWA 2HHNA 3OISA 2JQFR 1DF0A 1AU2A 3BCNA 1SP4B 4FIPA 1U9VA 1PIPA 2CB5A 2Y6EA 4MZSA 4PP1A 2DJFB 2XU5A 1MHWA 2ARYA 2FUDA 1EF7A 2PBHA 4YYQA 2DJGB 5J94A 2P7UA 2NQDB 2R6NA 3HD3A 3M99A 3WXEA 3NHEA 3I06A 7PCKA 2FRQA 2E02A 1ICFA 2DCAA 2YJ9A 2NQIA 3PDFA 1EWMA 2E00A 2AYOA 4X6HA 2G8EA 4P6GA 2FT2A 4N8WA 2GHUA 2G8JA 2E01A 4N79A 3KWBX 1BGOA 1CTEA 2R9OA 1MEMA 3MTNA 4HWYA 5EGWA 3BWKA 2FRAA 2Y5BA 1ZCMA 2R9FA 2YJCA 2GFOA 3HWNA 5CHVA 3TNXA 9PAPA 1U5IA 1AU0A 4MZOA 2XU1A 2DCCA 4QRXA 2AUZA 1BY8A 1QMYA 4BS6A 3OVXA 3BOWA 1Q6KA 2HXZA 4WA6A 1KHQA 4W4UA 1GLOA 1ATKA 5CVMA 3RVVA 2FQ9A 4YYSA 1F2AA 2AVWA 2AU1A 2WBFX 1S4VA 3V6EA 2XU4A 1NL6A 5CVNB 4BPVA 4AXLA 1BQIA 3P5WA 2DC6A 3H8CA 5FPWA 1STFE 5PADA 1CQDA 1PADA 4PADA 4CDEB 2HD5A 2BDLA 3F5VA 4K7CA 2DCBA 3IHPA 4FK5A 4CDFB 2VHSA 1Y08A 4MSXA 4BQVA 5A24A 2E03A 3D6SA 1AIMA 5K16A 5JH3A 3P5XA 1MIRA 3GCBA 3OF9A 1GMYA 3BC3A 2AUXA 4CZWA 1A6RA 3CBKA 1KHPA 1PBHA 2IBIA 2B1NA 2C0YA 3QT4A 1QOLA 1POPA 3ERVA 4CDDB 3LXSA 4X6IA 1HUCB 3K8UA 1CB5A 3OF8A 4AXMA 4BSQA 2NQGA 1NB3A 2BDZA 1F2BA 4DMXA 1NQCA 2P86A 3S3QA 2CIOA 1EWOA 1JQPA 3PNRA 1Y4HA 2OULA 2ATOA 2YJBA 1AECA 1AYWA 4QRVA 3WXGA 3HHIA 3N3GA 1GECE 1PCIA 2XU3A 3PBHA 1YT7A 1U9WA 1KXRA 1SNKA 4OELA 3RVXA 3USVA 1BP4A 3K24A 4W5BA 2P0RA 2OP3A 4RY2A 1CJLA 1U9QX 3N3KA 3IMAA 3WXFA 3MHSA 1AYUA 1PPNA 2O6XA 1AU3A 1ME4A 3IV2A 1PPPA 4YYUA 2YJ2A 5JA7A 1CS8A 1QDQA 2DC9A 3E1ZB 1PXVA 1F2CA 1MEGA 3BPFA
chains in the Genus database with same CATH superfamily
1NPZA 3CH2X 1MS6A 1NLJA 1PVJA 1AYVA 1YALA 2H7JA 4RF0A 4OVZA 4RKXA 3PRMA 1EWPA 3IOQA 1YVBA 2JQGR 2ACTA 3H7DA 3S3RA 1KFXL 2F7DA 4FJCA 4MI7A 3C9EA 3QSDA 4QRGA 4ZTBA 2HH5A 2PNSA 2DC8A 3MP2A 2IPPB 1CSBB 3H8BA 1YK8A 4CDCB 3QJ3A 5CVOB 3I3TA 4Q8GA 4XR7A 3HHAA 3OVZA 4XZXA 4YYRA 4PP2E 4YV8A 4YVAA 3CH3X 2B1MA 2BU3A 3PHXA 4I07A 3LFYA 4PI3A 2DCDA 5EF4A 2BTWA 3MHHA 1GCBA 2NQAA 2OZ2A 4X6JA 2AGAA 4XUIA 1AU4A 4ZUXU 1PPDA 3H6SA 1IWDA 1YK7A 2AS8A 2FO5A 1YZBA 3ZUAA 3V6CA 3B79A 3K9MA 4A5UA 3H89A 3P5UA 4YYVA 1KFUL 3KW9A 6PADA 1VJVA 1PPOA 1CV8A 4D8EA 4KLBA 3N4CA 1CPJA 4OEMA 2FYEA 4D8IA 3O1GA 2DC7A 1CVZA 2AIMA 1K3BB 2R9CA 4IUMA 1EWLA 1QXPA 1ME3A 1ZIVA 1TU6A 2YJ8A 1TL9A 4N4ZA 3P5VA 3F75A 2FTDA 3CBJA 3U8EA 1ITOA 2FE8A 1VSNA 3PW3A 4HXDB 4Q8HA 4G54A 2G6DA 1PE6A 2R9NA 3PHUA 2F1GA 2JTCA 2PREA 2R9MA 4I04A 5F02A 5JZEA 3KSEA 1F29A 4P6EA 4W5CA 8PCHA 2PADA 4BS5A 1TLOA 4RF1A 5CHTA 3KWZA 3MORA 4P16A 1M6DA 3RVWA 1NB5A 3AI8A 3IFUA 3DF0A 1U9XA 4R3DA 2DZYA 3KX1A 2G7YA 4QBBA 1XKGA 1MDWA 4OW0A 1THEA 4QH6A 4BOSA 4MM3B 3KKUA 4I05A 3O0UA 2BTWB 1X9YA 3IUTA 1DEUA 5KO3A 2VHFA 3TMPA 4DMYA 1O0EA 1FH0A 2DZZA 3BPMA 3KFQA 3IEJA 2AYNA 4YYWA 2HHNA 5E6JA 3OISA 2JQFR 1DF0A 1AU2A 3BCNA 4BOPA 4GUAA 1SP4B 3PHWA 4FIPA 1U9VA 1PIPA 4RNAA 2CB5A 2Y6EA 4MZSA 4PP1A 2DJFB 2XU5A 1MHWA 2ARYA 2FUDA 1EF7A 2PBHA 4YYQA 2DJGB 5J94A 2P7UA 2NQDB 3TRKA 2R6NA 3PRPA 3W31A 2HWKA 3HD3A 3M99A 3WXEA 3NHEA 3I06A 7PCKA 2FRQA 2E02A 1ICFA 2DCAA 2YJ9A 2NQIA 3PDFA 1EWMA 2E00A 4OVZB 2AYOA 4X6HA 2G8EA 4P6GA 2FT2A 4N8WA 2GHUA 4BOUA 2J7QA 2G8JA 3E9SA 2E01A 4N79A 3KWBX 1BGOA 1CTEA 2R9OA 1MEMA 3MTNA 4HWYA 5EGWA 3BWKA 2FRAA 2Y5BA 1ZCMA 2R9FA 2YJCA 2GFOA 3HWNA 5CHVA 3TNXA 9PAPA 1U5IA 1AU0A 4MZOA 5EZSA 2XU1A 2DCCA 4QRXA 2AUZA 1BY8A 1QMYA 4BS6A 3OVXA 3BOWA 4M0WA 1Q6KA 2HXZA 4WA6A 1KHQA 4W4UA 1GLOA 1ATKA 5CVMA 3RVVA 2FQ9A 4YYSA 5EZQA 1F2AA 2AVWA 2AU1A 2J7QC 2WBFX 1S4VA 3V6EA 2XU4A 1NL6A 5CVNB 4BPVA 4AXLA 1BQIA 3P5WA 3BY4A 2DC6A 4PT5A 3H8CA 5FPWA 3ZNHA 1STFE 5PADA 1CQDA 3BBAA 1PADA 4PADA 4CDEB 2HD5A 2BDLA 3F5VA 4K7CA 3W30A 2DCBA 4REZA 3IHPA 4IP3A 4FK5A 3B21A 3PT2A 4CDFB 2VHSA 1Y08A 4MSXA 4BQVA 5A24A 2E03A 3D6SA 1AIMA 5K16A 5JH3A 3P5XA 1MIRA 3GCBA 3OF9A 1GMYA 3BC3A 2AUXA 4D8BA 4CZWA 1A6RA 3CBKA 1KHPA 3RNVA 3C0RA 1PBHA 2IBIA 2B1NA 2C0YA 4WURA 3QT4A 1QOLA 1POPA 3ERVA 4CDDB 3LXSA 4X6IA 1HUCB 3K8UA 1CB5A 3MTVA 3O65A 3OF8A 2JRIA 4AXMA 1UKFA 4BSQA 2NQGA 1NB3A 2BDZA 1F2BA 4DMXA 1NQCA 2P86A 3S3QA 2CIOA 4BOZA 1EWOA 1JQPA 3PNRA 1Y4HA 2OULA 2ATOA 2YJBA 1AECA 1AYWA 4QRVA 3WXGA 3HHIA 3N3GA 1GECE 1PCIA 2XU3A 3PBHA 2Z84A 3BB7A 1YT7A 4BOQA 1U9WA 1KXRA 1SNKA 4OELA 3RVXA 3USVA 2UZJA 1BP4A 1DKIA 3K24A 3PSEA 4W5BA 2P0RA 2OP3A 4RY2A 1CJLA 1U9QX 3N3KA 3IMAA 3WXFA 3MHSA 3OQCA 1AYUA 1PPNA 2O6XA 1AU3A 1ME4A 3IV2A 2DOSA 1PPPA 4YYUA 2YJ2A 5JA7A 1CS8A 1QDQA 2DC9A 3E1ZB 1PXVA 1F2CA 3MJ5A 1MEGA 3BPFA
chains in the Genus database with same CATH topology
1NPZA 3CH2X 1W6FA 1MS6A 1NLJA 1AYVA 1YALA 2H7JA 1EWPA 3IOQA 1YVBA 2JQGR 2ACTA 3H7DA 3S3RA 1KFXL 2F7DA 4FJCA 3C9EA 3QSDA 4QRGA 2HH5A 2PNSA 2DC8A 2IPPB 1CSBB 3H8BA 1YK8A 4CDCB 3QJ3A 5CVOB 3I3TA 4Q8GA 4XR7A 3HHAA 3OVZA 3LTWA 4YYRA 4PP2E 4YV8A 4YVAA 3CH3X 2B1MA 4I07A 3LFYA 4PI3A 2DCDA 5EF4A 3MHHA 1GCBA 2NQAA 2OZ2A 4X6JA 4XUIA 1AU4A 4ZUXU 1PPDA 2VFCA 3H6SA 1IWDA 1YK7A 2AS8A 2FO5A 4BGFA 3ZUAA 3V6CA 3B79A 3K9MA 3H89A 3P5UA 4NV8A 4YYVA 1KFUL 3KW9A 6PADA 1VJVA 1PPOA 1CV8A 4KLBA 3N4CA 1CPJA 4OEMA 2FYEA 3O1GA 2DC7A 1CVZA 2AIMA 1K3BB 2R9CA 1EWLA 1QXPA 1ME3A 1ZIVA 1TU6A 2YJ8A 1TL9A 4N4ZA 3P5VA 3F75A 2FTDA 3CBJA 3U8EA 1ITOA 1VSNA 3PW3A 4Q8HA 4G54A 2G6DA 1PE6A 2R9NA 2BSZA 2F1GA 2PREA 2R9MA 4I04A 5F02A 1W4TA 3KSEA 1F29A 4P6EA 4W5CA 8PCHA 2PADA 4BS5A 1TLOA 5CHTA 3KWZA 3MORA 1M6DA 3RVWA 1NB5A 3AI8A 3DF0A 1U9XA 2DZYA 3KX1A 2G7YA 4QBBA 1XKGA 1MDWA 1THEA 4QH6A 3KKUA 4I05A 3O0UA 1X9YA 3IUTA 1DEUA 2VHFA 1W5RA 4DMYA 1O0EA 1FH0A 2DZZA 3BPMA 3KFQA 3IEJA 2AYNA 4YYWA 2HHNA 3OISA 2JQFR 1DF0A 1AU2A 3BCNA 1SP4B 4FIPA 1U9VA 1PIPA 2CB5A 2Y6EA 4MZSA 4PP1A 2DJFB 2XU5A 1MHWA 2ARYA 2FUDA 1EF7A 2PBHA 4YYQA 2DJGB 5J94A 2P7UA 2NQDB 2R6NA 3HD3A 3M99A 3WXEA 1E2TA 3NHEA 3I06A 7PCKA 2FRQA 2E02A 1ICFA 2DCAA 2YJ9A 2NQIA 3PDFA 1EWMA 2E00A 2AYOA 4X6HA 2G8EA 4P6GA 2FT2A 4N8WA 2GHUA 2G8JA 2E01A 4N79A 3KWBX 1BGOA 1CTEA 2R9OA 1MEMA 3MTNA 4HWYA 5EGWA 3BWKA 2FRAA 4C5PA 4GUZA 2Y5BA 1ZCMA 2R9FA 2YJCA 2GFOA 3HWNA 5CHVA 3TNXA 9PAPA 1U5IA 1AU0A 4NV7A 4MZOA 2XU1A 2DCCA 4QRXA 2AUZA 1BY8A 1QMYA 4BS6A 3OVXA 3BOWA 3D9WA 1Q6KA 2HXZA 4WA6A 1KHQA 4W4UA 1GLOA 1ATKA 5CVMA 3RVVA 2FQ9A 4YYSA 1F2AA 2AVWA 2AU1A 2WBFX 1S4VA 3V6EA 2XU4A 1NL6A 5CVNB 4BPVA 4AXLA 1BQIA 3P5WA 2DC6A 3H8CA 5FPWA 1STFE 5PADA 1CQDA 1PADA 4PADA 4CDEB 2HD5A 2BDLA 3F5VA 4K7CA 2DCBA 3IHPA 4FK5A 4CDFB 2VHSA 1Y08A 4MSXA 4BQVA 5A24A 2E03A 3D6SA 1AIMA 5K16A 5JH3A 3P5XA 1MIRA 3GCBA 3OF9A 1GMYA 3BC3A 2AUXA 4CZWA 1A6RA 3CBKA 1KHPA 1PBHA 2IBIA 2B1NA 2C0YA 3QT4A 1QOLA 1POPA 3ERVA 4CDDB 3LXSA 4X6IA 1HUCB 3K8UA 1CB5A 3OF8A 4AXMA 4BSQA 2NQGA 1NB3A 2BDZA 1F2BA 4DMXA 1NQCA 2P86A 1GX3A 3S3QA 2CIOA 1EWOA 1JQPA 3PNRA 1Y4HA 2OULA 2ATOA 2YJBA 1AECA 1AYWA 4QRVA 3WXGA 3HHIA 3N3GA 1GECE 1PCIA 2XU3A 3PBHA 1YT7A 1U9WA 1KXRA 1SNKA 4OELA 3RVXA 3USVA 1BP4A 3K24A 4W5BA 2VFBA 2P0RA 2OP3A 4RY2A 1CJLA 1U9QX 3N3KA 3IMAA 3WXFA 3MHSA 1AYUA 1PPNA 2O6XA 1AU3A 1ME4A 3IV2A 1PPPA 4YYUA 2YJ2A 5JA7A 4B55A 1CS8A 1QDQA 2DC9A 3E1ZB 1PXVA 1F2CA 1MEGA 3BPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPZ A;  3CH2 X;  1MS6 A;  1NLJ A;  1AYV A;  1YAL A;  2H7J A;  1EWP A;  3IOQ A;  1YVB A;  2JQG R;  2ACT A;  3H7D A;  3S3R A;  1KFX L;  2F7D A;  4FJC A;  3C9E A;  3QSD A;  4QRG A;  2HH5 A;  2PNS A;  2DC8 A;  2IPP B;  1CSB B;  3H8B A;  1YK8 A;  4CDC B;  3QJ3 A;  5CVO B;  3I3T A;  4Q8G A;  4XR7 A;  3HHA A;  3OVZ A;  4YYR A;  4PP2 E;  4YV8 A;  4YVA A;  3CH3 X;  2B1M A;  4I07 A;  3LFY A;  4PI3 A;  2DCD A;  5EF4 A;  3MHH A;  1GCB A;  2NQA A;  2OZ2 A;  4X6J A;  4XUI A;  1AU4 A;  4ZUX U;  1PPD A;  3H6S A;  1IWD A;  1YK7 A;  2AS8 A;  2FO5 A;  3ZUA A;  3V6C A;  3B79 A;  3K9M A;  3H89 A;  3P5U A;  4YYV A;  1KFU L;  3KW9 A;  6PAD A;  1VJV A;  1PPO A;  1CV8 A;  4KLB A;  3N4C A;  1CPJ A;  4OEM A;  2FYE A;  3O1G A;  2DC7 A;  1CVZ A;  2AIM A;  1K3B B;  2R9C A;  1EWL A;  1QXP A;  1ME3 A;  1ZIV A;  1TU6 A;  2YJ8 A;  1TL9 A;  4N4Z A;  3P5V A;  3F75 A;  2FTD A;  3CBJ A;  3U8E A;  1ITO A;  1VSN A;  3PW3 A;  4Q8H A;  4G54 A;  2G6D A;  1PE6 A;  2R9N A;  2F1G A;  2PRE A;  2R9M A;  4I04 A;  5F02 A;  3KSE A;  1F29 A;  4P6E A;  4W5C A;  8PCH A;  2PAD A;  4BS5 A;  1TLO A;  5CHT A;  3KWZ A;  3MOR A;  1M6D A;  3RVW A;  1NB5 A;  3AI8 A;  3DF0 A;  1U9X A;  2DZY A;  3KX1 A;  2G7Y A;  4QBB A;  1XKG A;  1MDW A;  1THE A;  4QH6 A;  3KKU A;  4I05 A;  3O0U A;  1X9Y A;  3IUT A;  1DEU A;  2VHF A;  4DMY A;  1O0E A;  1FH0 A;  2DZZ A;  3BPM A;  3KFQ A;  3IEJ A;  2AYN A;  4YYW A;  2HHN A;  3OIS A;  2JQF R;  1DF0 A;  1AU2 A;  3BCN A;  1SP4 B;  4FIP A;  1U9V A;  1PIP A;  2CB5 A;  2Y6E A;  4MZS A;  4PP1 A;  2DJF B;  2XU5 A;  1MHW A;  2ARY A;  2FUD A;  1EF7 A;  2PBH A;  4YYQ A;  2DJG B;  5J94 A;  2P7U A;  2NQD B;  2R6N A;  3HD3 A;  3M99 A;  3WXE A;  3NHE A;  3I06 A;  7PCK A;  2FRQ A;  2E02 A;  1ICF A;  2DCA A;  2YJ9 A;  2NQI A;  3PDF A;  1EWM A;  2E00 A;  2AYO A;  4X6H A;  2G8E A;  4P6G A;  2FT2 A;  4N8W A;  2GHU A;  2G8J A;  2E01 A;  4N79 A;  3KWB X;  1BGO A;  1CTE A;  2R9O A;  1MEM A;  3MTN A;  4HWY A;  5EGW A;  3BWK A;  2FRA A;  2Y5B A;  1ZCM A;  2R9F A;  2YJC A;  2GFO A;  3HWN A;  5CHV A;  3TNX A;  9PAP A;  1U5I A;  1AU0 A;  4MZO A;  2XU1 A;  2DCC A;  4QRX A;  2AUZ A;  1BY8 A;  1QMY A;  4BS6 A;  3OVX A;  3BOW A;  1Q6K A;  2HXZ A;  4WA6 A;  1KHQ A;  4W4U A;  1GLO A;  1ATK A;  5CVM A;  3RVV A;  2FQ9 A;  4YYS A;  1F2A A;  2AVW A;  2AU1 A;  2WBF X;  1S4V A;  3V6E A;  2XU4 A;  1NL6 A;  5CVN B;  4BPV A;  4AXL A;  1BQI A;  3P5W A;  2DC6 A;  3H8C A;  5FPW A;  1STF E;  5PAD A;  1CQD A;  1PAD A;  4PAD A;  4CDE B;  2HD5 A;  2BDL A;  3F5V A;  4K7C A;  2DCB A;  3IHP A;  4FK5 A;  4CDF B;  2VHS A;  1Y08 A;  4MSX A;  4BQV A;  5A24 A;  2E03 A;  3D6S A;  1AIM A;  5K16 A;  5JH3 A;  3P5X A;  1MIR A;  3GCB A;  3OF9 A;  1GMY A;  3BC3 A;  2AUX A;  4CZW A;  1A6R A;  3CBK A;  1KHP A;  1PBH A;  2IBI A;  2B1N A;  2C0Y A;  3QT4 A;  1QOL A;  1POP A;  3ERV A;  4CDD B;  3LXS A;  4X6I A;  1HUC B;  3K8U A;  1CB5 A;  3OF8 A;  4AXM A;  4BSQ A;  2NQG A;  1NB3 A;  2BDZ A;  1F2B A;  4DMX A;  1NQC A;  2P86 A;  3S3Q A;  2CIO A;  1EWO A;  1JQP A;  3PNR A;  1Y4H A;  2OUL A;  2ATO A;  2YJB A;  1AEC A;  1AYW A;  4QRV A;  3WXG A;  3HHI A;  3N3G A;  1GEC E;  1PCI A;  2XU3 A;  3PBH A;  1YT7 A;  1U9W A;  1KXR A;  1SNK A;  4OEL A;  3RVX A;  3USV A;  1BP4 A;  3K24 A;  4W5B A;  2P0R A;  2OP3 A;  4RY2 A;  1CJL A;  1U9Q X;  3N3K A;  3IMA A;  3WXF A;  3MHS A;  1AYU A;  1PPN A;  2O6X A;  1AU3 A;  1ME4 A;  3IV2 A;  1PPP A;  4YYU A;  2YJ2 A;  5JA7 A;  1CS8 A;  1QDQ A;  2DC9 A;  3E1Z B;  1PXV A;  1F2C A;  1MEG A;  3BPF A; 
#chains in the Genus database with same CATH topology
 1NPZ A;  3CH2 X;  1MS6 A;  1NLJ A;  1PVJ A;  1AYV A;  1YAL A;  2H7J A;  4RF0 A;  4OVZ A;  4RKX A;  3PRM A;  1EWP A;  3IOQ A;  1YVB A;  2JQG R;  2ACT A;  3H7D A;  3S3R A;  1KFX L;  2F7D A;  4FJC A;  4MI7 A;  3C9E A;  3QSD A;  4QRG A;  4ZTB A;  2HH5 A;  2PNS A;  2DC8 A;  3MP2 A;  2IPP B;  1CSB B;  3H8B A;  1YK8 A;  4CDC B;  3QJ3 A;  5CVO B;  3I3T A;  4Q8G A;  4XR7 A;  3HHA A;  3OVZ A;  4XZX A;  4YYR A;  4PP2 E;  4YV8 A;  4YVA A;  3CH3 X;  2B1M A;  2BU3 A;  3PHX A;  4I07 A;  3LFY A;  4PI3 A;  2DCD A;  5EF4 A;  2BTW A;  3MHH A;  1GCB A;  2NQA A;  2OZ2 A;  4X6J A;  2AGA A;  4XUI A;  1AU4 A;  4ZUX U;  1PPD A;  3H6S A;  1IWD A;  1YK7 A;  2AS8 A;  2FO5 A;  1YZB A;  3ZUA A;  3V6C A;  3B79 A;  3K9M A;  4A5U A;  3H89 A;  3P5U A;  4YYV A;  1KFU L;  3KW9 A;  6PAD A;  1VJV A;  1PPO A;  1CV8 A;  4D8E A;  4KLB A;  3N4C A;  1CPJ A;  4OEM A;  2FYE A;  4D8I A;  3O1G A;  2DC7 A;  1CVZ A;  2AIM A;  1K3B B;  2R9C A;  4IUM A;  1EWL A;  1QXP A;  1ME3 A;  1ZIV A;  1TU6 A;  2YJ8 A;  1TL9 A;  4N4Z A;  3P5V A;  3F75 A;  2FTD A;  3CBJ A;  3U8E A;  1ITO A;  2FE8 A;  1VSN A;  3PW3 A;  4HXD B;  4Q8H A;  4G54 A;  2G6D A;  1PE6 A;  2R9N A;  3PHU A;  2F1G A;  2JTC A;  2PRE A;  2R9M A;  4I04 A;  5F02 A;  5JZE A;  3KSE A;  1F29 A;  4P6E A;  4W5C A;  8PCH A;  2PAD A;  4BS5 A;  1TLO A;  4RF1 A;  5CHT A;  3KWZ A;  3MOR A;  4P16 A;  1M6D A;  3RVW A;  1NB5 A;  3AI8 A;  3IFU A;  3DF0 A;  1U9X A;  4R3D A;  2DZY A;  3KX1 A;  2G7Y A;  4QBB A;  1XKG A;  1MDW A;  4OW0 A;  1THE A;  4QH6 A;  4BOS A;  4MM3 B;  3KKU A;  4I05 A;  3O0U A;  2BTW B;  1X9Y A;  3IUT A;  1DEU A;  5KO3 A;  2VHF A;  3TMP A;  4DMY A;  1O0E A;  1FH0 A;  2DZZ A;  3BPM A;  3KFQ A;  3IEJ A;  2AYN A;  4YYW A;  2HHN A;  5E6J A;  3OIS A;  2JQF R;  1DF0 A;  1AU2 A;  3BCN A;  4BOP A;  4GUA A;  1SP4 B;  3PHW A;  4FIP A;  1U9V A;  1PIP A;  4RNA A;  2CB5 A;  2Y6E A;  4MZS A;  4PP1 A;  2DJF B;  2XU5 A;  1MHW A;  2ARY A;  2FUD A;  1EF7 A;  2PBH A;  4YYQ A;  2DJG B;  5J94 A;  2P7U A;  2NQD B;  3TRK A;  2R6N A;  3PRP A;  3W31 A;  2HWK A;  3HD3 A;  3M99 A;  3WXE A;  3NHE A;  3I06 A;  7PCK A;  2FRQ A;  2E02 A;  1ICF A;  2DCA A;  2YJ9 A;  2NQI A;  3PDF A;  1EWM A;  2E00 A;  4OVZ B;  2AYO A;  4X6H A;  2G8E A;  4P6G A;  2FT2 A;  4N8W A;  2GHU A;  4BOU A;  2J7Q A;  2G8J A;  3E9S A;  2E01 A;  4N79 A;  3KWB X;  1BGO A;  1CTE A;  2R9O A;  1MEM A;  3MTN A;  4HWY A;  5EGW A;  3BWK A;  2FRA A;  2Y5B A;  1ZCM A;  2R9F A;  2YJC A;  2GFO A;  3HWN A;  5CHV A;  3TNX A;  9PAP A;  1U5I A;  1AU0 A;  4MZO A;  5EZS A;  2XU1 A;  2DCC A;  4QRX A;  2AUZ A;  1BY8 A;  1QMY A;  4BS6 A;  3OVX A;  3BOW A;  4M0W A;  1Q6K A;  2HXZ A;  4WA6 A;  1KHQ A;  4W4U A;  1GLO A;  1ATK A;  5CVM A;  3RVV A;  2FQ9 A;  4YYS A;  5EZQ A;  1F2A A;  2AVW A;  2AU1 A;  2J7Q C;  2WBF X;  1S4V A;  3V6E A;  2XU4 A;  1NL6 A;  5CVN B;  4BPV A;  4AXL A;  1BQI A;  3P5W A;  3BY4 A;  2DC6 A;  4PT5 A;  3H8C A;  5FPW A;  3ZNH A;  1STF E;  5PAD A;  1CQD A;  3BBA A;  1PAD A;  4PAD A;  4CDE B;  2HD5 A;  2BDL A;  3F5V A;  4K7C A;  3W30 A;  2DCB A;  4REZ A;  3IHP A;  4IP3 A;  4FK5 A;  3B21 A;  3PT2 A;  4CDF B;  2VHS A;  1Y08 A;  4MSX A;  4BQV A;  5A24 A;  2E03 A;  3D6S A;  1AIM A;  5K16 A;  5JH3 A;  3P5X A;  1MIR A;  3GCB A;  3OF9 A;  1GMY A;  3BC3 A;  2AUX A;  4D8B A;  4CZW A;  1A6R A;  3CBK A;  1KHP A;  3RNV A;  3C0R A;  1PBH A;  2IBI A;  2B1N A;  2C0Y A;  4WUR A;  3QT4 A;  1QOL A;  1POP A;  3ERV A;  4CDD B;  3LXS A;  4X6I A;  1HUC B;  3K8U A;  1CB5 A;  3MTV A;  3O65 A;  3OF8 A;  2JRI A;  4AXM A;  1UKF A;  4BSQ A;  2NQG A;  1NB3 A;  2BDZ A;  1F2B A;  4DMX A;  1NQC A;  2P86 A;  3S3Q A;  2CIO A;  4BOZ A;  1EWO A;  1JQP A;  3PNR A;  1Y4H A;  2OUL A;  2ATO A;  2YJB A;  1AEC A;  1AYW A;  4QRV A;  3WXG A;  3HHI A;  3N3G A;  1GEC E;  1PCI A;  2XU3 A;  3PBH A;  2Z84 A;  3BB7 A;  1YT7 A;  4BOQ A;  1U9W A;  1KXR A;  1SNK A;  4OEL A;  3RVX A;  3USV A;  2UZJ A;  1BP4 A;  1DKI A;  3K24 A;  3PSE A;  4W5B A;  2P0R A;  2OP3 A;  4RY2 A;  1CJL A;  1U9Q X;  3N3K A;  3IMA A;  3WXF A;  3MHS A;  3OQC A;  1AYU A;  1PPN A;  2O6X A;  1AU3 A;  1ME4 A;  3IV2 A;  2DOS A;  1PPP A;  4YYU A;  2YJ2 A;  5JA7 A;  1CS8 A;  1QDQ A;  2DC9 A;  3E1Z B;  1PXV A;  1F2C A;  3MJ5 A;  1MEG A;  3BPF A; 
#chains in the Genus database with same CATH homology
 1NPZ A;  3CH2 X;  1W6F A;  1MS6 A;  1NLJ A;  1AYV A;  1YAL A;  2H7J A;  1EWP A;  3IOQ A;  1YVB A;  2JQG R;  2ACT A;  3H7D A;  3S3R A;  1KFX L;  2F7D A;  4FJC A;  3C9E A;  3QSD A;  4QRG A;  2HH5 A;  2PNS A;  2DC8 A;  2IPP B;  1CSB B;  3H8B A;  1YK8 A;  4CDC B;  3QJ3 A;  5CVO B;  3I3T A;  4Q8G A;  4XR7 A;  3HHA A;  3OVZ A;  3LTW A;  4YYR A;  4PP2 E;  4YV8 A;  4YVA A;  3CH3 X;  2B1M A;  4I07 A;  3LFY A;  4PI3 A;  2DCD A;  5EF4 A;  3MHH A;  1GCB A;  2NQA A;  2OZ2 A;  4X6J A;  4XUI A;  1AU4 A;  4ZUX U;  1PPD A;  2VFC A;  3H6S A;  1IWD A;  1YK7 A;  2AS8 A;  2FO5 A;  4BGF A;  3ZUA A;  3V6C A;  3B79 A;  3K9M A;  3H89 A;  3P5U A;  4NV8 A;  4YYV A;  1KFU L;  3KW9 A;  6PAD A;  1VJV A;  1PPO A;  1CV8 A;  4KLB A;  3N4C A;  1CPJ A;  4OEM A;  2FYE A;  3O1G A;  2DC7 A;  1CVZ A;  2AIM A;  1K3B B;  2R9C A;  1EWL A;  1QXP A;  1ME3 A;  1ZIV A;  1TU6 A;  2YJ8 A;  1TL9 A;  4N4Z A;  3P5V A;  3F75 A;  2FTD A;  3CBJ A;  3U8E A;  1ITO A;  1VSN A;  3PW3 A;  4Q8H A;  4G54 A;  2G6D A;  1PE6 A;  2R9N A;  2BSZ A;  2F1G A;  2PRE A;  2R9M A;  4I04 A;  5F02 A;  1W4T A;  3KSE A;  1F29 A;  4P6E A;  4W5C A;  8PCH A;  2PAD A;  4BS5 A;  1TLO A;  5CHT A;  3KWZ A;  3MOR A;  1M6D A;  3RVW A;  1NB5 A;  3AI8 A;  3DF0 A;  1U9X A;  2DZY A;  3KX1 A;  2G7Y A;  4QBB A;  1XKG A;  1MDW A;  1THE A;  4QH6 A;  3KKU A;  4I05 A;  3O0U A;  1X9Y A;  3IUT A;  1DEU A;  2VHF A;  1W5R A;  4DMY A;  1O0E A;  1FH0 A;  2DZZ A;  3BPM A;  3KFQ A;  3IEJ A;  2AYN A;  4YYW A;  2HHN A;  3OIS A;  2JQF R;  1DF0 A;  1AU2 A;  3BCN A;  1SP4 B;  4FIP A;  1U9V A;  1PIP A;  2CB5 A;  2Y6E A;  4MZS A;  4PP1 A;  2DJF B;  2XU5 A;  1MHW A;  2ARY A;  2FUD A;  1EF7 A;  2PBH A;  4YYQ A;  2DJG B;  5J94 A;  2P7U A;  2NQD B;  2R6N A;  3HD3 A;  3M99 A;  3WXE A;  1E2T A;  3NHE A;  3I06 A;  7PCK A;  2FRQ A;  2E02 A;  1ICF A;  2DCA A;  2YJ9 A;  2NQI A;  3PDF A;  1EWM A;  2E00 A;  2AYO A;  4X6H A;  2G8E A;  4P6G A;  2FT2 A;  4N8W A;  2GHU A;  2G8J A;  2E01 A;  4N79 A;  3KWB X;  1BGO A;  1CTE A;  2R9O A;  1MEM A;  3MTN A;  4HWY A;  5EGW A;  3BWK A;  2FRA A;  4C5P A;  4GUZ A;  2Y5B A;  1ZCM A;  2R9F A;  2YJC A;  2GFO A;  3HWN A;  5CHV A;  3TNX A;  9PAP A;  1U5I A;  1AU0 A;  4NV7 A;  4MZO A;  2XU1 A;  2DCC A;  4QRX A;  2AUZ A;  1BY8 A;  1QMY A;  4BS6 A;  3OVX A;  3BOW A;  3D9W A;  1Q6K A;  2HXZ A;  4WA6 A;  1KHQ A;  4W4U A;  1GLO A;  1ATK A;  5CVM A;  3RVV A;  2FQ9 A;  4YYS A;  1F2A A;  2AVW A;  2AU1 A;  2WBF X;  1S4V A;  3V6E A;  2XU4 A;  1NL6 A;  5CVN B;  4BPV A;  4AXL A;  1BQI A;  3P5W A;  2DC6 A;  3H8C A;  5FPW A;  1STF E;  5PAD A;  1CQD A;  1PAD A;  4PAD A;  4CDE B;  2HD5 A;  2BDL A;  3F5V A;  4K7C A;  2DCB A;  3IHP A;  4FK5 A;  4CDF B;  2VHS A;  1Y08 A;  4MSX A;  4BQV A;  5A24 A;  2E03 A;  3D6S A;  1AIM A;  5K16 A;  5JH3 A;  3P5X A;  1MIR A;  3GCB A;  3OF9 A;  1GMY A;  3BC3 A;  2AUX A;  4CZW A;  1A6R A;  3CBK A;  1KHP A;  1PBH A;  2IBI A;  2B1N A;  2C0Y A;  3QT4 A;  1QOL A;  1POP A;  3ERV A;  4CDD B;  3LXS A;  4X6I A;  1HUC B;  3K8U A;  1CB5 A;  3OF8 A;  4AXM A;  4BSQ A;  2NQG A;  1NB3 A;  2BDZ A;  1F2B A;  4DMX A;  1NQC A;  2P86 A;  1GX3 A;  3S3Q A;  2CIO A;  1EWO A;  1JQP A;  3PNR A;  1Y4H A;  2OUL A;  2ATO A;  2YJB A;  1AEC A;  1AYW A;  4QRV A;  3WXG A;  3HHI A;  3N3G A;  1GEC E;  1PCI A;  2XU3 A;  3PBH A;  1YT7 A;  1U9W A;  1KXR A;  1SNK A;  4OEL A;  3RVX A;  3USV A;  1BP4 A;  3K24 A;  4W5B A;  2VFB A;  2P0R A;  2OP3 A;  4RY2 A;  1CJL A;  1U9Q X;  3N3K A;  3IMA A;  3WXF A;  3MHS A;  1AYU A;  1PPN A;  2O6X A;  1AU3 A;  1ME4 A;  3IV2 A;  1PPP A;  4YYU A;  2YJ2 A;  5JA7 A;  4B55 A;  1CS8 A;  1QDQ A;  2DC9 A;  3E1Z B;  1PXV A;  1F2C A;  1MEG A;  3BPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...