1MS6A

Dipeptide nitrile inhibitor bound to cathepsin s.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title Design and synthesis of dipeptide nitriles as reversible and potent Cathepsin S inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ms6A00
2YJ8A 3HHAA 7PCKA 3OISA 2DCBA 1GECE 1YVBA 3QJ3A 3RVVA 3RVXA 3PNRA 3ZUAA 4FJCA 3BPMA 1POPA 3BPFA 1STFE 1AU2A 1BY8A 1F2BA 1AIMA 5J94A 2F1GA 8PCHA 3H7DA 3E1ZB 2ATOA 1YK7A 1DF0A 1TL9A 1K3BB 3B79A 2R9OA 4BS6A 3MTNA 1SP4B 5JH3A 1AU0A 1PCIA 1U9XA 1PPNA 1GLOA 3CH3X 5CVNB 3WXGA 1ATKA 2YJCA 2XU1A 3IOQA 4QBBA 4DMYA 3USVA 3V6EA 6PADA 1CVZA 1BQIA 3N3KA 4QRGA 2OP3A 2XU4A 2NQIA 3TNXA 5F02A 1QMYA 2DC9A 3P5UA 1MHWA 3I3TA 3WXEA 1PIPA 3KWBX 4PP1A 4PADA 1EWOA 1Y4HA 1U9QX 4ZUXU 9PAPA 4I07A 1Y08A 5EGWA 3N4CA 2DZYA 3BWKA 4KLBA 2P0RA 2P7UA 3BOWA 1ITOA 3CH2X 1CQDA 4OEMA 2E00A 2DJGB 1YT7A 4YYSA 4N4ZA 1GMYA 3IUTA 3H6SA 4X6IA 3F75A 2WBFX 5EF4A 3KX1A 1PPOA 2JQFR 2PREA 2G8EA 2OZ2A 4W4UA 1NPZA 4DMXA 4BSQA 1O0EA 1JQPA 1PPDA 3HHIA 2FO5A 3H8BA 2VHSA 1VSNA 4W5BA 1CTEA 1M6DA 1NB3A 3BC3A 1NQCA 4CDEB 3M99A 1A6RA 3IEJA 1KXRA 3IHPA 3WXFA 4YV8A 1ME4A 4YVAA 1VJVA 2AIMA 1QDQA 2B1NA 1PBHA 2YJ9A 2XU5A 4CDFB 2R9MA 5CVMA 3KSEA 3ERVA 1HUCB 2GFOA 3HWNA 1AYVA 4I05A 2C0YA 2P86A 1DEUA 3DF0A 4WA6A 1MEMA 1ZIVA 4AXLA 3GCBA 3S3QA 2DC8A 1ME3A 1KFXL 1CJLA 2BDZA 2FUDA 4BS5A 2G8JA 2FTDA 4YYRA 4BPVA 3NHEA 2G6DA 2YJ2A 3P5VA 1X9YA 5K16A 3LXSA 2JQGR 2IPPB 1MS6A 2R6NA 2E03A 2AS8A 3PDFA 1BGOA 2G7YA 4CDCB 3K8UA 3OF9A 2DZZA 2R9NA 2H7JA 4K7CA 3CBJA 1U9WA 4XR7A 4G54A 2XU3A 3QSDA 2IBIA 1QXPA 1CSBB 1MEGA 1XKGA 2DCAA 4XUIA 3CBKA 4X6HA 5JA7A 2AYOA 1MIRA 4RY2A 2CB5A 2OULA 2F7DA 1SNKA 2DCDA 2E02A 2R9CA 3O1GA 3RVWA 1Q6KA 4MZOA 1YALA 3I06A 2FYEA 2FT2A 2BDLA 2PBHA 5CHTA 4I04A 3PW3A 3K9MA 1EWMA 2AU1A 4CZWA 1KFUL 3U8EA 1ICFA 1FH0A 3QT4A 4OELA 1BP4A 2DC7A 2AUXA 1YK8A 1PPPA 1S4VA 3IV2A 3KWZA 4W5CA 4YYQA 4Q8GA 2AVWA 1EF7A 4N8WA 3HD3A 2FRQA 3OVZA 3BCNA 2HD5A 1THEA 2B1MA 2CIOA 2GHUA 3H89A 2Y5BA 1CV8A 1F29A 2NQDB 4CDDB 3V6CA 1QOLA 3F5VA 4X6JA 5PADA 1TLOA 1AYWA 5FPWA 4MZSA 3H8CA 3P5WA 3MHHA 4FIPA 3K24A 2DCCA 4QH6A 3LFYA 3OVXA 2ARYA 3KFQA 1U9VA 3MORA 1EWPA 1U5IA 4FK5A 2YJBA 1CPJA 1GCBA 3P5XA 2AUZA 2NQGA 2DJFB 4BQVA 1PADA 3KW9A 3MHSA 4Q8HA 4YYUA 1KHQA 2E01A 4QRXA 3KKUA 3PBHA 3S3RA 1PE6A 3N3GA 1ZCMA 1KHPA 1AU3A 2VHFA 1NB5A 4YYWA 4P6EA 1AYUA 1MDWA 5CVOB 3OF8A 4PI3A 2DC6A 1IWDA 1CS8A 2HXZA 1NLJA 4P6GA 3O0UA 2O6XA 2NQAA 4HWYA 1F2AA 2HHNA 2R9FA 3AI8A 4AXMA 2FRAA 1CB5A 4N79A 1AECA 2PADA 5CHVA 2AYNA 1PXVA 2HH5A 4QRVA 2FQ9A 1TU6A 3C9EA 1NL6A 1F2CA 4PP2E 4MSXA 3IMAA 2Y6EA 3D6SA 2PNSA 4YYVA 5A24A 1EWLA 2ACTA 1AU4A
chains in the Genus database with same CATH superfamily
2YJ8A 3HHAA 7PCKA 3ZNHA 3OISA 2DCBA 1GECE 4BOSA 1YVBA 3QJ3A 3RVVA 3RVXA 3PNRA 3ZUAA 4FJCA 2DOSA 3BPMA 1POPA 3BPFA 1STFE 1AU2A 4PT5A 1BY8A 1F2BA 2BTWB 1AIMA 5J94A 4BOQA 2F1GA 8PCHA 3H7DA 3E1ZB 2ATOA 4P16A 1YK7A 1DF0A 1TL9A 1K3BB 4HXDB 3B79A 2R9OA 4BS6A 4WURA 3MTNA 1SP4B 5JH3A 1PVJA 4ZTBA 1AU0A 1PCIA 1U9XA 1PPNA 1GLOA 3CH3X 5CVNB 3WXGA 1ATKA 2YJCA 2XU1A 3IOQA 4QBBA 4DMYA 3MP2A 3USVA 3V6EA 3RNVA 6PADA 1CVZA 1BQIA 3N3KA 3B21A 4QRGA 2FE8A 2OP3A 2XU4A 2JTCA 2NQIA 3PRPA 5KO3A 3TNXA 3PSEA 5F02A 1QMYA 2DC9A 3P5UA 1MHWA 3I3TA 3WXEA 1PIPA 3KWBX 4PP1A 4PADA 1EWOA 1Y4HA 1U9QX 4GUAA 4ZUXU 3BB7A 9PAPA 4I07A 3TRKA 1Y08A 5EGWA 3N4CA 2DZYA 3BWKA 4KLBA 2HWKA 2P0RA 2P7UA 3BOWA 1YZBA 1ITOA 3CH2X 1CQDA 4OEMA 3OQCA 2E00A 2DJGB 1YT7A 4YYSA 4N4ZA 4D8IA 3MTVA 1GMYA 3IUTA 3H6SA 4X6IA 3F75A 2WBFX 5EF4A 3KX1A 1PPOA 2J7QC 2JQFR 2PREA 2G8EA 2OZ2A 4W4UA 1NPZA 4DMXA 4BSQA 1O0EA 3W31A 1JQPA 1PPDA 3HHIA 2FO5A 3H8BA 2VHSA 2AGAA 1VSNA 3MJ5A 4W5BA 1CTEA 1M6DA 1NB3A 3BC3A 1NQCA 4CDEB 3M99A 1A6RA 3IEJA 1KXRA 3IHPA 3WXFA 4YV8A 1ME4A 4YVAA 1VJVA 2AIMA 1QDQA 2B1NA 1PBHA 2YJ9A 2XU5A 4CDFB 5E6JA 3PHUA 5EZQA 2R9MA 5CVMA 3KSEA 4IUMA 3ERVA 1HUCB 2GFOA 3HWNA 1AYVA 4I05A 4OW0A 3BBAA 2C0YA 2P86A 1DEUA 3DF0A 4WA6A 1MEMA 1ZIVA 4AXLA 3GCBA 3S3QA 2DC8A 1ME3A 1KFXL 1CJLA 2BDZA 2FUDA 4BS5A 2G8JA 2JRIA 2FTDA 4YYRA 4BPVA 3NHEA 2G6DA 2YJ2A 3P5VA 1X9YA 5K16A 4OVZB 4IP3A 3LXSA 2JQGR 2IPPB 1MS6A 2R6NA 2E03A 2BU3A 2AS8A 4M0WA 4D8EA 3PDFA 1BGOA 2G7YA 4CDCB 3K8UA 3OF9A 2DZZA 2R9NA 2H7JA 4K7CA 3CBJA 1U9WA 4XR7A 4G54A 4RNAA 3PHXA 2XU3A 3QSDA 2IBIA 1QXPA 1CSBB 1MEGA 1XKGA 2DCAA 4XUIA 3CBKA 4X6HA 5JA7A 2AYOA 1MIRA 3BY4A 4RY2A 2CB5A 2OULA 4BOUA 2F7DA 1SNKA 3PT2A 2DCDA 2E02A 2R9CA 3O1GA 3RVWA 4BOPA 1Q6KA 4MZOA 1YALA 3I06A 2FYEA 4RKXA 2FT2A 1UKFA 2BDLA 2PBHA 5CHTA 4I04A 3PW3A 3K9MA 1EWMA 2AU1A 4CZWA 1KFUL 3U8EA 1ICFA 1FH0A 4OVZA 3QT4A 4OELA 1BP4A 2DC7A 2AUXA 4A5UA 1YK8A 4R3DA 1PPPA 1S4VA 4RF0A 3IV2A 3KWZA 4MI7A 4W5CA 4YYQA 4Q8GA 2AVWA 5EZSA 1EF7A 4N8WA 3HD3A 2FRQA 3OVZA 3BCNA 2HD5A 1THEA 2B1MA 2CIOA 2GHUA 3H89A 2Y5BA 1CV8A 1F29A 2NQDB 4CDDB 3V6CA 1QOLA 3F5VA 4X6JA 5PADA 1TLOA 3W30A 1AYWA 5FPWA 4BOZA 4MZSA 3H8CA 3P5WA 3MHHA 4FIPA 3K24A 2DCCA 2J7QA 4QH6A 3LFYA 3OVXA 1DKIA 4RF1A 2ARYA 3KFQA 2UZJA 1U9VA 4D8BA 2Z84A 1EWPA 1U5IA 3MORA 4FK5A 4REZA 2YJBA 1CPJA 1GCBA 3P5XA 2AUZA 2NQGA 2DJFB 4BQVA 1PADA 3KW9A 3MHSA 4Q8HA 4YYUA 1KHQA 3PRMA 2E01A 4QRXA 3KKUA 3PBHA 3S3RA 1PE6A 3N3GA 1ZCMA 3IFUA 1KHPA 1AU3A 3C0RA 2VHFA 1NB5A 4YYWA 4P6EA 1AYUA 1MDWA 5CVOB 3OF8A 4PI3A 2DC6A 1IWDA 1CS8A 4XZXA 2HXZA 3E9SA 1NLJA 4P6GA 3O0UA 2O6XA 4MM3B 2NQAA 2BTWA 4HWYA 1F2AA 2HHNA 2R9FA 3AI8A 4AXMA 2FRAA 1CB5A 5JZEA 4N79A 1AECA 2PADA 5CHVA 2AYNA 1PXVA 2HH5A 4QRVA 2FQ9A 3TMPA 1TU6A 3C9EA 1NL6A 3O65A 1F2CA 4PP2E 4MSXA 3IMAA 3PHWA 2Y6EA 3D6SA 2PNSA 4YYVA 5A24A 1EWLA 2ACTA 1AU4A
chains in the Genus database with same CATH topology
2YJ8A 3HHAA 7PCKA 3OISA 2DCBA 1GECE 1YVBA 3QJ3A 3RVVA 3RVXA 3PNRA 3ZUAA 4FJCA 3BPMA 1POPA 3BPFA 1STFE 1AU2A 1BY8A 1F2BA 1AIMA 5J94A 2F1GA 8PCHA 3H7DA 3E1ZB 2ATOA 4NV8A 1YK7A 1DF0A 1TL9A 1K3BB 3B79A 2R9OA 4BS6A 3MTNA 1SP4B 5JH3A 1AU0A 1PCIA 1U9XA 1PPNA 1GLOA 3CH3X 5CVNB 3WXGA 1ATKA 2YJCA 2XU1A 3IOQA 4QBBA 4DMYA 1W6FA 3USVA 3V6EA 6PADA 1CVZA 1BQIA 3N3KA 4QRGA 2OP3A 2XU4A 2NQIA 3TNXA 5F02A 1QMYA 2DC9A 4B55A 3P5UA 1W4TA 1MHWA 3I3TA 3WXEA 1PIPA 3KWBX 4PP1A 4PADA 1EWOA 1Y4HA 1U9QX 4ZUXU 9PAPA 4I07A 1Y08A 5EGWA 3N4CA 2DZYA 3BWKA 4KLBA 2P0RA 2P7UA 3BOWA 1ITOA 3CH2X 1CQDA 4OEMA 2E00A 2DJGB 1YT7A 4YYSA 4N4ZA 1GMYA 3IUTA 3H6SA 4X6IA 3F75A 2WBFX 5EF4A 3KX1A 1PPOA 2JQFR 2PREA 2G8EA 2OZ2A 4W4UA 1NPZA 4DMXA 4BSQA 1O0EA 1JQPA 1PPDA 3HHIA 2FO5A 3H8BA 2VHSA 1VSNA 4W5BA 1CTEA 1M6DA 1NB3A 3BC3A 1NQCA 4CDEB 3M99A 1A6RA 3IEJA 1KXRA 3IHPA 3WXFA 4YV8A 1ME4A 4YVAA 1VJVA 2AIMA 1QDQA 2B1NA 1PBHA 2YJ9A 2XU5A 4CDFB 4GUZA 2R9MA 5CVMA 3KSEA 3ERVA 1HUCB 2GFOA 3HWNA 1AYVA 4I05A 2C0YA 2P86A 1DEUA 3DF0A 4WA6A 1MEMA 1ZIVA 4AXLA 3GCBA 3S3QA 2DC8A 1ME3A 1KFXL 1CJLA 2BDZA 2FUDA 4BS5A 2G8JA 2FTDA 4YYRA 4BPVA 3NHEA 2G6DA 2YJ2A 3P5VA 1X9YA 5K16A 3LXSA 2JQGR 2IPPB 1MS6A 3LTWA 2R6NA 2E03A 2AS8A 3PDFA 1BGOA 2G7YA 4CDCB 3K8UA 3OF9A 2DZZA 2R9NA 2H7JA 4K7CA 3CBJA 1U9WA 4XR7A 4G54A 2XU3A 3QSDA 2IBIA 1QXPA 1CSBB 1MEGA 2BSZA 1XKGA 2DCAA 4XUIA 3CBKA 4X6HA 5JA7A 2AYOA 1MIRA 4RY2A 2CB5A 2OULA 2F7DA 1SNKA 2DCDA 2E02A 2R9CA 3O1GA 3RVWA 1Q6KA 4MZOA 1YALA 3I06A 2FYEA 2FT2A 1E2TA 2BDLA 2PBHA 5CHTA 4I04A 3PW3A 3K9MA 1EWMA 2AU1A 4CZWA 1KFUL 3U8EA 1ICFA 1FH0A 3QT4A 4OELA 1BP4A 2DC7A 2AUXA 1YK8A 1PPPA 1S4VA 3IV2A 3KWZA 4W5CA 4YYQA 4Q8GA 2AVWA 1EF7A 4N8WA 3HD3A 2FRQA 3OVZA 3BCNA 2HD5A 1THEA 2B1MA 2CIOA 2GHUA 3H89A 2Y5BA 1CV8A 1F29A 2NQDB 4CDDB 3V6CA 1QOLA 3F5VA 4X6JA 5PADA 1TLOA 1AYWA 5FPWA 4MZSA 3H8CA 3P5WA 3MHHA 4FIPA 3K24A 2DCCA 4QH6A 3LFYA 3OVXA 4NV7A 2ARYA 3KFQA 1U9VA 3MORA 1EWPA 1U5IA 4FK5A 2YJBA 1CPJA 1GCBA 3P5XA 2AUZA 2NQGA 2DJFB 4BQVA 1PADA 3KW9A 3MHSA 4Q8HA 4YYUA 1KHQA 2E01A 4QRXA 3KKUA 3PBHA 3S3RA 1PE6A 3N3GA 1ZCMA 1KHPA 1AU3A 2VHFA 1NB5A 1W5RA 4YYWA 4P6EA 1AYUA 1MDWA 5CVOB 3OF8A 2VFCA 1GX3A 4PI3A 2DC6A 1IWDA 1CS8A 2HXZA 1NLJA 4P6GA 3O0UA 2O6XA 2NQAA 4HWYA 2VFBA 1F2AA 2HHNA 2R9FA 3AI8A 4AXMA 2FRAA 1CB5A 4N79A 1AECA 2PADA 5CHVA 2AYNA 1PXVA 3D9WA 2HH5A 4QRVA 2FQ9A 1TU6A 3C9EA 1NL6A 1F2CA 4PP2E 4MSXA 3IMAA 2Y6EA 4C5PA 3D6SA 2PNSA 4YYVA 5A24A 4BGFA 1EWLA 2ACTA 1AU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ8 A;  3HHA A;  7PCK A;  3OIS A;  2DCB A;  1GEC E;  1YVB A;  3QJ3 A;  3RVV A;  3RVX A;  3PNR A;  3ZUA A;  4FJC A;  3BPM A;  1POP A;  3BPF A;  1STF E;  1AU2 A;  1BY8 A;  1F2B A;  1AIM A;  5J94 A;  2F1G A;  8PCH A;  3H7D A;  3E1Z B;  2ATO A;  1YK7 A;  1DF0 A;  1TL9 A;  1K3B B;  3B79 A;  2R9O A;  4BS6 A;  3MTN A;  1SP4 B;  5JH3 A;  1AU0 A;  1PCI A;  1U9X A;  1PPN A;  1GLO A;  3CH3 X;  5CVN B;  3WXG A;  1ATK A;  2YJC A;  2XU1 A;  3IOQ A;  4QBB A;  4DMY A;  3USV A;  3V6E A;  6PAD A;  1CVZ A;  1BQI A;  3N3K A;  4QRG A;  2OP3 A;  2XU4 A;  2NQI A;  3TNX A;  5F02 A;  1QMY A;  2DC9 A;  3P5U A;  1MHW A;  3I3T A;  3WXE A;  1PIP A;  3KWB X;  4PP1 A;  4PAD A;  1EWO A;  1Y4H A;  1U9Q X;  4ZUX U;  9PAP A;  4I07 A;  1Y08 A;  5EGW A;  3N4C A;  2DZY A;  3BWK A;  4KLB A;  2P0R A;  2P7U A;  3BOW A;  1ITO A;  3CH2 X;  1CQD A;  4OEM A;  2E00 A;  2DJG B;  1YT7 A;  4YYS A;  4N4Z A;  1GMY A;  3IUT A;  3H6S A;  4X6I A;  3F75 A;  2WBF X;  5EF4 A;  3KX1 A;  1PPO A;  2JQF R;  2PRE A;  2G8E A;  2OZ2 A;  4W4U A;  1NPZ A;  4DMX A;  4BSQ A;  1O0E A;  1JQP A;  1PPD A;  3HHI A;  2FO5 A;  3H8B A;  2VHS A;  1VSN A;  4W5B A;  1CTE A;  1M6D A;  1NB3 A;  3BC3 A;  1NQC A;  4CDE B;  3M99 A;  1A6R A;  3IEJ A;  1KXR A;  3IHP A;  3WXF A;  4YV8 A;  1ME4 A;  4YVA A;  1VJV A;  2AIM A;  1QDQ A;  2B1N A;  1PBH A;  2YJ9 A;  2XU5 A;  4CDF B;  2R9M A;  5CVM A;  3KSE A;  3ERV A;  1HUC B;  2GFO A;  3HWN A;  1AYV A;  4I05 A;  2C0Y A;  2P86 A;  1DEU A;  3DF0 A;  4WA6 A;  1MEM A;  1ZIV A;  4AXL A;  3GCB A;  3S3Q A;  2DC8 A;  1ME3 A;  1KFX L;  1CJL A;  2BDZ A;  2FUD A;  4BS5 A;  2G8J A;  2FTD A;  4YYR A;  4BPV A;  3NHE A;  2G6D A;  2YJ2 A;  3P5V A;  1X9Y A;  5K16 A;  3LXS A;  2JQG R;  2IPP B;  1MS6 A;  2R6N A;  2E03 A;  2AS8 A;  3PDF A;  1BGO A;  2G7Y A;  4CDC B;  3K8U A;  3OF9 A;  2DZZ A;  2R9N A;  2H7J A;  4K7C A;  3CBJ A;  1U9W A;  4XR7 A;  4G54 A;  2XU3 A;  3QSD A;  2IBI A;  1QXP A;  1CSB B;  1MEG A;  1XKG A;  2DCA A;  4XUI A;  3CBK A;  4X6H A;  5JA7 A;  2AYO A;  1MIR A;  4RY2 A;  2CB5 A;  2OUL A;  2F7D A;  1SNK A;  2DCD A;  2E02 A;  2R9C A;  3O1G A;  3RVW A;  1Q6K A;  4MZO A;  1YAL A;  3I06 A;  2FYE A;  2FT2 A;  2BDL A;  2PBH A;  5CHT A;  4I04 A;  3PW3 A;  3K9M A;  1EWM A;  2AU1 A;  4CZW A;  1KFU L;  3U8E A;  1ICF A;  1FH0 A;  3QT4 A;  4OEL A;  1BP4 A;  2DC7 A;  2AUX A;  1YK8 A;  1PPP A;  1S4V A;  3IV2 A;  3KWZ A;  4W5C A;  4YYQ A;  4Q8G A;  2AVW A;  1EF7 A;  4N8W A;  3HD3 A;  2FRQ A;  3OVZ A;  3BCN A;  2HD5 A;  1THE A;  2B1M A;  2CIO A;  2GHU A;  3H89 A;  2Y5B A;  1CV8 A;  1F29 A;  2NQD B;  4CDD B;  3V6C A;  1QOL A;  3F5V A;  4X6J A;  5PAD A;  1TLO A;  1AYW A;  5FPW A;  4MZS A;  3H8C A;  3P5W A;  3MHH A;  4FIP A;  3K24 A;  2DCC A;  4QH6 A;  3LFY A;  3OVX A;  2ARY A;  3KFQ A;  1U9V A;  3MOR A;  1EWP A;  1U5I A;  4FK5 A;  2YJB A;  1CPJ A;  1GCB A;  3P5X A;  2AUZ A;  2NQG A;  2DJF B;  4BQV A;  1PAD A;  3KW9 A;  3MHS A;  4Q8H A;  4YYU A;  1KHQ A;  2E01 A;  4QRX A;  3KKU A;  3PBH A;  3S3R A;  1PE6 A;  3N3G A;  1ZCM A;  1KHP A;  1AU3 A;  2VHF A;  1NB5 A;  4YYW A;  4P6E A;  1AYU A;  1MDW A;  5CVO B;  3OF8 A;  4PI3 A;  2DC6 A;  1IWD A;  1CS8 A;  2HXZ A;  1NLJ A;  4P6G A;  3O0U A;  2O6X A;  2NQA A;  4HWY A;  1F2A A;  2HHN A;  2R9F A;  3AI8 A;  4AXM A;  2FRA A;  1CB5 A;  4N79 A;  1AEC A;  2PAD A;  5CHV A;  2AYN A;  1PXV A;  2HH5 A;  4QRV A;  2FQ9 A;  1TU6 A;  3C9E A;  1NL6 A;  1F2C A;  4PP2 E;  4MSX A;  3IMA A;  2Y6E A;  3D6S A;  2PNS A;  4YYV A;  5A24 A;  1EWL A;  2ACT A;  1AU4 A; 
#chains in the Genus database with same CATH topology
 2YJ8 A;  3HHA A;  7PCK A;  3ZNH A;  3OIS A;  2DCB A;  1GEC E;  4BOS A;  1YVB A;  3QJ3 A;  3RVV A;  3RVX A;  3PNR A;  3ZUA A;  4FJC A;  2DOS A;  3BPM A;  1POP A;  3BPF A;  1STF E;  1AU2 A;  4PT5 A;  1BY8 A;  1F2B A;  2BTW B;  1AIM A;  5J94 A;  4BOQ A;  2F1G A;  8PCH A;  3H7D A;  3E1Z B;  2ATO A;  4P16 A;  1YK7 A;  1DF0 A;  1TL9 A;  1K3B B;  4HXD B;  3B79 A;  2R9O A;  4BS6 A;  4WUR A;  3MTN A;  1SP4 B;  5JH3 A;  1PVJ A;  4ZTB A;  1AU0 A;  1PCI A;  1U9X A;  1PPN A;  1GLO A;  3CH3 X;  5CVN B;  3WXG A;  1ATK A;  2YJC A;  2XU1 A;  3IOQ A;  4QBB A;  4DMY A;  3MP2 A;  3USV A;  3V6E A;  3RNV A;  6PAD A;  1CVZ A;  1BQI A;  3N3K A;  3B21 A;  4QRG A;  2FE8 A;  2OP3 A;  2XU4 A;  2JTC A;  2NQI A;  3PRP A;  5KO3 A;  3TNX A;  3PSE A;  5F02 A;  1QMY A;  2DC9 A;  3P5U A;  1MHW A;  3I3T A;  3WXE A;  1PIP A;  3KWB X;  4PP1 A;  4PAD A;  1EWO A;  1Y4H A;  1U9Q X;  4GUA A;  4ZUX U;  3BB7 A;  9PAP A;  4I07 A;  3TRK A;  1Y08 A;  5EGW A;  3N4C A;  2DZY A;  3BWK A;  4KLB A;  2HWK A;  2P0R A;  2P7U A;  3BOW A;  1YZB A;  1ITO A;  3CH2 X;  1CQD A;  4OEM A;  3OQC A;  2E00 A;  2DJG B;  1YT7 A;  4YYS A;  4N4Z A;  4D8I A;  3MTV A;  1GMY A;  3IUT A;  3H6S A;  4X6I A;  3F75 A;  2WBF X;  5EF4 A;  3KX1 A;  1PPO A;  2J7Q C;  2JQF R;  2PRE A;  2G8E A;  2OZ2 A;  4W4U A;  1NPZ A;  4DMX A;  4BSQ A;  1O0E A;  3W31 A;  1JQP A;  1PPD A;  3HHI A;  2FO5 A;  3H8B A;  2VHS A;  2AGA A;  1VSN A;  3MJ5 A;  4W5B A;  1CTE A;  1M6D A;  1NB3 A;  3BC3 A;  1NQC A;  4CDE B;  3M99 A;  1A6R A;  3IEJ A;  1KXR A;  3IHP A;  3WXF A;  4YV8 A;  1ME4 A;  4YVA A;  1VJV A;  2AIM A;  1QDQ A;  2B1N A;  1PBH A;  2YJ9 A;  2XU5 A;  4CDF B;  5E6J A;  3PHU A;  5EZQ A;  2R9M A;  5CVM A;  3KSE A;  4IUM A;  3ERV A;  1HUC B;  2GFO A;  3HWN A;  1AYV A;  4I05 A;  4OW0 A;  3BBA A;  2C0Y A;  2P86 A;  1DEU A;  3DF0 A;  4WA6 A;  1MEM A;  1ZIV A;  4AXL A;  3GCB A;  3S3Q A;  2DC8 A;  1ME3 A;  1KFX L;  1CJL A;  2BDZ A;  2FUD A;  4BS5 A;  2G8J A;  2JRI A;  2FTD A;  4YYR A;  4BPV A;  3NHE A;  2G6D A;  2YJ2 A;  3P5V A;  1X9Y A;  5K16 A;  4OVZ B;  4IP3 A;  3LXS A;  2JQG R;  2IPP B;  1MS6 A;  2R6N A;  2E03 A;  2BU3 A;  2AS8 A;  4M0W A;  4D8E A;  3PDF A;  1BGO A;  2G7Y A;  4CDC B;  3K8U A;  3OF9 A;  2DZZ A;  2R9N A;  2H7J A;  4K7C A;  3CBJ A;  1U9W A;  4XR7 A;  4G54 A;  4RNA A;  3PHX A;  2XU3 A;  3QSD A;  2IBI A;  1QXP A;  1CSB B;  1MEG A;  1XKG A;  2DCA A;  4XUI A;  3CBK A;  4X6H A;  5JA7 A;  2AYO A;  1MIR A;  3BY4 A;  4RY2 A;  2CB5 A;  2OUL A;  4BOU A;  2F7D A;  1SNK A;  3PT2 A;  2DCD A;  2E02 A;  2R9C A;  3O1G A;  3RVW A;  4BOP A;  1Q6K A;  4MZO A;  1YAL A;  3I06 A;  2FYE A;  4RKX A;  2FT2 A;  1UKF A;  2BDL A;  2PBH A;  5CHT A;  4I04 A;  3PW3 A;  3K9M A;  1EWM A;  2AU1 A;  4CZW A;  1KFU L;  3U8E A;  1ICF A;  1FH0 A;  4OVZ A;  3QT4 A;  4OEL A;  1BP4 A;  2DC7 A;  2AUX A;  4A5U A;  1YK8 A;  4R3D A;  1PPP A;  1S4V A;  4RF0 A;  3IV2 A;  3KWZ A;  4MI7 A;  4W5C A;  4YYQ A;  4Q8G A;  2AVW A;  5EZS A;  1EF7 A;  4N8W A;  3HD3 A;  2FRQ A;  3OVZ A;  3BCN A;  2HD5 A;  1THE A;  2B1M A;  2CIO A;  2GHU A;  3H89 A;  2Y5B A;  1CV8 A;  1F29 A;  2NQD B;  4CDD B;  3V6C A;  1QOL A;  3F5V A;  4X6J A;  5PAD A;  1TLO A;  3W30 A;  1AYW A;  5FPW A;  4BOZ A;  4MZS A;  3H8C A;  3P5W A;  3MHH A;  4FIP A;  3K24 A;  2DCC A;  2J7Q A;  4QH6 A;  3LFY A;  3OVX A;  1DKI A;  4RF1 A;  2ARY A;  3KFQ A;  2UZJ A;  1U9V A;  4D8B A;  2Z84 A;  1EWP A;  1U5I A;  3MOR A;  4FK5 A;  4REZ A;  2YJB A;  1CPJ A;  1GCB A;  3P5X A;  2AUZ A;  2NQG A;  2DJF B;  4BQV A;  1PAD A;  3KW9 A;  3MHS A;  4Q8H A;  4YYU A;  1KHQ A;  3PRM A;  2E01 A;  4QRX A;  3KKU A;  3PBH A;  3S3R A;  1PE6 A;  3N3G A;  1ZCM A;  3IFU A;  1KHP A;  1AU3 A;  3C0R A;  2VHF A;  1NB5 A;  4YYW A;  4P6E A;  1AYU A;  1MDW A;  5CVO B;  3OF8 A;  4PI3 A;  2DC6 A;  1IWD A;  1CS8 A;  4XZX A;  2HXZ A;  3E9S A;  1NLJ A;  4P6G A;  3O0U A;  2O6X A;  4MM3 B;  2NQA A;  2BTW A;  4HWY A;  1F2A A;  2HHN A;  2R9F A;  3AI8 A;  4AXM A;  2FRA A;  1CB5 A;  5JZE A;  4N79 A;  1AEC A;  2PAD A;  5CHV A;  2AYN A;  1PXV A;  2HH5 A;  4QRV A;  2FQ9 A;  3TMP A;  1TU6 A;  3C9E A;  1NL6 A;  3O65 A;  1F2C A;  4PP2 E;  4MSX A;  3IMA A;  3PHW A;  2Y6E A;  3D6S A;  2PNS A;  4YYV A;  5A24 A;  1EWL A;  2ACT A;  1AU4 A; 
#chains in the Genus database with same CATH homology
 2YJ8 A;  3HHA A;  7PCK A;  3OIS A;  2DCB A;  1GEC E;  1YVB A;  3QJ3 A;  3RVV A;  3RVX A;  3PNR A;  3ZUA A;  4FJC A;  3BPM A;  1POP A;  3BPF A;  1STF E;  1AU2 A;  1BY8 A;  1F2B A;  1AIM A;  5J94 A;  2F1G A;  8PCH A;  3H7D A;  3E1Z B;  2ATO A;  4NV8 A;  1YK7 A;  1DF0 A;  1TL9 A;  1K3B B;  3B79 A;  2R9O A;  4BS6 A;  3MTN A;  1SP4 B;  5JH3 A;  1AU0 A;  1PCI A;  1U9X A;  1PPN A;  1GLO A;  3CH3 X;  5CVN B;  3WXG A;  1ATK A;  2YJC A;  2XU1 A;  3IOQ A;  4QBB A;  4DMY A;  1W6F A;  3USV A;  3V6E A;  6PAD A;  1CVZ A;  1BQI A;  3N3K A;  4QRG A;  2OP3 A;  2XU4 A;  2NQI A;  3TNX A;  5F02 A;  1QMY A;  2DC9 A;  4B55 A;  3P5U A;  1W4T A;  1MHW A;  3I3T A;  3WXE A;  1PIP A;  3KWB X;  4PP1 A;  4PAD A;  1EWO A;  1Y4H A;  1U9Q X;  4ZUX U;  9PAP A;  4I07 A;  1Y08 A;  5EGW A;  3N4C A;  2DZY A;  3BWK A;  4KLB A;  2P0R A;  2P7U A;  3BOW A;  1ITO A;  3CH2 X;  1CQD A;  4OEM A;  2E00 A;  2DJG B;  1YT7 A;  4YYS A;  4N4Z A;  1GMY A;  3IUT A;  3H6S A;  4X6I A;  3F75 A;  2WBF X;  5EF4 A;  3KX1 A;  1PPO A;  2JQF R;  2PRE A;  2G8E A;  2OZ2 A;  4W4U A;  1NPZ A;  4DMX A;  4BSQ A;  1O0E A;  1JQP A;  1PPD A;  3HHI A;  2FO5 A;  3H8B A;  2VHS A;  1VSN A;  4W5B A;  1CTE A;  1M6D A;  1NB3 A;  3BC3 A;  1NQC A;  4CDE B;  3M99 A;  1A6R A;  3IEJ A;  1KXR A;  3IHP A;  3WXF A;  4YV8 A;  1ME4 A;  4YVA A;  1VJV A;  2AIM A;  1QDQ A;  2B1N A;  1PBH A;  2YJ9 A;  2XU5 A;  4CDF B;  4GUZ A;  2R9M A;  5CVM A;  3KSE A;  3ERV A;  1HUC B;  2GFO A;  3HWN A;  1AYV A;  4I05 A;  2C0Y A;  2P86 A;  1DEU A;  3DF0 A;  4WA6 A;  1MEM A;  1ZIV A;  4AXL A;  3GCB A;  3S3Q A;  2DC8 A;  1ME3 A;  1KFX L;  1CJL A;  2BDZ A;  2FUD A;  4BS5 A;  2G8J A;  2FTD A;  4YYR A;  4BPV A;  3NHE A;  2G6D A;  2YJ2 A;  3P5V A;  1X9Y A;  5K16 A;  3LXS A;  2JQG R;  2IPP B;  1MS6 A;  3LTW A;  2R6N A;  2E03 A;  2AS8 A;  3PDF A;  1BGO A;  2G7Y A;  4CDC B;  3K8U A;  3OF9 A;  2DZZ A;  2R9N A;  2H7J A;  4K7C A;  3CBJ A;  1U9W A;  4XR7 A;  4G54 A;  2XU3 A;  3QSD A;  2IBI A;  1QXP A;  1CSB B;  1MEG A;  2BSZ A;  1XKG A;  2DCA A;  4XUI A;  3CBK A;  4X6H A;  5JA7 A;  2AYO A;  1MIR A;  4RY2 A;  2CB5 A;  2OUL A;  2F7D A;  1SNK A;  2DCD A;  2E02 A;  2R9C A;  3O1G A;  3RVW A;  1Q6K A;  4MZO A;  1YAL A;  3I06 A;  2FYE A;  2FT2 A;  1E2T A;  2BDL A;  2PBH A;  5CHT A;  4I04 A;  3PW3 A;  3K9M A;  1EWM A;  2AU1 A;  4CZW A;  1KFU L;  3U8E A;  1ICF A;  1FH0 A;  3QT4 A;  4OEL A;  1BP4 A;  2DC7 A;  2AUX A;  1YK8 A;  1PPP A;  1S4V A;  3IV2 A;  3KWZ A;  4W5C A;  4YYQ A;  4Q8G A;  2AVW A;  1EF7 A;  4N8W A;  3HD3 A;  2FRQ A;  3OVZ A;  3BCN A;  2HD5 A;  1THE A;  2B1M A;  2CIO A;  2GHU A;  3H89 A;  2Y5B A;  1CV8 A;  1F29 A;  2NQD B;  4CDD B;  3V6C A;  1QOL A;  3F5V A;  4X6J A;  5PAD A;  1TLO A;  1AYW A;  5FPW A;  4MZS A;  3H8C A;  3P5W A;  3MHH A;  4FIP A;  3K24 A;  2DCC A;  4QH6 A;  3LFY A;  3OVX A;  4NV7 A;  2ARY A;  3KFQ A;  1U9V A;  3MOR A;  1EWP A;  1U5I A;  4FK5 A;  2YJB A;  1CPJ A;  1GCB A;  3P5X A;  2AUZ A;  2NQG A;  2DJF B;  4BQV A;  1PAD A;  3KW9 A;  3MHS A;  4Q8H A;  4YYU A;  1KHQ A;  2E01 A;  4QRX A;  3KKU A;  3PBH A;  3S3R A;  1PE6 A;  3N3G A;  1ZCM A;  1KHP A;  1AU3 A;  2VHF A;  1NB5 A;  1W5R A;  4YYW A;  4P6E A;  1AYU A;  1MDW A;  5CVO B;  3OF8 A;  2VFC A;  1GX3 A;  4PI3 A;  2DC6 A;  1IWD A;  1CS8 A;  2HXZ A;  1NLJ A;  4P6G A;  3O0U A;  2O6X A;  2NQA A;  4HWY A;  2VFB A;  1F2A A;  2HHN A;  2R9F A;  3AI8 A;  4AXM A;  2FRA A;  1CB5 A;  4N79 A;  1AEC A;  2PAD A;  5CHV A;  2AYN A;  1PXV A;  3D9W A;  2HH5 A;  4QRV A;  2FQ9 A;  1TU6 A;  3C9E A;  1NL6 A;  1F2C A;  4PP2 E;  4MSX A;  3IMA A;  2Y6E A;  4C5P A;  3D6S A;  2PNS A;  4YYV A;  5A24 A;  4BGF A;  1EWL A;  2ACT A;  1AU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...