1MS6A

Dipeptide nitrile inhibitor bound to cathepsin s.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Design and synthesis of dipeptide nitriles as reversible and potent Cathepsin S inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ms6A00
2IPPB 1O0EA 4HWYA 2F1GA 4CDDB 3HWNA 1BQIA 1NPZA 4CDCB 3IV2A 2PNSA 2DJGB 3BPMA 1NB5A 1ME3A 2FYEA 3KW9A 2FT2A 5CHVA 1PPDA 2DC9A 3O0UA 1KHPA 1YK7A 2G6DA 2O6XA 3IUTA 1GLOA 1Q6KA 1NB3A 2G8EA 3K24A 2AVWA 3F5VA 2GFOA 3MTNA 5F02A 1U9XA 1KHQA 1PXVA 1ATKA 4YYQA 1PPOA 1AYWA 4X6JA 2OZ2A 3OF8A 3RVWA 2FO5A 3V6CA 2XU3A 5CVNB 1CVZA 2GHUA 1F2CA 4YYRA 1YK8A 2R9MA 3O1GA 2P0RA 2F7DA 2NQIA 2DC6A 2Y6EA 3AI8A 2NQGA 5A24A 3E1ZB 2CB5A 2AYNA 3PW3A 2ARYA 1CB5A 4I07A 1CQDA 1KXRA 5FPWA 1SNKA 1DEUA 1QXPA 1EWOA 2VHSA 3M99A 3IHPA 4CDFB 4N4ZA 1FH0A 1DF0A 4YYUA 5J94A 4QH6A 3KFQA 1YVBA 2DCAA 1CV8A 4OELA 3P5XA 3I3TA 4MZOA 2AYOA 1NLJA 3DF0A 5EF4A 2P7UA 2B1NA 2FUDA 1PIPA 1YT7A 3OVZA 1MS6A 1BP4A 4WA6A 3MHHA 3ERVA 3MORA 1AU2A 3KX1A 3CH3X 5CHTA 1PCIA 2R9CA 3KKUA 3HHIA 4CDEB 1HUCB 1VJVA 1QDQA 2AUXA 3N3KA 1YALA 3TNXA 1MHWA 4FIPA 1AYVA 4BS5A 4W5CA 4XUIA 4BQVA 2HH5A 1AU4A 4K7CA 2AUZA 3BOWA 3B79A 3OF9A 4W4UA 3BC3A 1TLOA 1U9VA 1TL9A 1POPA 4QRVA 2AS8A 4XR7A 2ATOA 1F2BA 2DC7A 1EWLA 3BCNA 1U9WA 1AYUA 2NQAA 3BWKA 5K16A 1F29A 1CJLA 3H89A 1KFXL 4N79A 2DZYA 2E03A 5JH3A 2OULA 4Q8GA 4FJCA 2R9FA 1PPPA 3S3QA 1AIMA 3HD3A 4QRGA 2IBIA 4CZWA 3NHEA 3H6SA 1AECA 2DC8A 3RVVA 2R6NA 3P5WA 2B1MA 4W5BA 2Y5BA 3N4CA 4RY2A 3ZUAA 1X9YA 2BDZA 4YYWA 3KWZA 3PDFA 1M6DA 2DCDA 3F75A 3S3RA 1NQCA 2AIMA 2JQGR 4PI3A 4FK5A 1ME4A 3QT4A 2HHNA 1ICFA 3IEJA 6PADA 4YYSA 2XU5A 1THEA 9PAPA 1SP4B 3C9EA 3WXFA 1CS8A 1PADA 3LXSA 1QOLA 3IMAA 1GCBA 4BPVA 2PREA 2DCBA 4MSXA 1EWPA 2FRQA 3OVXA 2NQDB 1PBHA 5CVMA 3CH2X 4YV8A 1CTEA 1AU0A 4I04A 4OEMA 1BGOA 2E00A 4X6HA 2YJ8A 1STFE 1S4VA 1XKGA 3H8BA 1CPJA 2R9NA 8PCHA 5JA7A 3WXGA 1BY8A 2E01A 1JQPA 2ACTA 7PCKA 2HD5A 3V6EA 1MIRA 4P6EA 1A6RA 4KLBA 4YYVA 1GMYA 1TU6A 4AXLA 2G7YA 3H8CA 4Q8HA 1MEGA 2H7JA 4QBBA 2YJBA 1PPNA 2XU1A 3I06A 2HXZA 3KSEA 3D6SA 4I05A 2P86A 1ZCMA 1NL6A 4N8WA 1K3BB 3N3GA 4AXMA 2VHFA 4DMYA 3H7DA 2DJFB 2OP3A 2YJCA 5PADA 1GECE 2FRAA 4BS6A 2AU1A 3K8UA 2R9OA 3IOQA 4MZSA 4YVAA 3P5VA 1AU3A 4X6IA 4BSQA 1IWDA 3HHAA 2XU4A 3OISA 2FQ9A 5CVOB 1PE6A 3P5UA 4P6GA 2DZZA 3CBJA 4PADA 3MHSA 4G54A 1ITOA 3PBHA 4PP2E 1QMYA 2PADA 2G8JA 3KWBX 1KFUL 1U9QX 2E02A 1CSBB 1MEMA 1F2AA 1ZIVA 3K9MA 1MDWA 4QRXA 2YJ9A 4PP1A 3U8EA 1U5IA 2YJ2A 4DMXA 3WXEA 2FTDA 2CIOA 2JQFR 4ZUXU 2BDLA 1Y4HA 1VSNA 3GCBA 1EWMA 3LFYA 1EF7A 3BPFA 3CBKA 2C0YA 1Y08A 2PBHA 5EGWA 3USVA 3PNRA 3QJ3A 3QSDA 3RVXA 2WBFX 2DCCA
chains in the Genus database with same CATH superfamily
2IPPB 1O0EA 4HWYA 2F1GA 4CDDB 3HWNA 3E9SA 1BQIA 1NPZA 4CDCB 3IV2A 2PNSA 2DJGB 3BPMA 1NB5A 1ME3A 2FYEA 3KW9A 2FT2A 5CHVA 1PPDA 2DC9A 3O0UA 1KHPA 1YK7A 2G6DA 2O6XA 3IUTA 1GLOA 1Q6KA 1NB3A 2G8EA 3K24A 2AVWA 3F5VA 2GFOA 3MTNA 5F02A 1U9XA 1KHQA 1PXVA 1ATKA 4YYQA 1PPOA 1AYWA 1DKIA 1PVJA 4X6JA 2OZ2A 3TRKA 3OQCA 4BOPA 3MP2A 3OF8A 3RVWA 2FO5A 3V6CA 2XU3A 5CVNB 1CVZA 2GHUA 1F2CA 4M0WA 4YYRA 1YK8A 2R9MA 3O1GA 2P0RA 2F7DA 4BOZA 4ZTBA 5EZQA 2NQIA 2DC6A 2Y6EA 3AI8A 2NQGA 5A24A 3E1ZB 2CB5A 3PHUA 3RNVA 4OVZB 2AYNA 4D8EA 3PW3A 2ARYA 1CB5A 4I07A 1CQDA 1KXRA 5FPWA 1SNKA 1DEUA 4XZXA 1QXPA 1EWOA 2VHSA 3M99A 3IHPA 4CDFB 3PSEA 3PT2A 4N4ZA 4D8BA 1FH0A 4R3DA 2Z84A 3PRPA 1DF0A 4YYUA 5J94A 4QH6A 3KFQA 4D8IA 1YVBA 2DCAA 1CV8A 2JTCA 5JZEA 3C0RA 4OELA 3P5XA 4P16A 3I3TA 2AYOA 4MZOA 4MM3B 1NLJA 3DF0A 5EF4A 2P7UA 2B1NA 2FUDA 1PIPA 1YT7A 4IP3A 3OVZA 1MS6A 1BP4A 4WA6A 3MHHA 3ERVA 3MORA 1AU2A 3KX1A 3CH3X 5CHTA 1PCIA 2R9CA 3KKUA 3HHIA 4CDEB 1HUCB 1VJVA 1QDQA 2AUXA 3N3KA 1YALA 3TNXA 3PHXA 1MHWA 4FIPA 1AYVA 4BS5A 4W5CA 4XUIA 4BQVA 1YZBA 2HH5A 1AU4A 4K7CA 4A5UA 2AUZA 3BOWA 2BTWA 3B79A 3OF9A 4W4UA 3BC3A 1TLOA 1U9VA 4WURA 1TL9A 1POPA 4QRVA 2AS8A 4XR7A 2ATOA 1F2BA 2J7QC 2DC7A 1EWLA 3BCNA 1U9WA 3ZNHA 1AYUA 2NQAA 3BWKA 2DOSA 5K16A 1F29A 1CJLA 3H89A 1KFXL 4OW0A 4N79A 2DZYA 2E03A 5JH3A 2J7QA 2OULA 4Q8GA 4FJCA 2R9FA 1PPPA 3S3QA 5KO3A 2AGAA 1AIMA 3HD3A 4QRGA 2IBIA 3IFUA 4CZWA 3PHWA 3NHEA 3H6SA 1AECA 2DC8A 3RVVA 2R6NA 3P5WA 2B1MA 4W5BA 2Y5BA 3N4CA 3MTVA 2UZJA 4RY2A 3ZUAA 4REZA 1X9YA 2BDZA 4YYWA 3KWZA 3PDFA 1M6DA 2DCDA 3F75A 3S3RA 1NQCA 2AIMA 2JQGR 4PI3A 3BB7A 5E6JA 4FK5A 1ME4A 3QT4A 2HHNA 1ICFA 3IEJA 6PADA 4YYSA 2XU5A 4GUAA 1THEA 2BU3A 4HXDB 9PAPA 1SP4B 3C9EA 3WXFA 3BY4A 1CS8A 1PADA 3TMPA 3LXSA 1QOLA 3IMAA 1GCBA 4BPVA 2PREA 2DCBA 4MSXA 1EWPA 2FRQA 3OVXA 2NQDB 1PBHA 3W30A 5CVMA 3CH2X 4YV8A 1CTEA 1AU0A 4I04A 2FE8A 4RF0A 4OEMA 1BGOA 2E00A 4X6HA 2YJ8A 1STFE 1S4VA 1XKGA 3B21A 3MJ5A 3H8BA 1CPJA 2R9NA 8PCHA 5JA7A 4PT5A 1BY8A 2E01A 3WXGA 1JQPA 2ACTA 7PCKA 2BTWB 2HD5A 3V6EA 1MIRA 4P6EA 1A6RA 4KLBA 4YYVA 1GMYA 1TU6A 4AXLA 2G7YA 3H8CA 4Q8HA 3O65A 1MEGA 2H7JA 4QBBA 2YJBA 4IUMA 4BOQA 1PPNA 2XU1A 3I06A 2HXZA 3KSEA 3PRMA 3W31A 3D6SA 4I05A 2P86A 1ZCMA 1NL6A 4N8WA 1K3BB 3N3GA 4AXMA 2VHFA 4DMYA 3H7DA 2DJFB 2OP3A 2YJCA 5PADA 1GECE 2FRAA 4BS6A 2AU1A 3K8UA 2R9OA 3IOQA 4MZSA 4YVAA 3P5VA 1AU3A 4X6IA 4OVZA 1IWDA 4BSQA 5EZSA 3HHAA 2XU4A 3OISA 4MI7A 4RF1A 2FQ9A 4BOSA 5CVOB 1PE6A 3P5UA 4P6GA 2DZZA 3CBJA 4PADA 3MHSA 4G54A 1ITOA 3PBHA 4PP2E 1QMYA 2PADA 2G8JA 3KWBX 4BOUA 1KFUL 1U9QX 2E02A 1CSBB 1MEMA 1F2AA 1ZIVA 3K9MA 1MDWA 4QRXA 2YJ9A 4PP1A 2HWKA 3U8EA 1U5IA 2YJ2A 4DMXA 3WXEA 2JRIA 2FTDA 2CIOA 2JQFR 4ZUXU 2BDLA 1Y4HA 1VSNA 3GCBA 1EWMA 1UKFA 3LFYA 1EF7A 3BPFA 3CBKA 3BBAA 2C0YA 4RKXA 1Y08A 2PBHA 5EGWA 3USVA 3PNRA 3QJ3A 3QSDA 3RVXA 2WBFX 4RNAA 2DCCA
chains in the Genus database with same CATH topology
2IPPB 1O0EA 4HWYA 2VFCA 2F1GA 4CDDB 3HWNA 1BQIA 1NPZA 4CDCB 3IV2A 2PNSA 2DJGB 1W5RA 3BPMA 1NB5A 1ME3A 2FYEA 3KW9A 2FT2A 5CHVA 1PPDA 2DC9A 3O0UA 1KHPA 1YK7A 2G6DA 2O6XA 1W4TA 3IUTA 1GLOA 1Q6KA 1NB3A 2G8EA 3K24A 2AVWA 3F5VA 2GFOA 3MTNA 5F02A 1U9XA 1KHQA 1PXVA 1ATKA 4YYQA 1PPOA 1AYWA 4X6JA 2OZ2A 3OF8A 3RVWA 3LTWA 2FO5A 3V6CA 2XU3A 5CVNB 1CVZA 2GHUA 1F2CA 4YYRA 1YK8A 2R9MA 4B55A 3O1GA 2P0RA 2F7DA 2NQIA 2DC6A 2Y6EA 3AI8A 2NQGA 5A24A 3E1ZB 2CB5A 2AYNA 3PW3A 1E2TA 2ARYA 4NV8A 1CB5A 4I07A 1CQDA 1KXRA 5FPWA 1SNKA 1DEUA 1QXPA 1EWOA 2VHSA 3M99A 3IHPA 4CDFB 4N4ZA 1FH0A 1DF0A 4YYUA 5J94A 4QH6A 3KFQA 1YVBA 2DCAA 1CV8A 4OELA 3P5XA 3I3TA 4MZOA 2AYOA 1W6FA 1NLJA 3DF0A 5EF4A 2P7UA 2B1NA 2FUDA 1PIPA 4BGFA 1YT7A 3OVZA 1MS6A 1BP4A 4WA6A 3MHHA 3ERVA 3MORA 1AU2A 3KX1A 3CH3X 5CHTA 1PCIA 2R9CA 3KKUA 3HHIA 4CDEB 1HUCB 1VJVA 1QDQA 2AUXA 3D9WA 1YALA 3N3KA 3TNXA 1MHWA 4FIPA 1AYVA 4BS5A 4W5CA 4XUIA 4BQVA 2HH5A 1AU4A 4K7CA 2AUZA 3BOWA 3B79A 3OF9A 4W4UA 3BC3A 1TLOA 1U9VA 1TL9A 1POPA 4QRVA 2AS8A 4XR7A 2ATOA 1F2BA 2DC7A 4C5PA 1EWLA 3BCNA 1U9WA 1AYUA 2NQAA 3BWKA 5K16A 1F29A 1CJLA 3H89A 1KFXL 4N79A 2DZYA 2E03A 5JH3A 2OULA 4Q8GA 4FJCA 2R9FA 1PPPA 3S3QA 1AIMA 3HD3A 4QRGA 2IBIA 4CZWA 3NHEA 3H6SA 1AECA 2DC8A 3RVVA 2R6NA 3P5WA 2B1MA 4W5BA 2Y5BA 3N4CA 4RY2A 3ZUAA 2BSZA 1X9YA 2BDZA 4YYWA 3KWZA 3PDFA 1M6DA 2DCDA 3F75A 3S3RA 1NQCA 2AIMA 2JQGR 4PI3A 4FK5A 1ME4A 3QT4A 2HHNA 1ICFA 3IEJA 6PADA 4YYSA 2XU5A 1THEA 9PAPA 1SP4B 3C9EA 3WXFA 1CS8A 1PADA 3LXSA 1QOLA 3IMAA 1GCBA 4BPVA 2PREA 2DCBA 4MSXA 1EWPA 2FRQA 3OVXA 2NQDB 1PBHA 5CVMA 3CH2X 4YV8A 1CTEA 1AU0A 4I04A 4OEMA 4GUZA 1BGOA 2E00A 4X6HA 2YJ8A 1STFE 1S4VA 1XKGA 3H8BA 1CPJA 2R9NA 8PCHA 5JA7A 3WXGA 1BY8A 2E01A 1JQPA 4NV7A 2ACTA 7PCKA 2HD5A 3V6EA 1MIRA 4P6EA 1A6RA 4KLBA 4YYVA 1GMYA 1TU6A 4AXLA 2G7YA 3H8CA 4Q8HA 1MEGA 2H7JA 4QBBA 2YJBA 1PPNA 2XU1A 3I06A 2HXZA 3KSEA 3D6SA 4I05A 2P86A 1ZCMA 1NL6A 4N8WA 1K3BB 3N3GA 4AXMA 2VHFA 4DMYA 3H7DA 2DJFB 2OP3A 2YJCA 5PADA 1GECE 2FRAA 4BS6A 2AU1A 3K8UA 2R9OA 3IOQA 4MZSA 4YVAA 3P5VA 1AU3A 4X6IA 4BSQA 1IWDA 3HHAA 2XU4A 3OISA 2FQ9A 5CVOB 1PE6A 3P5UA 4P6GA 2DZZA 3CBJA 4PADA 3MHSA 4G54A 1ITOA 3PBHA 4PP2E 1QMYA 2PADA 2G8JA 3KWBX 1KFUL 1U9QX 2E02A 1CSBB 1MEMA 1F2AA 1ZIVA 3K9MA 1MDWA 4QRXA 2YJ9A 4PP1A 3U8EA 1U5IA 2YJ2A 4DMXA 3WXEA 2FTDA 2CIOA 2JQFR 4ZUXU 2BDLA 1Y4HA 1GX3A 1VSNA 2VFBA 3GCBA 1EWMA 3LFYA 1EF7A 3BPFA 3CBKA 2C0YA 1Y08A 2PBHA 5EGWA 3USVA 3PNRA 3QJ3A 3QSDA 3RVXA 2WBFX 2DCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPP B;  1O0E A;  4HWY A;  2F1G A;  4CDD B;  3HWN A;  1BQI A;  1NPZ A;  4CDC B;  3IV2 A;  2PNS A;  2DJG B;  3BPM A;  1NB5 A;  1ME3 A;  2FYE A;  3KW9 A;  2FT2 A;  5CHV A;  1PPD A;  2DC9 A;  3O0U A;  1KHP A;  1YK7 A;  2G6D A;  2O6X A;  3IUT A;  1GLO A;  1Q6K A;  1NB3 A;  2G8E A;  3K24 A;  2AVW A;  3F5V A;  2GFO A;  3MTN A;  5F02 A;  1U9X A;  1KHQ A;  1PXV A;  1ATK A;  4YYQ A;  1PPO A;  1AYW A;  4X6J A;  2OZ2 A;  3OF8 A;  3RVW A;  2FO5 A;  3V6C A;  2XU3 A;  5CVN B;  1CVZ A;  2GHU A;  1F2C A;  4YYR A;  1YK8 A;  2R9M A;  3O1G A;  2P0R A;  2F7D A;  2NQI A;  2DC6 A;  2Y6E A;  3AI8 A;  2NQG A;  5A24 A;  3E1Z B;  2CB5 A;  2AYN A;  3PW3 A;  2ARY A;  1CB5 A;  4I07 A;  1CQD A;  1KXR A;  5FPW A;  1SNK A;  1DEU A;  1QXP A;  1EWO A;  2VHS A;  3M99 A;  3IHP A;  4CDF B;  4N4Z A;  1FH0 A;  1DF0 A;  4YYU A;  5J94 A;  4QH6 A;  3KFQ A;  1YVB A;  2DCA A;  1CV8 A;  4OEL A;  3P5X A;  3I3T A;  4MZO A;  2AYO A;  1NLJ A;  3DF0 A;  5EF4 A;  2P7U A;  2B1N A;  2FUD A;  1PIP A;  1YT7 A;  3OVZ A;  1MS6 A;  1BP4 A;  4WA6 A;  3MHH A;  3ERV A;  3MOR A;  1AU2 A;  3KX1 A;  3CH3 X;  5CHT A;  1PCI A;  2R9C A;  3KKU A;  3HHI A;  4CDE B;  1HUC B;  1VJV A;  1QDQ A;  2AUX A;  3N3K A;  1YAL A;  3TNX A;  1MHW A;  4FIP A;  1AYV A;  4BS5 A;  4W5C A;  4XUI A;  4BQV A;  2HH5 A;  1AU4 A;  4K7C A;  2AUZ A;  3BOW A;  3B79 A;  3OF9 A;  4W4U A;  3BC3 A;  1TLO A;  1U9V A;  1TL9 A;  1POP A;  4QRV A;  2AS8 A;  4XR7 A;  2ATO A;  1F2B A;  2DC7 A;  1EWL A;  3BCN A;  1U9W A;  1AYU A;  2NQA A;  3BWK A;  5K16 A;  1F29 A;  1CJL A;  3H89 A;  1KFX L;  4N79 A;  2DZY A;  2E03 A;  5JH3 A;  2OUL A;  4Q8G A;  4FJC A;  2R9F A;  1PPP A;  3S3Q A;  1AIM A;  3HD3 A;  4QRG A;  2IBI A;  4CZW A;  3NHE A;  3H6S A;  1AEC A;  2DC8 A;  3RVV A;  2R6N A;  3P5W A;  2B1M A;  4W5B A;  2Y5B A;  3N4C A;  4RY2 A;  3ZUA A;  1X9Y A;  2BDZ A;  4YYW A;  3KWZ A;  3PDF A;  1M6D A;  2DCD A;  3F75 A;  3S3R A;  1NQC A;  2AIM A;  2JQG R;  4PI3 A;  4FK5 A;  1ME4 A;  3QT4 A;  2HHN A;  1ICF A;  3IEJ A;  6PAD A;  4YYS A;  2XU5 A;  1THE A;  9PAP A;  1SP4 B;  3C9E A;  3WXF A;  1CS8 A;  1PAD A;  3LXS A;  1QOL A;  3IMA A;  1GCB A;  4BPV A;  2PRE A;  2DCB A;  4MSX A;  1EWP A;  2FRQ A;  3OVX A;  2NQD B;  1PBH A;  5CVM A;  3CH2 X;  4YV8 A;  1CTE A;  1AU0 A;  4I04 A;  4OEM A;  1BGO A;  2E00 A;  4X6H A;  2YJ8 A;  1STF E;  1S4V A;  1XKG A;  3H8B A;  1CPJ A;  2R9N A;  8PCH A;  5JA7 A;  3WXG A;  1BY8 A;  2E01 A;  1JQP A;  2ACT A;  7PCK A;  2HD5 A;  3V6E A;  1MIR A;  4P6E A;  1A6R A;  4KLB A;  4YYV A;  1GMY A;  1TU6 A;  4AXL A;  2G7Y A;  3H8C A;  4Q8H A;  1MEG A;  2H7J A;  4QBB A;  2YJB A;  1PPN A;  2XU1 A;  3I06 A;  2HXZ A;  3KSE A;  3D6S A;  4I05 A;  2P86 A;  1ZCM A;  1NL6 A;  4N8W A;  1K3B B;  3N3G A;  4AXM A;  2VHF A;  4DMY A;  3H7D A;  2DJF B;  2OP3 A;  2YJC A;  5PAD A;  1GEC E;  2FRA A;  4BS6 A;  2AU1 A;  3K8U A;  2R9O A;  3IOQ A;  4MZS A;  4YVA A;  3P5V A;  1AU3 A;  4X6I A;  4BSQ A;  1IWD A;  3HHA A;  2XU4 A;  3OIS A;  2FQ9 A;  5CVO B;  1PE6 A;  3P5U A;  4P6G A;  2DZZ A;  3CBJ A;  4PAD A;  3MHS A;  4G54 A;  1ITO A;  3PBH A;  4PP2 E;  1QMY A;  2PAD A;  2G8J A;  3KWB X;  1KFU L;  1U9Q X;  2E02 A;  1CSB B;  1MEM A;  1F2A A;  1ZIV A;  3K9M A;  1MDW A;  4QRX A;  2YJ9 A;  4PP1 A;  3U8E A;  1U5I A;  2YJ2 A;  4DMX A;  3WXE A;  2FTD A;  2CIO A;  2JQF R;  4ZUX U;  2BDL A;  1Y4H A;  1VSN A;  3GCB A;  1EWM A;  3LFY A;  1EF7 A;  3BPF A;  3CBK A;  2C0Y A;  1Y08 A;  2PBH A;  5EGW A;  3USV A;  3PNR A;  3QJ3 A;  3QSD A;  3RVX A;  2WBF X;  2DCC A; 
#chains in the Genus database with same CATH topology
 2IPP B;  1O0E A;  4HWY A;  2F1G A;  4CDD B;  3HWN A;  3E9S A;  1BQI A;  1NPZ A;  4CDC B;  3IV2 A;  2PNS A;  2DJG B;  3BPM A;  1NB5 A;  1ME3 A;  2FYE A;  3KW9 A;  2FT2 A;  5CHV A;  1PPD A;  2DC9 A;  3O0U A;  1KHP A;  1YK7 A;  2G6D A;  2O6X A;  3IUT A;  1GLO A;  1Q6K A;  1NB3 A;  2G8E A;  3K24 A;  2AVW A;  3F5V A;  2GFO A;  3MTN A;  5F02 A;  1U9X A;  1KHQ A;  1PXV A;  1ATK A;  4YYQ A;  1PPO A;  1AYW A;  1DKI A;  1PVJ A;  4X6J A;  2OZ2 A;  3TRK A;  3OQC A;  4BOP A;  3MP2 A;  3OF8 A;  3RVW A;  2FO5 A;  3V6C A;  2XU3 A;  5CVN B;  1CVZ A;  2GHU A;  1F2C A;  4M0W A;  4YYR A;  1YK8 A;  2R9M A;  3O1G A;  2P0R A;  2F7D A;  4BOZ A;  4ZTB A;  5EZQ A;  2NQI A;  2DC6 A;  2Y6E A;  3AI8 A;  2NQG A;  5A24 A;  3E1Z B;  2CB5 A;  3PHU A;  3RNV A;  4OVZ B;  2AYN A;  4D8E A;  3PW3 A;  2ARY A;  1CB5 A;  4I07 A;  1CQD A;  1KXR A;  5FPW A;  1SNK A;  1DEU A;  4XZX A;  1QXP A;  1EWO A;  2VHS A;  3M99 A;  3IHP A;  4CDF B;  3PSE A;  3PT2 A;  4N4Z A;  4D8B A;  1FH0 A;  4R3D A;  2Z84 A;  3PRP A;  1DF0 A;  4YYU A;  5J94 A;  4QH6 A;  3KFQ A;  4D8I A;  1YVB A;  2DCA A;  1CV8 A;  2JTC A;  5JZE A;  3C0R A;  4OEL A;  3P5X A;  4P16 A;  3I3T A;  2AYO A;  4MZO A;  4MM3 B;  1NLJ A;  3DF0 A;  5EF4 A;  2P7U A;  2B1N A;  2FUD A;  1PIP A;  1YT7 A;  4IP3 A;  3OVZ A;  1MS6 A;  1BP4 A;  4WA6 A;  3MHH A;  3ERV A;  3MOR A;  1AU2 A;  3KX1 A;  3CH3 X;  5CHT A;  1PCI A;  2R9C A;  3KKU A;  3HHI A;  4CDE B;  1HUC B;  1VJV A;  1QDQ A;  2AUX A;  3N3K A;  1YAL A;  3TNX A;  3PHX A;  1MHW A;  4FIP A;  1AYV A;  4BS5 A;  4W5C A;  4XUI A;  4BQV A;  1YZB A;  2HH5 A;  1AU4 A;  4K7C A;  4A5U A;  2AUZ A;  3BOW A;  2BTW A;  3B79 A;  3OF9 A;  4W4U A;  3BC3 A;  1TLO A;  1U9V A;  4WUR A;  1TL9 A;  1POP A;  4QRV A;  2AS8 A;  4XR7 A;  2ATO A;  1F2B A;  2J7Q C;  2DC7 A;  1EWL A;  3BCN A;  1U9W A;  3ZNH A;  1AYU A;  2NQA A;  3BWK A;  2DOS A;  5K16 A;  1F29 A;  1CJL A;  3H89 A;  1KFX L;  4OW0 A;  4N79 A;  2DZY A;  2E03 A;  5JH3 A;  2J7Q A;  2OUL A;  4Q8G A;  4FJC A;  2R9F A;  1PPP A;  3S3Q A;  5KO3 A;  2AGA A;  1AIM A;  3HD3 A;  4QRG A;  2IBI A;  3IFU A;  4CZW A;  3PHW A;  3NHE A;  3H6S A;  1AEC A;  2DC8 A;  3RVV A;  2R6N A;  3P5W A;  2B1M A;  4W5B A;  2Y5B A;  3N4C A;  3MTV A;  2UZJ A;  4RY2 A;  3ZUA A;  4REZ A;  1X9Y A;  2BDZ A;  4YYW A;  3KWZ A;  3PDF A;  1M6D A;  2DCD A;  3F75 A;  3S3R A;  1NQC A;  2AIM A;  2JQG R;  4PI3 A;  3BB7 A;  5E6J A;  4FK5 A;  1ME4 A;  3QT4 A;  2HHN A;  1ICF A;  3IEJ A;  6PAD A;  4YYS A;  2XU5 A;  4GUA A;  1THE A;  2BU3 A;  4HXD B;  9PAP A;  1SP4 B;  3C9E A;  3WXF A;  3BY4 A;  1CS8 A;  1PAD A;  3TMP A;  3LXS A;  1QOL A;  3IMA A;  1GCB A;  4BPV A;  2PRE A;  2DCB A;  4MSX A;  1EWP A;  2FRQ A;  3OVX A;  2NQD B;  1PBH A;  3W30 A;  5CVM A;  3CH2 X;  4YV8 A;  1CTE A;  1AU0 A;  4I04 A;  2FE8 A;  4RF0 A;  4OEM A;  1BGO A;  2E00 A;  4X6H A;  2YJ8 A;  1STF E;  1S4V A;  1XKG A;  3B21 A;  3MJ5 A;  3H8B A;  1CPJ A;  2R9N A;  8PCH A;  5JA7 A;  4PT5 A;  1BY8 A;  2E01 A;  3WXG A;  1JQP A;  2ACT A;  7PCK A;  2BTW B;  2HD5 A;  3V6E A;  1MIR A;  4P6E A;  1A6R A;  4KLB A;  4YYV A;  1GMY A;  1TU6 A;  4AXL A;  2G7Y A;  3H8C A;  4Q8H A;  3O65 A;  1MEG A;  2H7J A;  4QBB A;  2YJB A;  4IUM A;  4BOQ A;  1PPN A;  2XU1 A;  3I06 A;  2HXZ A;  3KSE A;  3PRM A;  3W31 A;  3D6S A;  4I05 A;  2P86 A;  1ZCM A;  1NL6 A;  4N8W A;  1K3B B;  3N3G A;  4AXM A;  2VHF A;  4DMY A;  3H7D A;  2DJF B;  2OP3 A;  2YJC A;  5PAD A;  1GEC E;  2FRA A;  4BS6 A;  2AU1 A;  3K8U A;  2R9O A;  3IOQ A;  4MZS A;  4YVA A;  3P5V A;  1AU3 A;  4X6I A;  4OVZ A;  1IWD A;  4BSQ A;  5EZS A;  3HHA A;  2XU4 A;  3OIS A;  4MI7 A;  4RF1 A;  2FQ9 A;  4BOS A;  5CVO B;  1PE6 A;  3P5U A;  4P6G A;  2DZZ A;  3CBJ A;  4PAD A;  3MHS A;  4G54 A;  1ITO A;  3PBH A;  4PP2 E;  1QMY A;  2PAD A;  2G8J A;  3KWB X;  4BOU A;  1KFU L;  1U9Q X;  2E02 A;  1CSB B;  1MEM A;  1F2A A;  1ZIV A;  3K9M A;  1MDW A;  4QRX A;  2YJ9 A;  4PP1 A;  2HWK A;  3U8E A;  1U5I A;  2YJ2 A;  4DMX A;  3WXE A;  2JRI A;  2FTD A;  2CIO A;  2JQF R;  4ZUX U;  2BDL A;  1Y4H A;  1VSN A;  3GCB A;  1EWM A;  1UKF A;  3LFY A;  1EF7 A;  3BPF A;  3CBK A;  3BBA A;  2C0Y A;  4RKX A;  1Y08 A;  2PBH A;  5EGW A;  3USV A;  3PNR A;  3QJ3 A;  3QSD A;  3RVX A;  2WBF X;  4RNA A;  2DCC A; 
#chains in the Genus database with same CATH homology
 2IPP B;  1O0E A;  4HWY A;  2VFC A;  2F1G A;  4CDD B;  3HWN A;  1BQI A;  1NPZ A;  4CDC B;  3IV2 A;  2PNS A;  2DJG B;  1W5R A;  3BPM A;  1NB5 A;  1ME3 A;  2FYE A;  3KW9 A;  2FT2 A;  5CHV A;  1PPD A;  2DC9 A;  3O0U A;  1KHP A;  1YK7 A;  2G6D A;  2O6X A;  1W4T A;  3IUT A;  1GLO A;  1Q6K A;  1NB3 A;  2G8E A;  3K24 A;  2AVW A;  3F5V A;  2GFO A;  3MTN A;  5F02 A;  1U9X A;  1KHQ A;  1PXV A;  1ATK A;  4YYQ A;  1PPO A;  1AYW A;  4X6J A;  2OZ2 A;  3OF8 A;  3RVW A;  3LTW A;  2FO5 A;  3V6C A;  2XU3 A;  5CVN B;  1CVZ A;  2GHU A;  1F2C A;  4YYR A;  1YK8 A;  2R9M A;  4B55 A;  3O1G A;  2P0R A;  2F7D A;  2NQI A;  2DC6 A;  2Y6E A;  3AI8 A;  2NQG A;  5A24 A;  3E1Z B;  2CB5 A;  2AYN A;  3PW3 A;  1E2T A;  2ARY A;  4NV8 A;  1CB5 A;  4I07 A;  1CQD A;  1KXR A;  5FPW A;  1SNK A;  1DEU A;  1QXP A;  1EWO A;  2VHS A;  3M99 A;  3IHP A;  4CDF B;  4N4Z A;  1FH0 A;  1DF0 A;  4YYU A;  5J94 A;  4QH6 A;  3KFQ A;  1YVB A;  2DCA A;  1CV8 A;  4OEL A;  3P5X A;  3I3T A;  4MZO A;  2AYO A;  1W6F A;  1NLJ A;  3DF0 A;  5EF4 A;  2P7U A;  2B1N A;  2FUD A;  1PIP A;  4BGF A;  1YT7 A;  3OVZ A;  1MS6 A;  1BP4 A;  4WA6 A;  3MHH A;  3ERV A;  3MOR A;  1AU2 A;  3KX1 A;  3CH3 X;  5CHT A;  1PCI A;  2R9C A;  3KKU A;  3HHI A;  4CDE B;  1HUC B;  1VJV A;  1QDQ A;  2AUX A;  3D9W A;  1YAL A;  3N3K A;  3TNX A;  1MHW A;  4FIP A;  1AYV A;  4BS5 A;  4W5C A;  4XUI A;  4BQV A;  2HH5 A;  1AU4 A;  4K7C A;  2AUZ A;  3BOW A;  3B79 A;  3OF9 A;  4W4U A;  3BC3 A;  1TLO A;  1U9V A;  1TL9 A;  1POP A;  4QRV A;  2AS8 A;  4XR7 A;  2ATO A;  1F2B A;  2DC7 A;  4C5P A;  1EWL A;  3BCN A;  1U9W A;  1AYU A;  2NQA A;  3BWK A;  5K16 A;  1F29 A;  1CJL A;  3H89 A;  1KFX L;  4N79 A;  2DZY A;  2E03 A;  5JH3 A;  2OUL A;  4Q8G A;  4FJC A;  2R9F A;  1PPP A;  3S3Q A;  1AIM A;  3HD3 A;  4QRG A;  2IBI A;  4CZW A;  3NHE A;  3H6S A;  1AEC A;  2DC8 A;  3RVV A;  2R6N A;  3P5W A;  2B1M A;  4W5B A;  2Y5B A;  3N4C A;  4RY2 A;  3ZUA A;  2BSZ A;  1X9Y A;  2BDZ A;  4YYW A;  3KWZ A;  3PDF A;  1M6D A;  2DCD A;  3F75 A;  3S3R A;  1NQC A;  2AIM A;  2JQG R;  4PI3 A;  4FK5 A;  1ME4 A;  3QT4 A;  2HHN A;  1ICF A;  3IEJ A;  6PAD A;  4YYS A;  2XU5 A;  1THE A;  9PAP A;  1SP4 B;  3C9E A;  3WXF A;  1CS8 A;  1PAD A;  3LXS A;  1QOL A;  3IMA A;  1GCB A;  4BPV A;  2PRE A;  2DCB A;  4MSX A;  1EWP A;  2FRQ A;  3OVX A;  2NQD B;  1PBH A;  5CVM A;  3CH2 X;  4YV8 A;  1CTE A;  1AU0 A;  4I04 A;  4OEM A;  4GUZ A;  1BGO A;  2E00 A;  4X6H A;  2YJ8 A;  1STF E;  1S4V A;  1XKG A;  3H8B A;  1CPJ A;  2R9N A;  8PCH A;  5JA7 A;  3WXG A;  1BY8 A;  2E01 A;  1JQP A;  4NV7 A;  2ACT A;  7PCK A;  2HD5 A;  3V6E A;  1MIR A;  4P6E A;  1A6R A;  4KLB A;  4YYV A;  1GMY A;  1TU6 A;  4AXL A;  2G7Y A;  3H8C A;  4Q8H A;  1MEG A;  2H7J A;  4QBB A;  2YJB A;  1PPN A;  2XU1 A;  3I06 A;  2HXZ A;  3KSE A;  3D6S A;  4I05 A;  2P86 A;  1ZCM A;  1NL6 A;  4N8W A;  1K3B B;  3N3G A;  4AXM A;  2VHF A;  4DMY A;  3H7D A;  2DJF B;  2OP3 A;  2YJC A;  5PAD A;  1GEC E;  2FRA A;  4BS6 A;  2AU1 A;  3K8U A;  2R9O A;  3IOQ A;  4MZS A;  4YVA A;  3P5V A;  1AU3 A;  4X6I A;  4BSQ A;  1IWD A;  3HHA A;  2XU4 A;  3OIS A;  2FQ9 A;  5CVO B;  1PE6 A;  3P5U A;  4P6G A;  2DZZ A;  3CBJ A;  4PAD A;  3MHS A;  4G54 A;  1ITO A;  3PBH A;  4PP2 E;  1QMY A;  2PAD A;  2G8J A;  3KWB X;  1KFU L;  1U9Q X;  2E02 A;  1CSB B;  1MEM A;  1F2A A;  1ZIV A;  3K9M A;  1MDW A;  4QRX A;  2YJ9 A;  4PP1 A;  3U8E A;  1U5I A;  2YJ2 A;  4DMX A;  3WXE A;  2FTD A;  2CIO A;  2JQF R;  4ZUX U;  2BDL A;  1Y4H A;  1GX3 A;  1VSN A;  2VFB A;  3GCB A;  1EWM A;  3LFY A;  1EF7 A;  3BPF A;  3CBK A;  2C0Y A;  1Y08 A;  2PBH A;  5EGW A;  3USV A;  3PNR A;  3QJ3 A;  3QSD A;  3RVX A;  2WBF X;  2DCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...