1MS6A

Dipeptide nitrile inhibitor bound to cathepsin s.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of dipeptide nitriles as reversible and potent Cathepsin S inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 70
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ms6A00
4XR7A 2DCCA 2E03A 2DJGB 2DC8A 5CVNB 3I3TA 1PCIA 5CVOB 5PADA 1YK8A 4N8WA 2P7UA 3K9MA 7PCKA 1U5IA 3F5VA 1POPA 3RVVA 3HD3A 4X6HA 4CDCB 2FQ9A 3M99A 2HH5A 3B79A 1U9VA 1STFE 1SP4B 2R9MA 3IOQA 2CB5A 4I05A 6PADA 2DC7A 5CVMA 1AIMA 3MORA 2FO5A 2O6XA 4BS6A 4W5CA 3D6SA 4CDEB 3U8EA 4YYVA 1ZIVA 3ERVA 1TL9A 2G8JA 4X6JA 2YJCA 5JH3A 4YYUA 2DCBA 1M6DA 1QDQA 5EGWA 2VHFA 3RVWA 1MHWA 1BY8A 3F75A 3RVXA 1O0EA 2IBIA 4DMYA 9PAPA 3BWKA 2BDZA 3KX1A 3H7DA 1Q6KA 4QRXA 3P5UA 3QJ3A 4CDFB 1F2BA 2YJBA 4P6GA 2PADA 1Y4HA 3USVA 3H8CA 4DMXA 1Y08A 5A24A 2B1NA 1BQIA 1U9WA 2XU4A 1U9XA 1QMYA 1PIPA 1MS6A 2E00A 2AYOA 3CH2X 3N3KA 1CV8A 2H7JA 3AI8A 3OISA 1TU6A 4OEMA 1EF7A 1K3BB 2AS8A 1ME4A 3BC3A 3P5XA 3WXFA 1IWDA 4QRVA 2AUZA 1PADA 1S4VA 2JQGR 4QRGA 4XUIA 2XU5A 2R6NA 3IEJA 4BQVA 1AU2A 5FPWA 2DC9A 2NQGA 1AYWA 4PP2E 4X6IA 1F2AA 2E01A 1ICFA 2AVWA 3HWNA 1SNKA 1BP4A 2FUDA 2OP3A 4KLBA 2P0RA 3CH3X 2R9CA 4OELA 5CHTA 1KFXL 2DZYA 3O1GA 1CB5A 4BS5A 1PE6A 3BOWA 1XKGA 3MHHA 3WXEA 1GLOA 4FJCA 2P86A 1TLOA 4Q8HA 2OZ2A 2R9OA 2WBFX 1KXRA 3BPFA 3PDFA 1CPJA 3IHPA 3PW3A 3K24A 4PP1A 1DF0A 1MEGA 2YJ8A 8PCHA 4N79A 5CHVA 3IV2A 2AYNA 2DZZA 2Y6EA 2VHSA 3BPMA 1THEA 2C0YA 2HXZA 4MSXA 2DCAA 4HWYA 4YV8A 1AU0A 2FT2A 2R9FA 5K16A 1GCBA 1YVBA 1CQDA 3V6CA 2BDLA 1EWMA 3HHAA 4QH6A 1GECE 1MEMA 3LXSA 2Y5BA 3CBJA 5JA7A 1EWLA 1CVZA 2AUXA 1AU4A 3GCBA 5J94A 3KSEA 1ME3A 4FK5A 1FH0A 4YYRA 4ZUXU 3IMAA 1EWOA 2YJ2A 3S3QA 1F2CA 4PADA 1MDWA 1YK7A 1NB5A 1ITOA 2NQAA 2G6DA 4YYWA 3MTNA 3KW9A 3WXGA 1NL6A 2IPPB 3H6SA 3PBHA 2JQFR 3QT4A 2FYEA 3NHEA 4WA6A 2XU3A 3N4CA 4I04A 4W5BA 4G54A 2FRQA 1PBHA 4CDDB 1YALA 3N3GA 1F29A 1BGOA 4RY2A 3IUTA 1QOLA 3V6EA 2XU1A 1ZCMA 1CJLA 4PI3A 1KHPA 4MZOA 2HHNA 2AU1A 1AYUA 1YT7A 3OF9A 4Q8GA 2ACTA 3H8BA 3H89A 2NQDB 4MZSA 1VJVA 2FTDA 4P6EA 4AXMA 1AU3A 1A6RA 3P5WA 4I07A 3TNXA 4W4UA 3O0UA 2HD5A 4YYQA 1NB3A 3ZUAA 4K7CA 3CBKA 2NQIA 2GFOA 1PPDA 4FIPA 1VSNA 1PXVA 2OULA 2PBHA 1CS8A 2GHUA 3KKUA 2YJ9A 3LFYA 1NLJA 2DJFB 1EWPA 4BPVA 3KFQA 2E02A 2F1GA 3C9EA 3KWZA 3DF0A 5F02A 2FRAA 2B1MA 1CTEA 3QSDA 2PREA 3S3RA 3MHSA 3E1ZB 1NQCA 1CSBB 3K8UA 3OVZA 1HUCB 1KFUL 4YVAA 1PPNA 3OVXA 1NPZA 3BCNA 2DC6A 4N4ZA 2G8EA 4YYSA 3OF8A 2R9NA 4CZWA 2DCDA 3HHIA 1AECA 1QXPA 4QBBA 4BSQA 2ARYA 3PNRA 2G7YA 1JQPA 2F7DA 1GMYA 2PNSA 2AIMA 3KWBX 4AXLA 1KHQA 1DEUA 1PPOA 1PPPA 5EF4A 2ATOA 3I06A 2CIOA 1X9YA 1ATKA 1MIRA 3P5VA 1U9QX 1AYVA
chains in the Genus database with same CATH superfamily
4XR7A 2DCCA 2E03A 2DJGB 2DC8A 5CVNB 3I3TA 1PCIA 5CVOB 4BOSA 5PADA 1YK8A 3PHWA 4N8WA 2P7UA 3K9MA 7PCKA 1U5IA 3F5VA 1POPA 3RVVA 3HD3A 4X6HA 4CDCB 2FQ9A 3M99A 2HH5A 3PRMA 3B79A 1U9VA 2JTCA 1STFE 1SP4B 2R9MA 3IOQA 2CB5A 4I05A 4ZTBA 4XZXA 6PADA 2DC7A 5CVMA 1AIMA 3MORA 3W31A 2FO5A 2BU3A 2O6XA 4BS6A 4W5CA 3D6SA 4CDEB 3U8EA 4YYVA 1ZIVA 3ERVA 1TL9A 2G8JA 4X6JA 2YJCA 5JH3A 4YYUA 2DCBA 1M6DA 1QDQA 5EGWA 2VHFA 3RVWA 1MHWA 4OW0A 1BY8A 4P16A 3F75A 3RVXA 1O0EA 2UZJA 2Z84A 4BOUA 2IBIA 3MJ5A 4DMYA 9PAPA 3B21A 3BWKA 3BY4A 5EZQA 2BDZA 4RF1A 3KX1A 3H7DA 1Q6KA 4QRXA 3P5UA 3QJ3A 4CDFB 1F2BA 2AGAA 3BB7A 2YJBA 4P6GA 2PADA 4MM3B 5E6JA 1Y4HA 3USVA 3H8CA 3ZNHA 1Y08A 4DMXA 5A24A 2B1NA 1BQIA 4M0WA 1U9WA 2XU4A 1U9XA 1QMYA 1PIPA 1MS6A 1DKIA 2E00A 2AYOA 3BBAA 3CH2X 3N3KA 1CV8A 2H7JA 3AI8A 3OISA 1TU6A 2JRIA 4OEMA 1EF7A 1K3BB 5KO3A 2AS8A 1ME4A 4RKXA 3BC3A 3P5XA 3WXFA 1IWDA 4QRVA 2AUZA 1PADA 1S4VA 2JQGR 4QRGA 1UKFA 2XU5A 4XUIA 2R6NA 3PSEA 3IEJA 4BQVA 1AU2A 5FPWA 2DC9A 2NQGA 1AYWA 4PP2E 4X6IA 4MI7A 1F2AA 2E01A 1ICFA 2AVWA 3HWNA 1SNKA 1BP4A 2FUDA 2OP3A 4KLBA 3PHXA 2P0RA 3CH3X 2R9CA 4OELA 5CHTA 1KFXL 2DZYA 3O1GA 1CB5A 4BS5A 1PE6A 2J7QA 3BOWA 1XKGA 3MHHA 3WXEA 1GLOA 4FJCA 5EZSA 2P86A 1TLOA 4Q8HA 2OZ2A 2R9OA 2WBFX 1KXRA 3BPFA 3PDFA 1CPJA 3IHPA 3PW3A 3K24A 4PP1A 1DF0A 3O65A 1MEGA 4IP3A 2YJ8A 4BOZA 2J7QC 8PCHA 4N79A 1YZBA 5CHVA 3IV2A 2AYNA 2DZZA 2Y6EA 2VHSA 3BPMA 1THEA 2C0YA 2HXZA 4WURA 4MSXA 2DCAA 4HWYA 4YV8A 1AU0A 2FT2A 2R9FA 5K16A 1GCBA 1YVBA 1CQDA 3V6CA 2BDLA 1EWMA 3HHAA 4QH6A 1GECE 1MEMA 3LXSA 4D8BA 2Y5BA 4D8IA 3CBJA 2DOSA 5JA7A 1EWLA 1CVZA 2AUXA 1AU4A 3GCBA 2HWKA 5J94A 3KSEA 1ME3A 3PHUA 4FK5A 1FH0A 4YYRA 4ZUXU 4PT5A 3IMAA 3MP2A 1EWOA 2YJ2A 3S3QA 1F2CA 4PADA 1MDWA 1YK7A 1NB5A 1ITOA 2NQAA 2G6DA 4YYWA 3TRKA 3MTNA 3KW9A 3WXGA 1NL6A 3E9SA 2IPPB 3H6SA 3PBHA 4BOPA 2JQFR 3QT4A 2FYEA 3NHEA 4WA6A 2XU3A 3N4CA 4I04A 4W5BA 4G54A 2FRQA 1PBHA 4CDDB 1YALA 3N3GA 1F29A 1PVJA 1BGOA 4OVZA 4RY2A 3IUTA 1QOLA 3V6EA 3C0RA 2XU1A 1ZCMA 1CJLA 4PI3A 1KHPA 4MZOA 2HHNA 2AU1A 1AYUA 1YT7A 4R3DA 3OF9A 4Q8GA 2ACTA 3IFUA 3H8BA 2BTWB 3H89A 2NQDB 4MZSA 1VJVA 3OQCA 2FTDA 4P6EA 3W30A 4RNAA 2FE8A 4AXMA 1AU3A 1A6RA 3P5WA 4REZA 3TMPA 4OVZB 4I07A 4W4UA 3TNXA 3O0UA 2HD5A 4YYQA 1NB3A 3ZUAA 4K7CA 3CBKA 2NQIA 2GFOA 1PPDA 4FIPA 1VSNA 1PXVA 2OULA 2PBHA 1CS8A 2GHUA 3KKUA 2YJ9A 3LFYA 3PT2A 1NLJA 4RF0A 2DJFB 1EWPA 4BPVA 3KFQA 2E02A 2F1GA 3C9EA 3KWZA 3DF0A 5F02A 2FRAA 2B1MA 1CTEA 3QSDA 2PREA 3S3RA 3MHSA 3E1ZB 4IUMA 5JZEA 1NQCA 1CSBB 3K8UA 3OVZA 1HUCB 1KFUL 4HXDB 4YVAA 1PPNA 3MTVA 3OVXA 1NPZA 3RNVA 3BCNA 3PRPA 2DC6A 4D8EA 4N4ZA 2G8EA 4YYSA 3OF8A 2R9NA 4CZWA 2DCDA 3HHIA 1AECA 4BOQA 1QXPA 4QBBA 4BSQA 2ARYA 3PNRA 4A5UA 2G7YA 1JQPA 2F7DA 1GMYA 2PNSA 2AIMA 3KWBX 4AXLA 1KHQA 4GUAA 1DEUA 1PPOA 1PPPA 5EF4A 2ATOA 3I06A 2CIOA 1X9YA 1ATKA 1MIRA 3P5VA 2BTWA 1U9QX 1AYVA
chains in the Genus database with same CATH topology
4XR7A 2DCCA 2E03A 2DJGB 2DC8A 5CVNB 3I3TA 1PCIA 5CVOB 5PADA 3LTWA 1YK8A 4N8WA 2P7UA 3K9MA 7PCKA 1U5IA 3F5VA 1POPA 3RVVA 3HD3A 4X6HA 4CDCB 2FQ9A 3M99A 2HH5A 3B79A 1U9VA 1E2TA 1STFE 1SP4B 2R9MA 3IOQA 2CB5A 4I05A 6PADA 1W4TA 2DC7A 5CVMA 1AIMA 3MORA 2FO5A 2O6XA 4BS6A 4W5CA 3D6SA 4CDEB 3U8EA 4YYVA 1ZIVA 3ERVA 1TL9A 2G8JA 4X6JA 2YJCA 5JH3A 4YYUA 2DCBA 1M6DA 1QDQA 5EGWA 2VHFA 3RVWA 1MHWA 1BY8A 3F75A 3RVXA 1O0EA 2IBIA 4DMYA 9PAPA 3BWKA 2BDZA 3KX1A 3H7DA 1Q6KA 4BGFA 4QRXA 3P5UA 3QJ3A 4CDFB 1F2BA 2YJBA 4P6GA 2PADA 1Y4HA 3USVA 3H8CA 4DMXA 1Y08A 5A24A 2B1NA 1BQIA 1U9WA 2XU4A 1U9XA 1QMYA 1PIPA 1MS6A 2E00A 2AYOA 3CH2X 3N3KA 1CV8A 2H7JA 3AI8A 3OISA 1TU6A 4OEMA 1EF7A 1K3BB 2AS8A 1ME4A 4C5PA 3BC3A 3P5XA 3WXFA 1IWDA 3D9WA 4QRVA 2AUZA 1PADA 1S4VA 2JQGR 4QRGA 4XUIA 2XU5A 2R6NA 3IEJA 4BQVA 1AU2A 5FPWA 2DC9A 2NQGA 1AYWA 4PP2E 2VFBA 4X6IA 1F2AA 2E01A 1ICFA 2AVWA 3HWNA 1SNKA 1BP4A 2FUDA 2OP3A 1W5RA 4KLBA 2P0RA 3CH3X 2R9CA 4OELA 5CHTA 1KFXL 2DZYA 3O1GA 1CB5A 4BS5A 1PE6A 3BOWA 1XKGA 3MHHA 3WXEA 1GLOA 4FJCA 2P86A 1TLOA 4Q8HA 2OZ2A 2R9OA 2WBFX 1KXRA 3BPFA 3PDFA 1CPJA 3IHPA 3PW3A 3K24A 4PP1A 1DF0A 1MEGA 2YJ8A 8PCHA 4N79A 5CHVA 3IV2A 2AYNA 2DZZA 2Y6EA 2VHSA 3BPMA 1THEA 2C0YA 2HXZA 4MSXA 2DCAA 4HWYA 4YV8A 1AU0A 2FT2A 2R9FA 5K16A 1GCBA 1YVBA 1CQDA 3V6CA 2BDLA 1EWMA 3HHAA 1GX3A 4QH6A 1GECE 1MEMA 4NV8A 3LXSA 2Y5BA 3CBJA 5JA7A 1EWLA 1CVZA 2AUXA 2VFCA 1AU4A 3GCBA 5J94A 3KSEA 1ME3A 4FK5A 1FH0A 4YYRA 4ZUXU 3IMAA 1EWOA 2YJ2A 3S3QA 1F2CA 4PADA 1MDWA 1YK7A 1NB5A 1ITOA 2NQAA 2G6DA 4YYWA 3MTNA 3KW9A 1W6FA 3WXGA 1NL6A 2IPPB 3H6SA 3PBHA 2JQFR 3QT4A 2FYEA 3NHEA 4WA6A 2XU3A 3N4CA 4I04A 4W5BA 4G54A 2FRQA 1PBHA 4CDDB 1YALA 3N3GA 1F29A 1BGOA 4RY2A 3IUTA 1QOLA 3V6EA 2XU1A 1ZCMA 2BSZA 1CJLA 4PI3A 1KHPA 4MZOA 2HHNA 2AU1A 1AYUA 1YT7A 3OF9A 4Q8GA 2ACTA 3H8BA 3H89A 2NQDB 4MZSA 1VJVA 2FTDA 4P6EA 4AXMA 1AU3A 4NV7A 1A6RA 3P5WA 4I07A 4W4UA 3TNXA 3O0UA 2HD5A 4YYQA 1NB3A 3ZUAA 4K7CA 3CBKA 2NQIA 2GFOA 1PPDA 4FIPA 4GUZA 1VSNA 1PXVA 2OULA 2PBHA 1CS8A 2GHUA 3KKUA 2YJ9A 3LFYA 1NLJA 2DJFB 1EWPA 4BPVA 3KFQA 2E02A 2F1GA 3C9EA 3KWZA 3DF0A 5F02A 2FRAA 2B1MA 1CTEA 3QSDA 2PREA 3S3RA 3MHSA 3E1ZB 1NQCA 1CSBB 3K8UA 3OVZA 1HUCB 1KFUL 4YVAA 1PPNA 3OVXA 1NPZA 3BCNA 2DC6A 4N4ZA 2G8EA 4YYSA 3OF8A 2R9NA 4CZWA 2DCDA 3HHIA 1AECA 1QXPA 4QBBA 4BSQA 2ARYA 3PNRA 4B55A 2G7YA 1JQPA 2F7DA 1GMYA 2PNSA 2AIMA 3KWBX 4AXLA 1KHQA 1DEUA 1PPOA 1PPPA 5EF4A 2ATOA 3I06A 2CIOA 1X9YA 1ATKA 1MIRA 3P5VA 1U9QX 1AYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XR7 A;  2DCC A;  2E03 A;  2DJG B;  2DC8 A;  5CVN B;  3I3T A;  1PCI A;  5CVO B;  5PAD A;  1YK8 A;  4N8W A;  2P7U A;  3K9M A;  7PCK A;  1U5I A;  3F5V A;  1POP A;  3RVV A;  3HD3 A;  4X6H A;  4CDC B;  2FQ9 A;  3M99 A;  2HH5 A;  3B79 A;  1U9V A;  1STF E;  1SP4 B;  2R9M A;  3IOQ A;  2CB5 A;  4I05 A;  6PAD A;  2DC7 A;  5CVM A;  1AIM A;  3MOR A;  2FO5 A;  2O6X A;  4BS6 A;  4W5C A;  3D6S A;  4CDE B;  3U8E A;  4YYV A;  1ZIV A;  3ERV A;  1TL9 A;  2G8J A;  4X6J A;  2YJC A;  5JH3 A;  4YYU A;  2DCB A;  1M6D A;  1QDQ A;  5EGW A;  2VHF A;  3RVW A;  1MHW A;  1BY8 A;  3F75 A;  3RVX A;  1O0E A;  2IBI A;  4DMY A;  9PAP A;  3BWK A;  2BDZ A;  3KX1 A;  3H7D A;  1Q6K A;  4QRX A;  3P5U A;  3QJ3 A;  4CDF B;  1F2B A;  2YJB A;  4P6G A;  2PAD A;  1Y4H A;  3USV A;  3H8C A;  4DMX A;  1Y08 A;  5A24 A;  2B1N A;  1BQI A;  1U9W A;  2XU4 A;  1U9X A;  1QMY A;  1PIP A;  1MS6 A;  2E00 A;  2AYO A;  3CH2 X;  3N3K A;  1CV8 A;  2H7J A;  3AI8 A;  3OIS A;  1TU6 A;  4OEM A;  1EF7 A;  1K3B B;  2AS8 A;  1ME4 A;  3BC3 A;  3P5X A;  3WXF A;  1IWD A;  4QRV A;  2AUZ A;  1PAD A;  1S4V A;  2JQG R;  4QRG A;  4XUI A;  2XU5 A;  2R6N A;  3IEJ A;  4BQV A;  1AU2 A;  5FPW A;  2DC9 A;  2NQG A;  1AYW A;  4PP2 E;  4X6I A;  1F2A A;  2E01 A;  1ICF A;  2AVW A;  3HWN A;  1SNK A;  1BP4 A;  2FUD A;  2OP3 A;  4KLB A;  2P0R A;  3CH3 X;  2R9C A;  4OEL A;  5CHT A;  1KFX L;  2DZY A;  3O1G A;  1CB5 A;  4BS5 A;  1PE6 A;  3BOW A;  1XKG A;  3MHH A;  3WXE A;  1GLO A;  4FJC A;  2P86 A;  1TLO A;  4Q8H A;  2OZ2 A;  2R9O A;  2WBF X;  1KXR A;  3BPF A;  3PDF A;  1CPJ A;  3IHP A;  3PW3 A;  3K24 A;  4PP1 A;  1DF0 A;  1MEG A;  2YJ8 A;  8PCH A;  4N79 A;  5CHV A;  3IV2 A;  2AYN A;  2DZZ A;  2Y6E A;  2VHS A;  3BPM A;  1THE A;  2C0Y A;  2HXZ A;  4MSX A;  2DCA A;  4HWY A;  4YV8 A;  1AU0 A;  2FT2 A;  2R9F A;  5K16 A;  1GCB A;  1YVB A;  1CQD A;  3V6C A;  2BDL A;  1EWM A;  3HHA A;  4QH6 A;  1GEC E;  1MEM A;  3LXS A;  2Y5B A;  3CBJ A;  5JA7 A;  1EWL A;  1CVZ A;  2AUX A;  1AU4 A;  3GCB A;  5J94 A;  3KSE A;  1ME3 A;  4FK5 A;  1FH0 A;  4YYR A;  4ZUX U;  3IMA A;  1EWO A;  2YJ2 A;  3S3Q A;  1F2C A;  4PAD A;  1MDW A;  1YK7 A;  1NB5 A;  1ITO A;  2NQA A;  2G6D A;  4YYW A;  3MTN A;  3KW9 A;  3WXG A;  1NL6 A;  2IPP B;  3H6S A;  3PBH A;  2JQF R;  3QT4 A;  2FYE A;  3NHE A;  4WA6 A;  2XU3 A;  3N4C A;  4I04 A;  4W5B A;  4G54 A;  2FRQ A;  1PBH A;  4CDD B;  1YAL A;  3N3G A;  1F29 A;  1BGO A;  4RY2 A;  3IUT A;  1QOL A;  3V6E A;  2XU1 A;  1ZCM A;  1CJL A;  4PI3 A;  1KHP A;  4MZO A;  2HHN A;  2AU1 A;  1AYU A;  1YT7 A;  3OF9 A;  4Q8G A;  2ACT A;  3H8B A;  3H89 A;  2NQD B;  4MZS A;  1VJV A;  2FTD A;  4P6E A;  4AXM A;  1AU3 A;  1A6R A;  3P5W A;  4I07 A;  3TNX A;  4W4U A;  3O0U A;  2HD5 A;  4YYQ A;  1NB3 A;  3ZUA A;  4K7C A;  3CBK A;  2NQI A;  2GFO A;  1PPD A;  4FIP A;  1VSN A;  1PXV A;  2OUL A;  2PBH A;  1CS8 A;  2GHU A;  3KKU A;  2YJ9 A;  3LFY A;  1NLJ A;  2DJF B;  1EWP A;  4BPV A;  3KFQ A;  2E02 A;  2F1G A;  3C9E A;  3KWZ A;  3DF0 A;  5F02 A;  2FRA A;  2B1M A;  1CTE A;  3QSD A;  2PRE A;  3S3R A;  3MHS A;  3E1Z B;  1NQC A;  1CSB B;  3K8U A;  3OVZ A;  1HUC B;  1KFU L;  4YVA A;  1PPN A;  3OVX A;  1NPZ A;  3BCN A;  2DC6 A;  4N4Z A;  2G8E A;  4YYS A;  3OF8 A;  2R9N A;  4CZW A;  2DCD A;  3HHI A;  1AEC A;  1QXP A;  4QBB A;  4BSQ A;  2ARY A;  3PNR A;  2G7Y A;  1JQP A;  2F7D A;  1GMY A;  2PNS A;  2AIM A;  3KWB X;  4AXL A;  1KHQ A;  1DEU A;  1PPO A;  1PPP A;  5EF4 A;  2ATO A;  3I06 A;  2CIO A;  1X9Y A;  1ATK A;  1MIR A;  3P5V A;  1U9Q X;  1AYV A; 
#chains in the Genus database with same CATH topology
 4XR7 A;  2DCC A;  2E03 A;  2DJG B;  2DC8 A;  5CVN B;  3I3T A;  1PCI A;  5CVO B;  4BOS A;  5PAD A;  1YK8 A;  3PHW A;  4N8W A;  2P7U A;  3K9M A;  7PCK A;  1U5I A;  3F5V A;  1POP A;  3RVV A;  3HD3 A;  4X6H A;  4CDC B;  2FQ9 A;  3M99 A;  2HH5 A;  3PRM A;  3B79 A;  1U9V A;  2JTC A;  1STF E;  1SP4 B;  2R9M A;  3IOQ A;  2CB5 A;  4I05 A;  4ZTB A;  4XZX A;  6PAD A;  2DC7 A;  5CVM A;  1AIM A;  3MOR A;  3W31 A;  2FO5 A;  2BU3 A;  2O6X A;  4BS6 A;  4W5C A;  3D6S A;  4CDE B;  3U8E A;  4YYV A;  1ZIV A;  3ERV A;  1TL9 A;  2G8J A;  4X6J A;  2YJC A;  5JH3 A;  4YYU A;  2DCB A;  1M6D A;  1QDQ A;  5EGW A;  2VHF A;  3RVW A;  1MHW A;  4OW0 A;  1BY8 A;  4P16 A;  3F75 A;  3RVX A;  1O0E A;  2UZJ A;  2Z84 A;  4BOU A;  2IBI A;  3MJ5 A;  4DMY A;  9PAP A;  3B21 A;  3BWK A;  3BY4 A;  5EZQ A;  2BDZ A;  4RF1 A;  3KX1 A;  3H7D A;  1Q6K A;  4QRX A;  3P5U A;  3QJ3 A;  4CDF B;  1F2B A;  2AGA A;  3BB7 A;  2YJB A;  4P6G A;  2PAD A;  4MM3 B;  5E6J A;  1Y4H A;  3USV A;  3H8C A;  3ZNH A;  1Y08 A;  4DMX A;  5A24 A;  2B1N A;  1BQI A;  4M0W A;  1U9W A;  2XU4 A;  1U9X A;  1QMY A;  1PIP A;  1MS6 A;  1DKI A;  2E00 A;  2AYO A;  3BBA A;  3CH2 X;  3N3K A;  1CV8 A;  2H7J A;  3AI8 A;  3OIS A;  1TU6 A;  2JRI A;  4OEM A;  1EF7 A;  1K3B B;  5KO3 A;  2AS8 A;  1ME4 A;  4RKX A;  3BC3 A;  3P5X A;  3WXF A;  1IWD A;  4QRV A;  2AUZ A;  1PAD A;  1S4V A;  2JQG R;  4QRG A;  1UKF A;  2XU5 A;  4XUI A;  2R6N A;  3PSE A;  3IEJ A;  4BQV A;  1AU2 A;  5FPW A;  2DC9 A;  2NQG A;  1AYW A;  4PP2 E;  4X6I A;  4MI7 A;  1F2A A;  2E01 A;  1ICF A;  2AVW A;  3HWN A;  1SNK A;  1BP4 A;  2FUD A;  2OP3 A;  4KLB A;  3PHX A;  2P0R A;  3CH3 X;  2R9C A;  4OEL A;  5CHT A;  1KFX L;  2DZY A;  3O1G A;  1CB5 A;  4BS5 A;  1PE6 A;  2J7Q A;  3BOW A;  1XKG A;  3MHH A;  3WXE A;  1GLO A;  4FJC A;  5EZS A;  2P86 A;  1TLO A;  4Q8H A;  2OZ2 A;  2R9O A;  2WBF X;  1KXR A;  3BPF A;  3PDF A;  1CPJ A;  3IHP A;  3PW3 A;  3K24 A;  4PP1 A;  1DF0 A;  3O65 A;  1MEG A;  4IP3 A;  2YJ8 A;  4BOZ A;  2J7Q C;  8PCH A;  4N79 A;  1YZB A;  5CHV A;  3IV2 A;  2AYN A;  2DZZ A;  2Y6E A;  2VHS A;  3BPM A;  1THE A;  2C0Y A;  2HXZ A;  4WUR A;  4MSX A;  2DCA A;  4HWY A;  4YV8 A;  1AU0 A;  2FT2 A;  2R9F A;  5K16 A;  1GCB A;  1YVB A;  1CQD A;  3V6C A;  2BDL A;  1EWM A;  3HHA A;  4QH6 A;  1GEC E;  1MEM A;  3LXS A;  4D8B A;  2Y5B A;  4D8I A;  3CBJ A;  2DOS A;  5JA7 A;  1EWL A;  1CVZ A;  2AUX A;  1AU4 A;  3GCB A;  2HWK A;  5J94 A;  3KSE A;  1ME3 A;  3PHU A;  4FK5 A;  1FH0 A;  4YYR A;  4ZUX U;  4PT5 A;  3IMA A;  3MP2 A;  1EWO A;  2YJ2 A;  3S3Q A;  1F2C A;  4PAD A;  1MDW A;  1YK7 A;  1NB5 A;  1ITO A;  2NQA A;  2G6D A;  4YYW A;  3TRK A;  3MTN A;  3KW9 A;  3WXG A;  1NL6 A;  3E9S A;  2IPP B;  3H6S A;  3PBH A;  4BOP A;  2JQF R;  3QT4 A;  2FYE A;  3NHE A;  4WA6 A;  2XU3 A;  3N4C A;  4I04 A;  4W5B A;  4G54 A;  2FRQ A;  1PBH A;  4CDD B;  1YAL A;  3N3G A;  1F29 A;  1PVJ A;  1BGO A;  4OVZ A;  4RY2 A;  3IUT A;  1QOL A;  3V6E A;  3C0R A;  2XU1 A;  1ZCM A;  1CJL A;  4PI3 A;  1KHP A;  4MZO A;  2HHN A;  2AU1 A;  1AYU A;  1YT7 A;  4R3D A;  3OF9 A;  4Q8G A;  2ACT A;  3IFU A;  3H8B A;  2BTW B;  3H89 A;  2NQD B;  4MZS A;  1VJV A;  3OQC A;  2FTD A;  4P6E A;  3W30 A;  4RNA A;  2FE8 A;  4AXM A;  1AU3 A;  1A6R A;  3P5W A;  4REZ A;  3TMP A;  4OVZ B;  4I07 A;  4W4U A;  3TNX A;  3O0U A;  2HD5 A;  4YYQ A;  1NB3 A;  3ZUA A;  4K7C A;  3CBK A;  2NQI A;  2GFO A;  1PPD A;  4FIP A;  1VSN A;  1PXV A;  2OUL A;  2PBH A;  1CS8 A;  2GHU A;  3KKU A;  2YJ9 A;  3LFY A;  3PT2 A;  1NLJ A;  4RF0 A;  2DJF B;  1EWP A;  4BPV A;  3KFQ A;  2E02 A;  2F1G A;  3C9E A;  3KWZ A;  3DF0 A;  5F02 A;  2FRA A;  2B1M A;  1CTE A;  3QSD A;  2PRE A;  3S3R A;  3MHS A;  3E1Z B;  4IUM A;  5JZE A;  1NQC A;  1CSB B;  3K8U A;  3OVZ A;  1HUC B;  1KFU L;  4HXD B;  4YVA A;  1PPN A;  3MTV A;  3OVX A;  1NPZ A;  3RNV A;  3BCN A;  3PRP A;  2DC6 A;  4D8E A;  4N4Z A;  2G8E A;  4YYS A;  3OF8 A;  2R9N A;  4CZW A;  2DCD A;  3HHI A;  1AEC A;  4BOQ A;  1QXP A;  4QBB A;  4BSQ A;  2ARY A;  3PNR A;  4A5U A;  2G7Y A;  1JQP A;  2F7D A;  1GMY A;  2PNS A;  2AIM A;  3KWB X;  4AXL A;  1KHQ A;  4GUA A;  1DEU A;  1PPO A;  1PPP A;  5EF4 A;  2ATO A;  3I06 A;  2CIO A;  1X9Y A;  1ATK A;  1MIR A;  3P5V A;  2BTW A;  1U9Q X;  1AYV A; 
#chains in the Genus database with same CATH homology
 4XR7 A;  2DCC A;  2E03 A;  2DJG B;  2DC8 A;  5CVN B;  3I3T A;  1PCI A;  5CVO B;  5PAD A;  3LTW A;  1YK8 A;  4N8W A;  2P7U A;  3K9M A;  7PCK A;  1U5I A;  3F5V A;  1POP A;  3RVV A;  3HD3 A;  4X6H A;  4CDC B;  2FQ9 A;  3M99 A;  2HH5 A;  3B79 A;  1U9V A;  1E2T A;  1STF E;  1SP4 B;  2R9M A;  3IOQ A;  2CB5 A;  4I05 A;  6PAD A;  1W4T A;  2DC7 A;  5CVM A;  1AIM A;  3MOR A;  2FO5 A;  2O6X A;  4BS6 A;  4W5C A;  3D6S A;  4CDE B;  3U8E A;  4YYV A;  1ZIV A;  3ERV A;  1TL9 A;  2G8J A;  4X6J A;  2YJC A;  5JH3 A;  4YYU A;  2DCB A;  1M6D A;  1QDQ A;  5EGW A;  2VHF A;  3RVW A;  1MHW A;  1BY8 A;  3F75 A;  3RVX A;  1O0E A;  2IBI A;  4DMY A;  9PAP A;  3BWK A;  2BDZ A;  3KX1 A;  3H7D A;  1Q6K A;  4BGF A;  4QRX A;  3P5U A;  3QJ3 A;  4CDF B;  1F2B A;  2YJB A;  4P6G A;  2PAD A;  1Y4H A;  3USV A;  3H8C A;  4DMX A;  1Y08 A;  5A24 A;  2B1N A;  1BQI A;  1U9W A;  2XU4 A;  1U9X A;  1QMY A;  1PIP A;  1MS6 A;  2E00 A;  2AYO A;  3CH2 X;  3N3K A;  1CV8 A;  2H7J A;  3AI8 A;  3OIS A;  1TU6 A;  4OEM A;  1EF7 A;  1K3B B;  2AS8 A;  1ME4 A;  4C5P A;  3BC3 A;  3P5X A;  3WXF A;  1IWD A;  3D9W A;  4QRV A;  2AUZ A;  1PAD A;  1S4V A;  2JQG R;  4QRG A;  4XUI A;  2XU5 A;  2R6N A;  3IEJ A;  4BQV A;  1AU2 A;  5FPW A;  2DC9 A;  2NQG A;  1AYW A;  4PP2 E;  2VFB A;  4X6I A;  1F2A A;  2E01 A;  1ICF A;  2AVW A;  3HWN A;  1SNK A;  1BP4 A;  2FUD A;  2OP3 A;  1W5R A;  4KLB A;  2P0R A;  3CH3 X;  2R9C A;  4OEL A;  5CHT A;  1KFX L;  2DZY A;  3O1G A;  1CB5 A;  4BS5 A;  1PE6 A;  3BOW A;  1XKG A;  3MHH A;  3WXE A;  1GLO A;  4FJC A;  2P86 A;  1TLO A;  4Q8H A;  2OZ2 A;  2R9O A;  2WBF X;  1KXR A;  3BPF A;  3PDF A;  1CPJ A;  3IHP A;  3PW3 A;  3K24 A;  4PP1 A;  1DF0 A;  1MEG A;  2YJ8 A;  8PCH A;  4N79 A;  5CHV A;  3IV2 A;  2AYN A;  2DZZ A;  2Y6E A;  2VHS A;  3BPM A;  1THE A;  2C0Y A;  2HXZ A;  4MSX A;  2DCA A;  4HWY A;  4YV8 A;  1AU0 A;  2FT2 A;  2R9F A;  5K16 A;  1GCB A;  1YVB A;  1CQD A;  3V6C A;  2BDL A;  1EWM A;  3HHA A;  1GX3 A;  4QH6 A;  1GEC E;  1MEM A;  4NV8 A;  3LXS A;  2Y5B A;  3CBJ A;  5JA7 A;  1EWL A;  1CVZ A;  2AUX A;  2VFC A;  1AU4 A;  3GCB A;  5J94 A;  3KSE A;  1ME3 A;  4FK5 A;  1FH0 A;  4YYR A;  4ZUX U;  3IMA A;  1EWO A;  2YJ2 A;  3S3Q A;  1F2C A;  4PAD A;  1MDW A;  1YK7 A;  1NB5 A;  1ITO A;  2NQA A;  2G6D A;  4YYW A;  3MTN A;  3KW9 A;  1W6F A;  3WXG A;  1NL6 A;  2IPP B;  3H6S A;  3PBH A;  2JQF R;  3QT4 A;  2FYE A;  3NHE A;  4WA6 A;  2XU3 A;  3N4C A;  4I04 A;  4W5B A;  4G54 A;  2FRQ A;  1PBH A;  4CDD B;  1YAL A;  3N3G A;  1F29 A;  1BGO A;  4RY2 A;  3IUT A;  1QOL A;  3V6E A;  2XU1 A;  1ZCM A;  2BSZ A;  1CJL A;  4PI3 A;  1KHP A;  4MZO A;  2HHN A;  2AU1 A;  1AYU A;  1YT7 A;  3OF9 A;  4Q8G A;  2ACT A;  3H8B A;  3H89 A;  2NQD B;  4MZS A;  1VJV A;  2FTD A;  4P6E A;  4AXM A;  1AU3 A;  4NV7 A;  1A6R A;  3P5W A;  4I07 A;  4W4U A;  3TNX A;  3O0U A;  2HD5 A;  4YYQ A;  1NB3 A;  3ZUA A;  4K7C A;  3CBK A;  2NQI A;  2GFO A;  1PPD A;  4FIP A;  4GUZ A;  1VSN A;  1PXV A;  2OUL A;  2PBH A;  1CS8 A;  2GHU A;  3KKU A;  2YJ9 A;  3LFY A;  1NLJ A;  2DJF B;  1EWP A;  4BPV A;  3KFQ A;  2E02 A;  2F1G A;  3C9E A;  3KWZ A;  3DF0 A;  5F02 A;  2FRA A;  2B1M A;  1CTE A;  3QSD A;  2PRE A;  3S3R A;  3MHS A;  3E1Z B;  1NQC A;  1CSB B;  3K8U A;  3OVZ A;  1HUC B;  1KFU L;  4YVA A;  1PPN A;  3OVX A;  1NPZ A;  3BCN A;  2DC6 A;  4N4Z A;  2G8E A;  4YYS A;  3OF8 A;  2R9N A;  4CZW A;  2DCD A;  3HHI A;  1AEC A;  1QXP A;  4QBB A;  4BSQ A;  2ARY A;  3PNR A;  4B55 A;  2G7Y A;  1JQP A;  2F7D A;  1GMY A;  2PNS A;  2AIM A;  3KWB X;  4AXL A;  1KHQ A;  1DEU A;  1PPO A;  1PPP A;  5EF4 A;  2ATO A;  3I06 A;  2CIO A;  1X9Y A;  1ATK A;  1MIR A;  3P5V A;  1U9Q X;  1AYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...