1MS6A

Dipeptide nitrile inhibitor bound to cathepsin s.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Design and synthesis of dipeptide nitriles as reversible and potent Cathepsin S inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ms6A00
2FRAA 4MZSA 4DMYA 2BDZA 3KFQA 1DF0A 2DZZA 2FT2A 4QRGA 3O0UA 2R9MA 4P6EA 4QH6A 2PNSA 1CV8A 2AU1A 1YK7A 4W4UA 2AYNA 1CTEA 3HWNA 4ZUXU 2P7UA 1KFUL 1PPOA 3H89A 4P6GA 3C9EA 2GHUA 4CDFB 1SP4B 3F75A 1QDQA 1SNKA 3WXEA 2Y6EA 5K16A 2O6XA 4DMXA 4YYRA 4N79A 2DCAA 2E00A 1U5IA 3HHAA 2P0RA 1U9XA 1AU4A 2R9OA 3CBJA 1GLOA 1PXVA 3IV2A 2R9FA 8PCHA 3MORA 1AU3A 4XUIA 4YVAA 4WA6A 2E01A 3OVZA 1KXRA 3CH2X 2IPPB 3H8CA 2FYEA 5EF4A 1CS8A 2VHFA 1MEGA 2HH5A 3V6EA 2R6NA 1F2AA 3QSDA 2FTDA 3MTNA 2F1GA 3I3TA 2E02A 4YYSA 2AVWA 1CSBB 1NLJA 4QRXA 1CJLA 1HUCB 2XU3A 5CVOB 4X6IA 1M6DA 1PADA 1ZCMA 1NQCA 2AS8A 1CB5A 2YJCA 3IHPA 5FPWA 2XU1A 3BPMA 2NQAA 3BOWA 4N4ZA 3OISA 3IMAA 4PADA 3B79A 2PADA 4YYUA 2AUZA 3QJ3A 1Y08A 2ACTA 3BCNA 1AYUA 3OF9A 4MZOA 5EGWA 3I06A 7PCKA 1BY8A 2NQDB 1XKGA 4W5BA 1ZIVA 2OULA 1F2CA 1PCIA 4YYVA 1FH0A 1S4VA 4Q8HA 1PIPA 3WXGA 4BQVA 3P5UA 3PW3A 4G54A 5JA7A 3PBHA 1NPZA 2FUDA 5CVMA 3KWZA 2B1NA 3N3GA 3TNXA 1AECA 2ARYA 2XU4A 9PAPA 1QMYA 4XR7A 2DJFB 1KFXL 3H6SA 4FJCA 1IWDA 1K3BB 1VSNA 1NB3A 3KW9A 1U9QX 3LXSA 1CPJA 2DC6A 4MSXA 3KKUA 4BSQA 2NQIA 1O0EA 1JQPA 2G7YA 5PADA 2CIOA 1MDWA 4HWYA 3IEJA 4AXMA 2GFOA 2AIMA 4K7CA 2JQFR 2CB5A 4N8WA 1YALA 3MHSA 3AI8A 5A24A 2AUXA 3K8UA 2FRQA 2NQGA 3RVVA 5CHTA 2DCDA 1PPPA 3P5WA 3HHIA 4KLBA 1BGOA 4PP2E 4BS6A 2E03A 1GCBA 2F7DA 4BPVA 2Y5BA 4AXLA 1PPNA 4FIPA 2DC7A 2G6DA 1TU6A 3RVXA 4W5CA 2YJ8A 4OEMA 3K9MA 3PDFA 2WBFX 1NB5A 6PADA 1AU0A 1AU2A 5J94A 1A6RA 1Q6KA 1AYVA 4CDEB 4CDCB 4RY2A 2HXZA 1ME3A 2HHNA 2IBIA 2OZ2A 2DJGB 1CQDA 2BDLA 3N3KA 1POPA 2YJ2A 4YYWA 2DC9A 3H8BA 3NHEA 1QXPA 4PP1A 1YK8A 2PBHA 1PE6A 3KWBX 2OP3A 1EWLA 1EWMA 1TLOA 4YYQA 1VJVA 4CDDB 5CVNB 1BQIA 4CZWA 2G8EA 1AIMA 1TL9A 3BC3A 1EWPA 1STFE 2C0YA 1THEA 2DC8A 1PPDA 2FO5A 2PREA 3M99A 3S3RA 3V6CA 3S3QA 4BS5A 1ME4A 3E1ZB 3O1GA 2G8JA 4I07A 1MIRA 2DCCA 4I05A 1ATKA 3MHHA 3ZUAA 3H7DA 2FQ9A 1YVBA 3KX1A 3RVWA 2B1MA 1ICFA 3F5VA 3OF8A 1F29A 1U9WA 4X6JA 3U8EA 3OVXA 3HD3A 3P5XA 3ERVA 4X6HA 2DCBA 1QOLA 2YJBA 3BWKA 5JH3A 1EWOA 1KHQA 3BPFA 3N4CA 2H7JA 1PBHA 3CBKA 2DZYA 3USVA 2ATOA 3LFYA 1X9YA 2R9NA 4OELA 2XU5A 3D6SA 1U9VA 3CH3X 3KSEA 1KHPA 2P86A 1MS6A 4YV8A 2YJ9A 1MHWA 2HD5A 1NL6A 4Q8GA 1Y4HA 2JQGR 1AYWA 4PI3A 1MEMA 3IOQA 1ITOA 1YT7A 1EF7A 3P5VA 1DEUA 3IUTA 3WXFA 3DF0A 4QBBA 2R9CA 3QT4A 3GCBA 4FK5A 1BP4A 4QRVA 4I04A 1GECE 5CHVA 1GMYA 1CVZA 2VHSA 3PNRA 5F02A 1F2BA 3K24A 2AYOA
chains in the Genus database with same CATH superfamily
4D8EA 2FRAA 3BBAA 4MZSA 4DMYA 2BDZA 3KFQA 1DF0A 2DZZA 2FT2A 4QRGA 3O0UA 2R9MA 4P6EA 4QH6A 2PNSA 2BTWA 1CV8A 2AU1A 1YK7A 4W4UA 2AYNA 1CTEA 3HWNA 4ZUXU 2P7UA 1KFUL 1PPOA 3H89A 4P6GA 3C9EA 2GHUA 4GUAA 2J7QA 4CDFB 1SP4B 3F75A 1QDQA 1SNKA 4IUMA 3WXEA 2JTCA 2Y6EA 4RNAA 5K16A 2O6XA 4DMXA 4YYRA 4N79A 2DCAA 2E00A 1U5IA 3HHAA 2P0RA 1U9XA 1PVJA 4BOQA 1AU4A 2R9OA 3CBJA 1GLOA 1PXVA 3BB7A 3IV2A 2R9FA 8PCHA 3MORA 1AU3A 3PRMA 4XUIA 4YVAA 4WA6A 4IP3A 4D8BA 2E01A 3OVZA 4P16A 4RF1A 1KXRA 3CH2X 2IPPB 3H8CA 3RNVA 2FYEA 5EF4A 1CS8A 2VHFA 1MEGA 5JZEA 2HH5A 4REZA 3V6EA 2R6NA 1F2AA 3QSDA 3PSEA 2FTDA 3MTNA 2F1GA 3I3TA 1YZBA 2E02A 2HWKA 4YYSA 2AVWA 1CSBB 1NLJA 4QRXA 1CJLA 1HUCB 2XU3A 5CVOB 4X6IA 1M6DA 1PADA 1ZCMA 1NQCA 2AS8A 1CB5A 2YJCA 3IHPA 5FPWA 2XU1A 3BPMA 2NQAA 3BOWA 4N4ZA 3OISA 3IMAA 4PADA 3B79A 2PADA 4WURA 4YYUA 2AUZA 3QJ3A 1Y08A 4OVZB 2ACTA 4XZXA 3BCNA 5EZQA 1AYUA 3OF9A 4MZOA 5EGWA 3I06A 7PCKA 1BY8A 2NQDB 4BOSA 1XKGA 3O65A 4W5BA 3PHWA 1ZIVA 2OULA 1F2CA 1PCIA 4YYVA 1FH0A 1S4VA 4Q8HA 1PIPA 4RKXA 3WXGA 4BQVA 3P5UA 3PW3A 4G54A 5JA7A 3MJ5A 3PBHA 1NPZA 2FUDA 5CVMA 3KWZA 2B1NA 3N3GA 3TNXA 1AECA 4R3DA 4HXDB 2BTWB 2ARYA 2XU4A 9PAPA 4OW0A 1QMYA 4BOUA 4XR7A 2DJFB 1KFXL 3H6SA 4FJCA 1IWDA 1K3BB 1VSNA 1NB3A 4BOPA 3KW9A 1U9QX 3LXSA 1CPJA 2DC6A 4MSXA 3KKUA 4BSQA 3W31A 2NQIA 4BOZA 1O0EA 1DKIA 1JQPA 2G7YA 5PADA 2CIOA 1MDWA 2FE8A 4HWYA 3IEJA 4AXMA 2GFOA 2AIMA 2Z84A 4K7CA 2JQFR 2CB5A 4N8WA 1YALA 3MHSA 3AI8A 5A24A 2AUXA 3K8UA 2FRQA 2NQGA 3RVVA 5CHTA 2DCDA 1PPPA 3P5WA 3HHIA 4KLBA 1BGOA 4PP2E 4BS6A 2E03A 1GCBA 2F7DA 4BPVA 4RF0A 2Y5BA 4AXLA 1PPNA 2UZJA 4FIPA 2DC7A 2G6DA 1TU6A 3RVXA 4W5CA 2YJ8A 4OEMA 3K9MA 3PDFA 2AGAA 3TMPA 2WBFX 1NB5A 6PADA 1AU0A 3PRPA 1AU2A 5J94A 1A6RA 1Q6KA 1AYVA 4CDEB 4ZTBA 5E6JA 4CDCB 4RY2A 2HXZA 1ME3A 2HHNA 2IBIA 2OZ2A 2DJGB 1CQDA 2BDLA 3N3KA 1POPA 2YJ2A 4YYWA 2DC9A 3H8BA 3NHEA 1QXPA 4PP1A 1YK8A 2PBHA 3W30A 1PE6A 3KWBX 2OP3A 1EWLA 1EWMA 1TLOA 4YYQA 1VJVA 4CDDB 5KO3A 3TRKA 5CVNB 1BQIA 4CZWA 2G8EA 1AIMA 1TL9A 3BC3A 4D8IA 1EWPA 2JRIA 1STFE 3PT2A 3PHXA 2C0YA 3MTVA 2DOSA 1THEA 3IFUA 2DC8A 1PPDA 2FO5A 2PREA 3M99A 3S3RA 3V6CA 3S3QA 4BS5A 1ME4A 3E1ZB 3O1GA 2G8JA 2J7QC 4I07A 1MIRA 2DCCA 4PT5A 4I05A 1ATKA 3MHHA 3ZUAA 3H7DA 2FQ9A 1YVBA 3KX1A 3RVWA 1UKFA 2B1MA 1ICFA 3F5VA 3OF8A 1F29A 1U9WA 4X6JA 3U8EA 3ZNHA 3OVXA 3HD3A 3P5XA 3ERVA 4X6HA 2BU3A 2DCBA 1QOLA 2YJBA 3BWKA 3B21A 5JH3A 1EWOA 1KHQA 3BPFA 3N4CA 2H7JA 3OQCA 1PBHA 3CBKA 2DZYA 5EZSA 3USVA 4A5UA 2ATOA 3LFYA 1X9YA 2R9NA 4OELA 2XU5A 3D6SA 1U9VA 3CH3X 3KSEA 1KHPA 2P86A 1MS6A 4YV8A 3PHUA 2YJ9A 1MHWA 2HD5A 4M0WA 3BY4A 1NL6A 1Y4HA 2JQGR 4Q8GA 1AYWA 4PI3A 1MEMA 3IOQA 1ITOA 1YT7A 3E9SA 1EF7A 3P5VA 1DEUA 3IUTA 4OVZA 3WXFA 4MI7A 3DF0A 4QBBA 2R9CA 3QT4A 3GCBA 4MM3B 4FK5A 1BP4A 4QRVA 4I04A 1GECE 3MP2A 5CHVA 1GMYA 1CVZA 2VHSA 3PNRA 3C0RA 5F02A 1F2BA 3K24A 2AYOA
chains in the Genus database with same CATH topology
2FRAA 4MZSA 4DMYA 2BDZA 3KFQA 1DF0A 2DZZA 2FT2A 4QRGA 3O0UA 2R9MA 4P6EA 1W4TA 4QH6A 2PNSA 1CV8A 2AU1A 1YK7A 4W4UA 2AYNA 1CTEA 3HWNA 4ZUXU 2P7UA 1KFUL 1PPOA 3H89A 4P6GA 3C9EA 2GHUA 4CDFB 1SP4B 3F75A 4GUZA 1QDQA 1SNKA 3WXEA 2Y6EA 5K16A 2O6XA 4DMXA 4YYRA 4N79A 2DCAA 2E00A 1U5IA 3HHAA 2P0RA 1U9XA 1AU4A 2R9OA 3CBJA 1GLOA 1PXVA 3IV2A 2R9FA 8PCHA 3MORA 1AU3A 2VFCA 4XUIA 4YVAA 4WA6A 2E01A 3OVZA 1KXRA 3CH2X 2IPPB 3H8CA 2FYEA 5EF4A 1CS8A 2VHFA 1MEGA 2HH5A 1W5RA 3V6EA 2R6NA 1F2AA 3QSDA 2FTDA 3MTNA 2F1GA 3I3TA 2E02A 4YYSA 2VFBA 2AVWA 1CSBB 1NLJA 4QRXA 1CJLA 1W6FA 1HUCB 2XU3A 5CVOB 4X6IA 1M6DA 1PADA 1ZCMA 1NQCA 2AS8A 4B55A 1CB5A 2YJCA 3IHPA 5FPWA 2XU1A 3BPMA 2NQAA 3BOWA 4N4ZA 3OISA 3IMAA 4PADA 3B79A 2PADA 4YYUA 2AUZA 3QJ3A 1Y08A 2ACTA 3BCNA 1AYUA 3OF9A 4MZOA 5EGWA 3I06A 7PCKA 1BY8A 2NQDB 1XKGA 4W5BA 1ZIVA 2OULA 1F2CA 1PCIA 4YYVA 1FH0A 1S4VA 4Q8HA 1PIPA 3WXGA 4BQVA 3P5UA 3PW3A 4G54A 5JA7A 3PBHA 1NPZA 2FUDA 5CVMA 3KWZA 2B1NA 3N3GA 3TNXA 1AECA 2ARYA 2XU4A 9PAPA 1QMYA 4XR7A 2DJFB 1KFXL 3H6SA 4FJCA 1IWDA 1K3BB 1VSNA 1NB3A 3KW9A 1U9QX 3LXSA 1CPJA 2DC6A 4MSXA 3KKUA 4BSQA 2NQIA 1O0EA 1JQPA 2G7YA 2BSZA 5PADA 2CIOA 1MDWA 4HWYA 3IEJA 4AXMA 2GFOA 2AIMA 4K7CA 2JQFR 2CB5A 4N8WA 1YALA 3MHSA 3AI8A 5A24A 2AUXA 3K8UA 2FRQA 2NQGA 3RVVA 3LTWA 5CHTA 1E2TA 2DCDA 1PPPA 3P5WA 3HHIA 4KLBA 1BGOA 4PP2E 4BS6A 2E03A 1GCBA 2F7DA 4BPVA 2Y5BA 4AXLA 1PPNA 4FIPA 2DC7A 2G6DA 1TU6A 3RVXA 4W5CA 2YJ8A 4OEMA 3K9MA 3PDFA 2WBFX 1NB5A 6PADA 1AU0A 1AU2A 5J94A 1A6RA 1Q6KA 1AYVA 4CDEB 3D9WA 4CDCB 4RY2A 2HXZA 1ME3A 2HHNA 2IBIA 2OZ2A 2DJGB 4NV8A 1CQDA 2BDLA 3N3KA 1POPA 2YJ2A 4YYWA 2DC9A 3H8BA 3NHEA 1QXPA 4PP1A 1YK8A 2PBHA 1PE6A 3KWBX 2OP3A 1EWLA 1EWMA 1TLOA 4YYQA 1VJVA 4CDDB 4C5PA 5CVNB 1BQIA 4CZWA 2G8EA 1AIMA 1TL9A 3BC3A 1EWPA 1STFE 2C0YA 1THEA 2DC8A 1PPDA 2FO5A 2PREA 3M99A 3S3RA 3V6CA 3S3QA 4BS5A 4BGFA 1ME4A 3E1ZB 3O1GA 2G8JA 4I07A 1MIRA 2DCCA 4I05A 1ATKA 3MHHA 3ZUAA 3H7DA 2FQ9A 1YVBA 3KX1A 3RVWA 2B1MA 1ICFA 3F5VA 3OF8A 1F29A 1U9WA 4X6JA 3U8EA 3OVXA 3HD3A 3P5XA 3ERVA 4X6HA 2DCBA 1QOLA 2YJBA 3BWKA 5JH3A 1EWOA 1KHQA 3BPFA 3N4CA 2H7JA 1PBHA 3CBKA 2DZYA 3USVA 2ATOA 3LFYA 1X9YA 1GX3A 2R9NA 4OELA 2XU5A 3D6SA 1U9VA 4NV7A 3CH3X 3KSEA 1KHPA 2P86A 1MS6A 4YV8A 2YJ9A 1MHWA 2HD5A 1NL6A 1Y4HA 2JQGR 4Q8GA 1AYWA 4PI3A 1MEMA 3IOQA 1ITOA 1YT7A 1EF7A 3P5VA 1DEUA 3IUTA 3WXFA 3DF0A 4QBBA 2R9CA 3QT4A 3GCBA 4FK5A 1BP4A 4QRVA 4I04A 1GECE 5CHVA 1GMYA 1CVZA 2VHSA 3PNRA 5F02A 1F2BA 3K24A 2AYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRA A;  4MZS A;  4DMY A;  2BDZ A;  3KFQ A;  1DF0 A;  2DZZ A;  2FT2 A;  4QRG A;  3O0U A;  2R9M A;  4P6E A;  4QH6 A;  2PNS A;  1CV8 A;  2AU1 A;  1YK7 A;  4W4U A;  2AYN A;  1CTE A;  3HWN A;  4ZUX U;  2P7U A;  1KFU L;  1PPO A;  3H89 A;  4P6G A;  3C9E A;  2GHU A;  4CDF B;  1SP4 B;  3F75 A;  1QDQ A;  1SNK A;  3WXE A;  2Y6E A;  5K16 A;  2O6X A;  4DMX A;  4YYR A;  4N79 A;  2DCA A;  2E00 A;  1U5I A;  3HHA A;  2P0R A;  1U9X A;  1AU4 A;  2R9O A;  3CBJ A;  1GLO A;  1PXV A;  3IV2 A;  2R9F A;  8PCH A;  3MOR A;  1AU3 A;  4XUI A;  4YVA A;  4WA6 A;  2E01 A;  3OVZ A;  1KXR A;  3CH2 X;  2IPP B;  3H8C A;  2FYE A;  5EF4 A;  1CS8 A;  2VHF A;  1MEG A;  2HH5 A;  3V6E A;  2R6N A;  1F2A A;  3QSD A;  2FTD A;  3MTN A;  2F1G A;  3I3T A;  2E02 A;  4YYS A;  2AVW A;  1CSB B;  1NLJ A;  4QRX A;  1CJL A;  1HUC B;  2XU3 A;  5CVO B;  4X6I A;  1M6D A;  1PAD A;  1ZCM A;  1NQC A;  2AS8 A;  1CB5 A;  2YJC A;  3IHP A;  5FPW A;  2XU1 A;  3BPM A;  2NQA A;  3BOW A;  4N4Z A;  3OIS A;  3IMA A;  4PAD A;  3B79 A;  2PAD A;  4YYU A;  2AUZ A;  3QJ3 A;  1Y08 A;  2ACT A;  3BCN A;  1AYU A;  3OF9 A;  4MZO A;  5EGW A;  3I06 A;  7PCK A;  1BY8 A;  2NQD B;  1XKG A;  4W5B A;  1ZIV A;  2OUL A;  1F2C A;  1PCI A;  4YYV A;  1FH0 A;  1S4V A;  4Q8H A;  1PIP A;  3WXG A;  4BQV A;  3P5U A;  3PW3 A;  4G54 A;  5JA7 A;  3PBH A;  1NPZ A;  2FUD A;  5CVM A;  3KWZ A;  2B1N A;  3N3G A;  3TNX A;  1AEC A;  2ARY A;  2XU4 A;  9PAP A;  1QMY A;  4XR7 A;  2DJF B;  1KFX L;  3H6S A;  4FJC A;  1IWD A;  1K3B B;  1VSN A;  1NB3 A;  3KW9 A;  1U9Q X;  3LXS A;  1CPJ A;  2DC6 A;  4MSX A;  3KKU A;  4BSQ A;  2NQI A;  1O0E A;  1JQP A;  2G7Y A;  5PAD A;  2CIO A;  1MDW A;  4HWY A;  3IEJ A;  4AXM A;  2GFO A;  2AIM A;  4K7C A;  2JQF R;  2CB5 A;  4N8W A;  1YAL A;  3MHS A;  3AI8 A;  5A24 A;  2AUX A;  3K8U A;  2FRQ A;  2NQG A;  3RVV A;  5CHT A;  2DCD A;  1PPP A;  3P5W A;  3HHI A;  4KLB A;  1BGO A;  4PP2 E;  4BS6 A;  2E03 A;  1GCB A;  2F7D A;  4BPV A;  2Y5B A;  4AXL A;  1PPN A;  4FIP A;  2DC7 A;  2G6D A;  1TU6 A;  3RVX A;  4W5C A;  2YJ8 A;  4OEM A;  3K9M A;  3PDF A;  2WBF X;  1NB5 A;  6PAD A;  1AU0 A;  1AU2 A;  5J94 A;  1A6R A;  1Q6K A;  1AYV A;  4CDE B;  4CDC B;  4RY2 A;  2HXZ A;  1ME3 A;  2HHN A;  2IBI A;  2OZ2 A;  2DJG B;  1CQD A;  2BDL A;  3N3K A;  1POP A;  2YJ2 A;  4YYW A;  2DC9 A;  3H8B A;  3NHE A;  1QXP A;  4PP1 A;  1YK8 A;  2PBH A;  1PE6 A;  3KWB X;  2OP3 A;  1EWL A;  1EWM A;  1TLO A;  4YYQ A;  1VJV A;  4CDD B;  5CVN B;  1BQI A;  4CZW A;  2G8E A;  1AIM A;  1TL9 A;  3BC3 A;  1EWP A;  1STF E;  2C0Y A;  1THE A;  2DC8 A;  1PPD A;  2FO5 A;  2PRE A;  3M99 A;  3S3R A;  3V6C A;  3S3Q A;  4BS5 A;  1ME4 A;  3E1Z B;  3O1G A;  2G8J A;  4I07 A;  1MIR A;  2DCC A;  4I05 A;  1ATK A;  3MHH A;  3ZUA A;  3H7D A;  2FQ9 A;  1YVB A;  3KX1 A;  3RVW A;  2B1M A;  1ICF A;  3F5V A;  3OF8 A;  1F29 A;  1U9W A;  4X6J A;  3U8E A;  3OVX A;  3HD3 A;  3P5X A;  3ERV A;  4X6H A;  2DCB A;  1QOL A;  2YJB A;  3BWK A;  5JH3 A;  1EWO A;  1KHQ A;  3BPF A;  3N4C A;  2H7J A;  1PBH A;  3CBK A;  2DZY A;  3USV A;  2ATO A;  3LFY A;  1X9Y A;  2R9N A;  4OEL A;  2XU5 A;  3D6S A;  1U9V A;  3CH3 X;  3KSE A;  1KHP A;  2P86 A;  1MS6 A;  4YV8 A;  2YJ9 A;  1MHW A;  2HD5 A;  1NL6 A;  4Q8G A;  1Y4H A;  2JQG R;  1AYW A;  4PI3 A;  1MEM A;  3IOQ A;  1ITO A;  1YT7 A;  1EF7 A;  3P5V A;  1DEU A;  3IUT A;  3WXF A;  3DF0 A;  4QBB A;  2R9C A;  3QT4 A;  3GCB A;  4FK5 A;  1BP4 A;  4QRV A;  4I04 A;  1GEC E;  5CHV A;  1GMY A;  1CVZ A;  2VHS A;  3PNR A;  5F02 A;  1F2B A;  3K24 A;  2AYO A; 
#chains in the Genus database with same CATH topology
 4D8E A;  2FRA A;  3BBA A;  4MZS A;  4DMY A;  2BDZ A;  3KFQ A;  1DF0 A;  2DZZ A;  2FT2 A;  4QRG A;  3O0U A;  2R9M A;  4P6E A;  4QH6 A;  2PNS A;  2BTW A;  1CV8 A;  2AU1 A;  1YK7 A;  4W4U A;  2AYN A;  1CTE A;  3HWN A;  4ZUX U;  2P7U A;  1KFU L;  1PPO A;  3H89 A;  4P6G A;  3C9E A;  2GHU A;  4GUA A;  2J7Q A;  4CDF B;  1SP4 B;  3F75 A;  1QDQ A;  1SNK A;  4IUM A;  3WXE A;  2JTC A;  2Y6E A;  4RNA A;  5K16 A;  2O6X A;  4DMX A;  4YYR A;  4N79 A;  2DCA A;  2E00 A;  1U5I A;  3HHA A;  2P0R A;  1U9X A;  1PVJ A;  4BOQ A;  1AU4 A;  2R9O A;  3CBJ A;  1GLO A;  1PXV A;  3BB7 A;  3IV2 A;  2R9F A;  8PCH A;  3MOR A;  1AU3 A;  3PRM A;  4XUI A;  4YVA A;  4WA6 A;  4IP3 A;  4D8B A;  2E01 A;  3OVZ A;  4P16 A;  4RF1 A;  1KXR A;  3CH2 X;  2IPP B;  3H8C A;  3RNV A;  2FYE A;  5EF4 A;  1CS8 A;  2VHF A;  1MEG A;  5JZE A;  2HH5 A;  4REZ A;  3V6E A;  2R6N A;  1F2A A;  3QSD A;  3PSE A;  2FTD A;  3MTN A;  2F1G A;  3I3T A;  1YZB A;  2E02 A;  2HWK A;  4YYS A;  2AVW A;  1CSB B;  1NLJ A;  4QRX A;  1CJL A;  1HUC B;  2XU3 A;  5CVO B;  4X6I A;  1M6D A;  1PAD A;  1ZCM A;  1NQC A;  2AS8 A;  1CB5 A;  2YJC A;  3IHP A;  5FPW A;  2XU1 A;  3BPM A;  2NQA A;  3BOW A;  4N4Z A;  3OIS A;  3IMA A;  4PAD A;  3B79 A;  2PAD A;  4WUR A;  4YYU A;  2AUZ A;  3QJ3 A;  1Y08 A;  4OVZ B;  2ACT A;  4XZX A;  3BCN A;  5EZQ A;  1AYU A;  3OF9 A;  4MZO A;  5EGW A;  3I06 A;  7PCK A;  1BY8 A;  2NQD B;  4BOS A;  1XKG A;  3O65 A;  4W5B A;  3PHW A;  1ZIV A;  2OUL A;  1F2C A;  1PCI A;  4YYV A;  1FH0 A;  1S4V A;  4Q8H A;  1PIP A;  4RKX A;  3WXG A;  4BQV A;  3P5U A;  3PW3 A;  4G54 A;  5JA7 A;  3MJ5 A;  3PBH A;  1NPZ A;  2FUD A;  5CVM A;  3KWZ A;  2B1N A;  3N3G A;  3TNX A;  1AEC A;  4R3D A;  4HXD B;  2BTW B;  2ARY A;  2XU4 A;  9PAP A;  4OW0 A;  1QMY A;  4BOU A;  4XR7 A;  2DJF B;  1KFX L;  3H6S A;  4FJC A;  1IWD A;  1K3B B;  1VSN A;  1NB3 A;  4BOP A;  3KW9 A;  1U9Q X;  3LXS A;  1CPJ A;  2DC6 A;  4MSX A;  3KKU A;  4BSQ A;  3W31 A;  2NQI A;  4BOZ A;  1O0E A;  1DKI A;  1JQP A;  2G7Y A;  5PAD A;  2CIO A;  1MDW A;  2FE8 A;  4HWY A;  3IEJ A;  4AXM A;  2GFO A;  2AIM A;  2Z84 A;  4K7C A;  2JQF R;  2CB5 A;  4N8W A;  1YAL A;  3MHS A;  3AI8 A;  5A24 A;  2AUX A;  3K8U A;  2FRQ A;  2NQG A;  3RVV A;  5CHT A;  2DCD A;  1PPP A;  3P5W A;  3HHI A;  4KLB A;  1BGO A;  4PP2 E;  4BS6 A;  2E03 A;  1GCB A;  2F7D A;  4BPV A;  4RF0 A;  2Y5B A;  4AXL A;  1PPN A;  2UZJ A;  4FIP A;  2DC7 A;  2G6D A;  1TU6 A;  3RVX A;  4W5C A;  2YJ8 A;  4OEM A;  3K9M A;  3PDF A;  2AGA A;  3TMP A;  2WBF X;  1NB5 A;  6PAD A;  1AU0 A;  3PRP A;  1AU2 A;  5J94 A;  1A6R A;  1Q6K A;  1AYV A;  4CDE B;  4ZTB A;  5E6J A;  4CDC B;  4RY2 A;  2HXZ A;  1ME3 A;  2HHN A;  2IBI A;  2OZ2 A;  2DJG B;  1CQD A;  2BDL A;  3N3K A;  1POP A;  2YJ2 A;  4YYW A;  2DC9 A;  3H8B A;  3NHE A;  1QXP A;  4PP1 A;  1YK8 A;  2PBH A;  3W30 A;  1PE6 A;  3KWB X;  2OP3 A;  1EWL A;  1EWM A;  1TLO A;  4YYQ A;  1VJV A;  4CDD B;  5KO3 A;  3TRK A;  5CVN B;  1BQI A;  4CZW A;  2G8E A;  1AIM A;  1TL9 A;  3BC3 A;  4D8I A;  1EWP A;  2JRI A;  1STF E;  3PT2 A;  3PHX A;  2C0Y A;  3MTV A;  2DOS A;  1THE A;  3IFU A;  2DC8 A;  1PPD A;  2FO5 A;  2PRE A;  3M99 A;  3S3R A;  3V6C A;  3S3Q A;  4BS5 A;  1ME4 A;  3E1Z B;  3O1G A;  2G8J A;  2J7Q C;  4I07 A;  1MIR A;  2DCC A;  4PT5 A;  4I05 A;  1ATK A;  3MHH A;  3ZUA A;  3H7D A;  2FQ9 A;  1YVB A;  3KX1 A;  3RVW A;  1UKF A;  2B1M A;  1ICF A;  3F5V A;  3OF8 A;  1F29 A;  1U9W A;  4X6J A;  3U8E A;  3ZNH A;  3OVX A;  3HD3 A;  3P5X A;  3ERV A;  4X6H A;  2BU3 A;  2DCB A;  1QOL A;  2YJB A;  3BWK A;  3B21 A;  5JH3 A;  1EWO A;  1KHQ A;  3BPF A;  3N4C A;  2H7J A;  3OQC A;  1PBH A;  3CBK A;  2DZY A;  5EZS A;  3USV A;  4A5U A;  2ATO A;  3LFY A;  1X9Y A;  2R9N A;  4OEL A;  2XU5 A;  3D6S A;  1U9V A;  3CH3 X;  3KSE A;  1KHP A;  2P86 A;  1MS6 A;  4YV8 A;  3PHU A;  2YJ9 A;  1MHW A;  2HD5 A;  4M0W A;  3BY4 A;  1NL6 A;  1Y4H A;  2JQG R;  4Q8G A;  1AYW A;  4PI3 A;  1MEM A;  3IOQ A;  1ITO A;  1YT7 A;  3E9S A;  1EF7 A;  3P5V A;  1DEU A;  3IUT A;  4OVZ A;  3WXF A;  4MI7 A;  3DF0 A;  4QBB A;  2R9C A;  3QT4 A;  3GCB A;  4MM3 B;  4FK5 A;  1BP4 A;  4QRV A;  4I04 A;  1GEC E;  3MP2 A;  5CHV A;  1GMY A;  1CVZ A;  2VHS A;  3PNR A;  3C0R A;  5F02 A;  1F2B A;  3K24 A;  2AYO A; 
#chains in the Genus database with same CATH homology
 2FRA A;  4MZS A;  4DMY A;  2BDZ A;  3KFQ A;  1DF0 A;  2DZZ A;  2FT2 A;  4QRG A;  3O0U A;  2R9M A;  4P6E A;  1W4T A;  4QH6 A;  2PNS A;  1CV8 A;  2AU1 A;  1YK7 A;  4W4U A;  2AYN A;  1CTE A;  3HWN A;  4ZUX U;  2P7U A;  1KFU L;  1PPO A;  3H89 A;  4P6G A;  3C9E A;  2GHU A;  4CDF B;  1SP4 B;  3F75 A;  4GUZ A;  1QDQ A;  1SNK A;  3WXE A;  2Y6E A;  5K16 A;  2O6X A;  4DMX A;  4YYR A;  4N79 A;  2DCA A;  2E00 A;  1U5I A;  3HHA A;  2P0R A;  1U9X A;  1AU4 A;  2R9O A;  3CBJ A;  1GLO A;  1PXV A;  3IV2 A;  2R9F A;  8PCH A;  3MOR A;  1AU3 A;  2VFC A;  4XUI A;  4YVA A;  4WA6 A;  2E01 A;  3OVZ A;  1KXR A;  3CH2 X;  2IPP B;  3H8C A;  2FYE A;  5EF4 A;  1CS8 A;  2VHF A;  1MEG A;  2HH5 A;  1W5R A;  3V6E A;  2R6N A;  1F2A A;  3QSD A;  2FTD A;  3MTN A;  2F1G A;  3I3T A;  2E02 A;  4YYS A;  2VFB A;  2AVW A;  1CSB B;  1NLJ A;  4QRX A;  1CJL A;  1W6F A;  1HUC B;  2XU3 A;  5CVO B;  4X6I A;  1M6D A;  1PAD A;  1ZCM A;  1NQC A;  2AS8 A;  4B55 A;  1CB5 A;  2YJC A;  3IHP A;  5FPW A;  2XU1 A;  3BPM A;  2NQA A;  3BOW A;  4N4Z A;  3OIS A;  3IMA A;  4PAD A;  3B79 A;  2PAD A;  4YYU A;  2AUZ A;  3QJ3 A;  1Y08 A;  2ACT A;  3BCN A;  1AYU A;  3OF9 A;  4MZO A;  5EGW A;  3I06 A;  7PCK A;  1BY8 A;  2NQD B;  1XKG A;  4W5B A;  1ZIV A;  2OUL A;  1F2C A;  1PCI A;  4YYV A;  1FH0 A;  1S4V A;  4Q8H A;  1PIP A;  3WXG A;  4BQV A;  3P5U A;  3PW3 A;  4G54 A;  5JA7 A;  3PBH A;  1NPZ A;  2FUD A;  5CVM A;  3KWZ A;  2B1N A;  3N3G A;  3TNX A;  1AEC A;  2ARY A;  2XU4 A;  9PAP A;  1QMY A;  4XR7 A;  2DJF B;  1KFX L;  3H6S A;  4FJC A;  1IWD A;  1K3B B;  1VSN A;  1NB3 A;  3KW9 A;  1U9Q X;  3LXS A;  1CPJ A;  2DC6 A;  4MSX A;  3KKU A;  4BSQ A;  2NQI A;  1O0E A;  1JQP A;  2G7Y A;  2BSZ A;  5PAD A;  2CIO A;  1MDW A;  4HWY A;  3IEJ A;  4AXM A;  2GFO A;  2AIM A;  4K7C A;  2JQF R;  2CB5 A;  4N8W A;  1YAL A;  3MHS A;  3AI8 A;  5A24 A;  2AUX A;  3K8U A;  2FRQ A;  2NQG A;  3RVV A;  3LTW A;  5CHT A;  1E2T A;  2DCD A;  1PPP A;  3P5W A;  3HHI A;  4KLB A;  1BGO A;  4PP2 E;  4BS6 A;  2E03 A;  1GCB A;  2F7D A;  4BPV A;  2Y5B A;  4AXL A;  1PPN A;  4FIP A;  2DC7 A;  2G6D A;  1TU6 A;  3RVX A;  4W5C A;  2YJ8 A;  4OEM A;  3K9M A;  3PDF A;  2WBF X;  1NB5 A;  6PAD A;  1AU0 A;  1AU2 A;  5J94 A;  1A6R A;  1Q6K A;  1AYV A;  4CDE B;  3D9W A;  4CDC B;  4RY2 A;  2HXZ A;  1ME3 A;  2HHN A;  2IBI A;  2OZ2 A;  2DJG B;  4NV8 A;  1CQD A;  2BDL A;  3N3K A;  1POP A;  2YJ2 A;  4YYW A;  2DC9 A;  3H8B A;  3NHE A;  1QXP A;  4PP1 A;  1YK8 A;  2PBH A;  1PE6 A;  3KWB X;  2OP3 A;  1EWL A;  1EWM A;  1TLO A;  4YYQ A;  1VJV A;  4CDD B;  4C5P A;  5CVN B;  1BQI A;  4CZW A;  2G8E A;  1AIM A;  1TL9 A;  3BC3 A;  1EWP A;  1STF E;  2C0Y A;  1THE A;  2DC8 A;  1PPD A;  2FO5 A;  2PRE A;  3M99 A;  3S3R A;  3V6C A;  3S3Q A;  4BS5 A;  4BGF A;  1ME4 A;  3E1Z B;  3O1G A;  2G8J A;  4I07 A;  1MIR A;  2DCC A;  4I05 A;  1ATK A;  3MHH A;  3ZUA A;  3H7D A;  2FQ9 A;  1YVB A;  3KX1 A;  3RVW A;  2B1M A;  1ICF A;  3F5V A;  3OF8 A;  1F29 A;  1U9W A;  4X6J A;  3U8E A;  3OVX A;  3HD3 A;  3P5X A;  3ERV A;  4X6H A;  2DCB A;  1QOL A;  2YJB A;  3BWK A;  5JH3 A;  1EWO A;  1KHQ A;  3BPF A;  3N4C A;  2H7J A;  1PBH A;  3CBK A;  2DZY A;  3USV A;  2ATO A;  3LFY A;  1X9Y A;  1GX3 A;  2R9N A;  4OEL A;  2XU5 A;  3D6S A;  1U9V A;  4NV7 A;  3CH3 X;  3KSE A;  1KHP A;  2P86 A;  1MS6 A;  4YV8 A;  2YJ9 A;  1MHW A;  2HD5 A;  1NL6 A;  1Y4H A;  2JQG R;  4Q8G A;  1AYW A;  4PI3 A;  1MEM A;  3IOQ A;  1ITO A;  1YT7 A;  1EF7 A;  3P5V A;  1DEU A;  3IUT A;  3WXF A;  3DF0 A;  4QBB A;  2R9C A;  3QT4 A;  3GCB A;  4FK5 A;  1BP4 A;  4QRV A;  4I04 A;  1GEC E;  5CHV A;  1GMY A;  1CVZ A;  2VHS A;  3PNR A;  5F02 A;  1F2B A;  3K24 A;  2AYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...