3C9EA

Crystal structure of the cathepsin k : chondroitin sulfate complex.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title The crystal and molecular structures of a cathepsin K:chondroitin sulfate complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3c9eA00
3IOQA 4P6GA 2NQIA 3E1ZB 3DF0A 3K9MA 2B1NA 3RVXA 1NL6A 2DC8A 2HH5A 3KSEA 1NLJA 1DEUA 5CVNB 1PPNA 3ERVA 3KKUA 1Y08A 4YYSA 2B1MA 1FH0A 3QT4A 2R9CA 1U9WA 2DZZA 1AYWA 5K16A 7PCKA 3AI8A 1Y4HA 1MS6A 2G6DA 2CB5A 1BGOA 1QMYA 1S4VA 2R6NA 1NPZA 1TL9A 2F1GA 2AYOA 2JQGR 4X6JA 1DF0A 1O0EA 3CH3X 4DMYA 1VSNA 3PNRA 1TU6A 4YV8A 4BS5A 4RY2A 4BSQA 3QJ3A 4N79A 3CBKA 2DCAA 2AUXA 4G54A 1ME3A 2CIOA 1F2CA 2JQFR 4YYVA 1F2AA 2OZ2A 1YK7A 4MZOA 2FRAA 1NB5A 1EWOA 1MIRA 3K24A 1HUCB 2DC6A 2E03A 1U9QX 1BY8A 2AS8A 2Y5BA 1THEA 1CQDA 4CDEB 3WXGA 3MTNA 2GHUA 2NQGA 4ZUXU 1AU2A 4K7CA 5CHVA 4FIPA 3S3QA 1KXRA 3I06A 5FPWA 1AU3A 1YK8A 1CS8A 3KX1A 4P6EA 1QOLA 3H8BA 3P5XA 1CVZA 3OISA 2YJCA 2P7UA 3WXEA 4X6IA 2DJFB 1QXPA 4QBBA 3O0UA 5J94A 4HWYA 1NQCA 4XUIA 2R9MA 4QRVA 3BPMA 3TNXA 1YVBA 3RVWA 3USVA 1PPPA 3F5VA 4QRXA 3KFQA 5EF4A 5JA7A 3H6SA 4PP1A 4YYQA 1JQPA 4W5BA 2FRQA 2DCDA 4CZWA 2XU4A 1GMYA 4Q8GA 2WBFX 1ME4A 2PREA 3B79A 3U8EA 2AVWA 2E02A 1AU4A 1K3BB 1GCBA 3H8CA 5PADA 3H89A 3P5VA 4XR7A 4OELA 2XU5A 2YJBA 4AXLA 2AIMA 3H7DA 4X6HA 1YALA 5JH3A 2PBHA 2F7DA 3CH2X 1CB5A 2GFOA 3V6CA 3LXSA 1PE6A 3P5WA 1BP4A 4AXMA 1X9YA 3M99A 4QRGA 3CBJA 3IEJA 4N4ZA 4DMXA 5F02A 8PCHA 2PNSA 1EF7A 1F2BA 1EWLA 1CSBB 2IBIA 3HD3A 1U9XA 4CDDB 2Y6EA 4I05A 2AU1A 3N3GA 2FTDA 1QDQA 3C9EA 1CTEA 3RVVA 1AU0A 5CVOB 3HHIA 1SP4B 1U9VA 2P86A 1MDWA 2HD5A 2G7YA 1AYVA 2ACTA 2R9FA 2DCCA 1EWPA 4YYWA 1MEMA 2IPPB 3MHHA 1IWDA 2FT2A 2NQAA 2R9NA 1GECE 3F75A 4I07A 3IUTA 2G8JA 1AYUA 3PW3A 4FJCA 3IV2A 3V6EA 5EGWA 4BS6A 4MSXA 1SNKA 1AIMA 2YJ8A 2G8EA 2FUDA 2PADA 2ARYA 3D6SA 4I04A 4BPVA 2YJ9A 1NB3A 3NHEA 1U5IA 5A24A 1MEGA 2BDLA 1PXVA 2HHNA 2P0RA 3BCNA 1CV8A 1KFUL 2H7JA 1KHQA 3KWZA 1STFE 4PP2E 2ATOA 2DC7A 4PI3A 3ZUAA 4YVAA 4Q8HA 4W5CA 3HWNA 1TLOA 4YYUA 1ICFA 1EWMA 3OF8A 2OP3A 1XKGA 2NQDB 1PPDA 3OF9A 2XU3A 3O1GA 2DC9A 3MORA 3P5UA 1ZCMA 1PADA 1VJVA 3N3KA 3K8UA 2FO5A 4MZSA 2O6XA 2DJGB 4WA6A 3IHPA 2AUZA 3BWKA 1ATKA 1MHWA 1PBHA 2E01A 3GCBA 4W4UA 2XU1A 3PDFA 1KFXL 3IMAA 1PIPA 1Q6KA 3KW9A 4PADA 3BPFA 2VHSA 3N4CA 2VHFA 4FK5A 1A6RA 3BC3A 3MHSA 3PBHA 5CVMA 1BQIA 3KWBX 1AECA 1KHPA 3QSDA 4KLBA 4YYRA 2DZYA 2FYEA 9PAPA 1M6DA 1ZIVA 2BDZA 2YJ2A 3S3RA 3I3TA 5CHTA 2FQ9A 4QH6A 3HHAA 3OVZA 2AYNA 1GLOA 4CDFB 6PADA 1ITOA 2C0YA 1PCIA 2HXZA 1YT7A 2OULA 2R9OA 4N8WA 3OVXA 4BQVA 1F29A 1PPOA 3WXFA 1CJLA 1CPJA 2E00A 1POPA 2DCBA 3BOWA 4CDCB 4OEMA 3LFYA
chains in the Genus database with same CATH superfamily
3IOQA 4P6GA 2NQIA 3E1ZB 3DF0A 3K9MA 2B1NA 3RVXA 4OVZA 1NL6A 2DC8A 2HH5A 3KSEA 1NLJA 1DEUA 5CVNB 1PPNA 3ERVA 3KKUA 1Y08A 4YYSA 2B1MA 1FH0A 3MP2A 3QT4A 2R9CA 1U9WA 2DZZA 1AYWA 5K16A 7PCKA 3AI8A 1Y4HA 1MS6A 2G6DA 2CB5A 1BGOA 1QMYA 1S4VA 2R6NA 1NPZA 1TL9A 2F1GA 2AYOA 2JQGR 4X6JA 1DF0A 1O0EA 3CH3X 4DMYA 1VSNA 3PNRA 4XZXA 1TU6A 4YV8A 4BS5A 4RKXA 4RY2A 4BSQA 3QJ3A 4N79A 3CBKA 2DCAA 2AUXA 4G54A 1ME3A 2CIOA 3PHUA 1F2CA 4BOZA 2JQFR 4YYVA 1F2AA 2OZ2A 1YK7A 4ZTBA 4MZOA 2FRAA 1NB5A 1EWOA 1MIRA 5KO3A 3K24A 1HUCB 2DC6A 2JRIA 2E03A 1U9QX 3BBAA 1BY8A 2AS8A 2Y5BA 1THEA 1CQDA 4CDEB 1YZBA 4MI7A 3WXGA 3MTNA 3TMPA 2HWKA 2GHUA 2NQGA 4ZUXU 1AU2A 4K7CA 5CHVA 4FIPA 3S3QA 1KXRA 3I06A 2J7QA 5FPWA 3O65A 1AU3A 1YK8A 1CS8A 3KX1A 4R3DA 4RF0A 4P6EA 2J7QC 1QOLA 3H8BA 3P5XA 2JTCA 1CVZA 3OISA 4PT5A 2YJCA 2P7UA 3WXEA 4X6IA 2DJFB 4D8IA 4HXDB 1QXPA 3IFUA 4QBBA 3MJ5A 3O0UA 5J94A 2FE8A 4HWYA 1NQCA 4XUIA 2R9MA 4QRVA 3BPMA 3TNXA 1YVBA 3RVWA 3USVA 1PPPA 3F5VA 4QRXA 3KFQA 5EF4A 5JA7A 3H6SA 4PP1A 4YYQA 1JQPA 4W5BA 2FRQA 3W30A 2DCDA 4CZWA 2XU4A 1GMYA 4Q8GA 2WBFX 1ME4A 2PREA 3B79A 3U8EA 2AVWA 2E02A 1AU4A 1K3BB 1GCBA 3H8CA 5PADA 3H89A 3P5VA 4XR7A 4OELA 2XU5A 2YJBA 4AXLA 2AIMA 2UZJA 3H7DA 4X6HA 1YALA 5JH3A 2PBHA 3E9SA 2Z84A 2F7DA 3CH2X 4IP3A 4M0WA 1CB5A 2GFOA 3V6CA 3LXSA 1PE6A 3P5WA 1BP4A 4AXMA 1X9YA 3M99A 4QRGA 3CBJA 3IEJA 3PT2A 4N4ZA 4DMXA 5F02A 8PCHA 2PNSA 4RF1A 1EF7A 1F2BA 1EWLA 3TRKA 1CSBB 4REZA 2IBIA 3HD3A 1U9XA 4CDDB 2Y6EA 4I05A 2AU1A 3N3GA 5EZQA 3PRPA 2FTDA 1QDQA 3C9EA 4A5UA 1CTEA 3RVVA 1AU0A 3PHXA 3BB7A 5CVOB 3HHIA 5EZSA 3C0RA 1SP4B 1U9VA 2P86A 1MDWA 2HD5A 2G7YA 1AYVA 2ACTA 2R9FA 2DCCA 1EWPA 4OW0A 4YYWA 1MEMA 4BOUA 2IPPB 3MHHA 1IWDA 2FT2A 2NQAA 2R9NA 1GECE 3F75A 4I07A 3BY4A 3IUTA 2G8JA 1AYUA 3PW3A 4D8BA 4FJCA 1DKIA 3IV2A 3V6EA 5EGWA 4BS6A 4BOPA 1PVJA 4MSXA 1SNKA 1AIMA 2BTWB 4D8EA 2YJ8A 3PRMA 2G8EA 2FUDA 2PADA 2ARYA 3PSEA 3D6SA 4I04A 4BPVA 2YJ9A 2BTWA 1NB3A 3NHEA 3ZNHA 1U5IA 5A24A 1MEGA 2BDLA 1PXVA 2HHNA 2P0RA 3BCNA 1CV8A 1KFUL 4P16A 2H7JA 1KHQA 3KWZA 1STFE 4PP2E 2ATOA 2DC7A 5E6JA 4PI3A 3ZUAA 4BOQA 4YVAA 4Q8HA 3W31A 4W5CA 1UKFA 3HWNA 1TLOA 4YYUA 1ICFA 1EWMA 3OF8A 2OP3A 1XKGA 4RNAA 2NQDB 1PPDA 3OF9A 2XU3A 3O1GA 2DC9A 3MORA 3P5UA 1ZCMA 1PADA 3PHWA 1VJVA 3N3KA 3K8UA 2FO5A 4MZSA 2O6XA 2DJGB 4WA6A 3IHPA 2AUZA 3BWKA 1ATKA 1MHWA 1PBHA 3OQCA 2E01A 3GCBA 4W4UA 2DOSA 2XU1A 3PDFA 1KFXL 3IMAA 1PIPA 4GUAA 1Q6KA 3KW9A 4PADA 3BPFA 2VHSA 3N4CA 2VHFA 2BU3A 4FK5A 1A6RA 3BC3A 3MHSA 3PBHA 5CVMA 1BQIA 3KWBX 1AECA 1KHPA 3QSDA 5JZEA 4KLBA 4YYRA 2DZYA 2AGAA 2FYEA 9PAPA 1M6DA 1ZIVA 2BDZA 2YJ2A 3S3RA 3I3TA 5CHTA 2FQ9A 4QH6A 3HHAA 3OVZA 2AYNA 1GLOA 4CDFB 6PADA 1ITOA 2C0YA 1PCIA 2HXZA 4IUMA 1YT7A 2OULA 2R9OA 4N8WA 3OVXA 4BQVA 4WURA 1F29A 4OVZB 1PPOA 3WXFA 3RNVA 1CJLA 1CPJA 2E00A 1POPA 2DCBA 3B21A 3BOWA 3MTVA 4BOSA 4CDCB 4OEMA 3LFYA 4MM3B
chains in the Genus database with same CATH topology
3IOQA 4P6GA 2NQIA 3E1ZB 3DF0A 3K9MA 2B1NA 3RVXA 4GUZA 1NL6A 2DC8A 2HH5A 3KSEA 1NLJA 1DEUA 2BSZA 5CVNB 1PPNA 3ERVA 3KKUA 1Y08A 4YYSA 2B1MA 1FH0A 3QT4A 2R9CA 1GX3A 1U9WA 2DZZA 1AYWA 5K16A 7PCKA 3AI8A 1Y4HA 1MS6A 2G6DA 2CB5A 1BGOA 1QMYA 1S4VA 2R6NA 1NPZA 1TL9A 2F1GA 2AYOA 2JQGR 4X6JA 1DF0A 1O0EA 3CH3X 4DMYA 1VSNA 3PNRA 1TU6A 4YV8A 4BS5A 4RY2A 4BSQA 3QJ3A 4N79A 3CBKA 2DCAA 2AUXA 3LTWA 4G54A 1ME3A 2CIOA 4NV8A 1F2CA 2JQFR 4YYVA 1F2AA 2OZ2A 1YK7A 4MZOA 2FRAA 1NB5A 1EWOA 1MIRA 3K24A 1HUCB 2DC6A 2E03A 1U9QX 1BY8A 2AS8A 2Y5BA 1W5RA 1THEA 1CQDA 4CDEB 3WXGA 3MTNA 2GHUA 2NQGA 4ZUXU 1AU2A 4K7CA 5CHVA 4FIPA 3S3QA 1KXRA 3I06A 5FPWA 1AU3A 1YK8A 1CS8A 3KX1A 4P6EA 1QOLA 3H8BA 1W4TA 4BGFA 3P5XA 1CVZA 3OISA 2YJCA 2P7UA 3WXEA 4X6IA 2DJFB 1QXPA 4QBBA 3O0UA 5J94A 4HWYA 1NQCA 4XUIA 2R9MA 4QRVA 3BPMA 3TNXA 1YVBA 3RVWA 3USVA 1PPPA 3F5VA 4QRXA 3KFQA 5EF4A 5JA7A 2VFCA 3H6SA 4PP1A 4YYQA 1JQPA 4W5BA 2FRQA 2DCDA 4CZWA 2XU4A 1GMYA 4Q8GA 2WBFX 1ME4A 2PREA 3B79A 3U8EA 2AVWA 2E02A 1AU4A 1K3BB 1GCBA 3H8CA 5PADA 3H89A 3P5VA 4XR7A 4OELA 2XU5A 2YJBA 4AXLA 2AIMA 3H7DA 4X6HA 1YALA 5JH3A 2PBHA 2F7DA 3CH2X 1CB5A 2GFOA 3V6CA 3LXSA 1PE6A 3P5WA 1BP4A 4AXMA 1X9YA 3M99A 4QRGA 3CBJA 3IEJA 4N4ZA 4DMXA 5F02A 8PCHA 2PNSA 1EF7A 1F2BA 1EWLA 1CSBB 2IBIA 3HD3A 1U9XA 4CDDB 2Y6EA 4I05A 2AU1A 3N3GA 2FTDA 2VFBA 1QDQA 3C9EA 1CTEA 3RVVA 1AU0A 5CVOB 3HHIA 4B55A 1SP4B 1U9VA 2P86A 1MDWA 1E2TA 2HD5A 2G7YA 1AYVA 2ACTA 2R9FA 2DCCA 1EWPA 4YYWA 1MEMA 2IPPB 3MHHA 1IWDA 2FT2A 2NQAA 2R9NA 1GECE 3F75A 4I07A 3IUTA 2G8JA 1AYUA 3PW3A 4FJCA 3IV2A 3V6EA 5EGWA 4BS6A 4MSXA 1SNKA 1AIMA 2YJ8A 2G8EA 2FUDA 2PADA 2ARYA 1W6FA 3D6SA 4I04A 4BPVA 2YJ9A 1NB3A 3NHEA 1U5IA 5A24A 1MEGA 2BDLA 1PXVA 2HHNA 2P0RA 3BCNA 1CV8A 1KFUL 2H7JA 1KHQA 3KWZA 1STFE 4PP2E 2ATOA 2DC7A 4PI3A 3ZUAA 4YVAA 4Q8HA 4W5CA 3HWNA 1TLOA 4YYUA 1ICFA 1EWMA 3OF8A 2OP3A 1XKGA 2NQDB 1PPDA 3OF9A 2XU3A 3O1GA 2DC9A 3MORA 3P5UA 1ZCMA 1PADA 1VJVA 3N3KA 3K8UA 4NV7A 2FO5A 4MZSA 2O6XA 2DJGB 4WA6A 3IHPA 2AUZA 3BWKA 1ATKA 1MHWA 1PBHA 2E01A 3GCBA 4W4UA 2XU1A 3PDFA 1KFXL 3IMAA 1PIPA 3D9WA 1Q6KA 3KW9A 4PADA 3BPFA 2VHSA 3N4CA 2VHFA 4FK5A 1A6RA 3BC3A 3MHSA 3PBHA 5CVMA 1BQIA 3KWBX 1AECA 1KHPA 3QSDA 4KLBA 4YYRA 2DZYA 2FYEA 9PAPA 1M6DA 1ZIVA 2BDZA 2YJ2A 3S3RA 3I3TA 5CHTA 2FQ9A 4QH6A 3HHAA 3OVZA 2AYNA 1GLOA 4CDFB 6PADA 1ITOA 2C0YA 1PCIA 2HXZA 1YT7A 2OULA 2R9OA 4N8WA 3OVXA 4BQVA 4C5PA 1F29A 1PPOA 3WXFA 1CJLA 1CPJA 2E00A 1POPA 2DCBA 3BOWA 4CDCB 4OEMA 3LFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IOQ A;  4P6G A;  2NQI A;  3E1Z B;  3DF0 A;  3K9M A;  2B1N A;  3RVX A;  1NL6 A;  2DC8 A;  2HH5 A;  3KSE A;  1NLJ A;  1DEU A;  5CVN B;  1PPN A;  3ERV A;  3KKU A;  1Y08 A;  4YYS A;  2B1M A;  1FH0 A;  3QT4 A;  2R9C A;  1U9W A;  2DZZ A;  1AYW A;  5K16 A;  7PCK A;  3AI8 A;  1Y4H A;  1MS6 A;  2G6D A;  2CB5 A;  1BGO A;  1QMY A;  1S4V A;  2R6N A;  1NPZ A;  1TL9 A;  2F1G A;  2AYO A;  2JQG R;  4X6J A;  1DF0 A;  1O0E A;  3CH3 X;  4DMY A;  1VSN A;  3PNR A;  1TU6 A;  4YV8 A;  4BS5 A;  4RY2 A;  4BSQ A;  3QJ3 A;  4N79 A;  3CBK A;  2DCA A;  2AUX A;  4G54 A;  1ME3 A;  2CIO A;  1F2C A;  2JQF R;  4YYV A;  1F2A A;  2OZ2 A;  1YK7 A;  4MZO A;  2FRA A;  1NB5 A;  1EWO A;  1MIR A;  3K24 A;  1HUC B;  2DC6 A;  2E03 A;  1U9Q X;  1BY8 A;  2AS8 A;  2Y5B A;  1THE A;  1CQD A;  4CDE B;  3WXG A;  3MTN A;  2GHU A;  2NQG A;  4ZUX U;  1AU2 A;  4K7C A;  5CHV A;  4FIP A;  3S3Q A;  1KXR A;  3I06 A;  5FPW A;  1AU3 A;  1YK8 A;  1CS8 A;  3KX1 A;  4P6E A;  1QOL A;  3H8B A;  3P5X A;  1CVZ A;  3OIS A;  2YJC A;  2P7U A;  3WXE A;  4X6I A;  2DJF B;  1QXP A;  4QBB A;  3O0U A;  5J94 A;  4HWY A;  1NQC A;  4XUI A;  2R9M A;  4QRV A;  3BPM A;  3TNX A;  1YVB A;  3RVW A;  3USV A;  1PPP A;  3F5V A;  4QRX A;  3KFQ A;  5EF4 A;  5JA7 A;  3H6S A;  4PP1 A;  4YYQ A;  1JQP A;  4W5B A;  2FRQ A;  2DCD A;  4CZW A;  2XU4 A;  1GMY A;  4Q8G A;  2WBF X;  1ME4 A;  2PRE A;  3B79 A;  3U8E A;  2AVW A;  2E02 A;  1AU4 A;  1K3B B;  1GCB A;  3H8C A;  5PAD A;  3H89 A;  3P5V A;  4XR7 A;  4OEL A;  2XU5 A;  2YJB A;  4AXL A;  2AIM A;  3H7D A;  4X6H A;  1YAL A;  5JH3 A;  2PBH A;  2F7D A;  3CH2 X;  1CB5 A;  2GFO A;  3V6C A;  3LXS A;  1PE6 A;  3P5W A;  1BP4 A;  4AXM A;  1X9Y A;  3M99 A;  4QRG A;  3CBJ A;  3IEJ A;  4N4Z A;  4DMX A;  5F02 A;  8PCH A;  2PNS A;  1EF7 A;  1F2B A;  1EWL A;  1CSB B;  2IBI A;  3HD3 A;  1U9X A;  4CDD B;  2Y6E A;  4I05 A;  2AU1 A;  3N3G A;  2FTD A;  1QDQ A;  3C9E A;  1CTE A;  3RVV A;  1AU0 A;  5CVO B;  3HHI A;  1SP4 B;  1U9V A;  2P86 A;  1MDW A;  2HD5 A;  2G7Y A;  1AYV A;  2ACT A;  2R9F A;  2DCC A;  1EWP A;  4YYW A;  1MEM A;  2IPP B;  3MHH A;  1IWD A;  2FT2 A;  2NQA A;  2R9N A;  1GEC E;  3F75 A;  4I07 A;  3IUT A;  2G8J A;  1AYU A;  3PW3 A;  4FJC A;  3IV2 A;  3V6E A;  5EGW A;  4BS6 A;  4MSX A;  1SNK A;  1AIM A;  2YJ8 A;  2G8E A;  2FUD A;  2PAD A;  2ARY A;  3D6S A;  4I04 A;  4BPV A;  2YJ9 A;  1NB3 A;  3NHE A;  1U5I A;  5A24 A;  1MEG A;  2BDL A;  1PXV A;  2HHN A;  2P0R A;  3BCN A;  1CV8 A;  1KFU L;  2H7J A;  1KHQ A;  3KWZ A;  1STF E;  4PP2 E;  2ATO A;  2DC7 A;  4PI3 A;  3ZUA A;  4YVA A;  4Q8H A;  4W5C A;  3HWN A;  1TLO A;  4YYU A;  1ICF A;  1EWM A;  3OF8 A;  2OP3 A;  1XKG A;  2NQD B;  1PPD A;  3OF9 A;  2XU3 A;  3O1G A;  2DC9 A;  3MOR A;  3P5U A;  1ZCM A;  1PAD A;  1VJV A;  3N3K A;  3K8U A;  2FO5 A;  4MZS A;  2O6X A;  2DJG B;  4WA6 A;  3IHP A;  2AUZ A;  3BWK A;  1ATK A;  1MHW A;  1PBH A;  2E01 A;  3GCB A;  4W4U A;  2XU1 A;  3PDF A;  1KFX L;  3IMA A;  1PIP A;  1Q6K A;  3KW9 A;  4PAD A;  3BPF A;  2VHS A;  3N4C A;  2VHF A;  4FK5 A;  1A6R A;  3BC3 A;  3MHS A;  3PBH A;  5CVM A;  1BQI A;  3KWB X;  1AEC A;  1KHP A;  3QSD A;  4KLB A;  4YYR A;  2DZY A;  2FYE A;  9PAP A;  1M6D A;  1ZIV A;  2BDZ A;  2YJ2 A;  3S3R A;  3I3T A;  5CHT A;  2FQ9 A;  4QH6 A;  3HHA A;  3OVZ A;  2AYN A;  1GLO A;  4CDF B;  6PAD A;  1ITO A;  2C0Y A;  1PCI A;  2HXZ A;  1YT7 A;  2OUL A;  2R9O A;  4N8W A;  3OVX A;  4BQV A;  1F29 A;  1PPO A;  3WXF A;  1CJL A;  1CPJ A;  2E00 A;  1POP A;  2DCB A;  3BOW A;  4CDC B;  4OEM A;  3LFY A; 
#chains in the Genus database with same CATH topology
 3IOQ A;  4P6G A;  2NQI A;  3E1Z B;  3DF0 A;  3K9M A;  2B1N A;  3RVX A;  4OVZ A;  1NL6 A;  2DC8 A;  2HH5 A;  3KSE A;  1NLJ A;  1DEU A;  5CVN B;  1PPN A;  3ERV A;  3KKU A;  1Y08 A;  4YYS A;  2B1M A;  1FH0 A;  3MP2 A;  3QT4 A;  2R9C A;  1U9W A;  2DZZ A;  1AYW A;  5K16 A;  7PCK A;  3AI8 A;  1Y4H A;  1MS6 A;  2G6D A;  2CB5 A;  1BGO A;  1QMY A;  1S4V A;  2R6N A;  1NPZ A;  1TL9 A;  2F1G A;  2AYO A;  2JQG R;  4X6J A;  1DF0 A;  1O0E A;  3CH3 X;  4DMY A;  1VSN A;  3PNR A;  4XZX A;  1TU6 A;  4YV8 A;  4BS5 A;  4RKX A;  4RY2 A;  4BSQ A;  3QJ3 A;  4N79 A;  3CBK A;  2DCA A;  2AUX A;  4G54 A;  1ME3 A;  2CIO A;  3PHU A;  1F2C A;  4BOZ A;  2JQF R;  4YYV A;  1F2A A;  2OZ2 A;  1YK7 A;  4ZTB A;  4MZO A;  2FRA A;  1NB5 A;  1EWO A;  1MIR A;  5KO3 A;  3K24 A;  1HUC B;  2DC6 A;  2JRI A;  2E03 A;  1U9Q X;  3BBA A;  1BY8 A;  2AS8 A;  2Y5B A;  1THE A;  1CQD A;  4CDE B;  1YZB A;  4MI7 A;  3WXG A;  3MTN A;  3TMP A;  2HWK A;  2GHU A;  2NQG A;  4ZUX U;  1AU2 A;  4K7C A;  5CHV A;  4FIP A;  3S3Q A;  1KXR A;  3I06 A;  2J7Q A;  5FPW A;  3O65 A;  1AU3 A;  1YK8 A;  1CS8 A;  3KX1 A;  4R3D A;  4RF0 A;  4P6E A;  2J7Q C;  1QOL A;  3H8B A;  3P5X A;  2JTC A;  1CVZ A;  3OIS A;  4PT5 A;  2YJC A;  2P7U A;  3WXE A;  4X6I A;  2DJF B;  4D8I A;  4HXD B;  1QXP A;  3IFU A;  4QBB A;  3MJ5 A;  3O0U A;  5J94 A;  2FE8 A;  4HWY A;  1NQC A;  4XUI A;  2R9M A;  4QRV A;  3BPM A;  3TNX A;  1YVB A;  3RVW A;  3USV A;  1PPP A;  3F5V A;  4QRX A;  3KFQ A;  5EF4 A;  5JA7 A;  3H6S A;  4PP1 A;  4YYQ A;  1JQP A;  4W5B A;  2FRQ A;  3W30 A;  2DCD A;  4CZW A;  2XU4 A;  1GMY A;  4Q8G A;  2WBF X;  1ME4 A;  2PRE A;  3B79 A;  3U8E A;  2AVW A;  2E02 A;  1AU4 A;  1K3B B;  1GCB A;  3H8C A;  5PAD A;  3H89 A;  3P5V A;  4XR7 A;  4OEL A;  2XU5 A;  2YJB A;  4AXL A;  2AIM A;  2UZJ A;  3H7D A;  4X6H A;  1YAL A;  5JH3 A;  2PBH A;  3E9S A;  2Z84 A;  2F7D A;  3CH2 X;  4IP3 A;  4M0W A;  1CB5 A;  2GFO A;  3V6C A;  3LXS A;  1PE6 A;  3P5W A;  1BP4 A;  4AXM A;  1X9Y A;  3M99 A;  4QRG A;  3CBJ A;  3IEJ A;  3PT2 A;  4N4Z A;  4DMX A;  5F02 A;  8PCH A;  2PNS A;  4RF1 A;  1EF7 A;  1F2B A;  1EWL A;  3TRK A;  1CSB B;  4REZ A;  2IBI A;  3HD3 A;  1U9X A;  4CDD B;  2Y6E A;  4I05 A;  2AU1 A;  3N3G A;  5EZQ A;  3PRP A;  2FTD A;  1QDQ A;  3C9E A;  4A5U A;  1CTE A;  3RVV A;  1AU0 A;  3PHX A;  3BB7 A;  5CVO B;  3HHI A;  5EZS A;  3C0R A;  1SP4 B;  1U9V A;  2P86 A;  1MDW A;  2HD5 A;  2G7Y A;  1AYV A;  2ACT A;  2R9F A;  2DCC A;  1EWP A;  4OW0 A;  4YYW A;  1MEM A;  4BOU A;  2IPP B;  3MHH A;  1IWD A;  2FT2 A;  2NQA A;  2R9N A;  1GEC E;  3F75 A;  4I07 A;  3BY4 A;  3IUT A;  2G8J A;  1AYU A;  3PW3 A;  4D8B A;  4FJC A;  1DKI A;  3IV2 A;  3V6E A;  5EGW A;  4BS6 A;  4BOP A;  1PVJ A;  4MSX A;  1SNK A;  1AIM A;  2BTW B;  4D8E A;  2YJ8 A;  3PRM A;  2G8E A;  2FUD A;  2PAD A;  2ARY A;  3PSE A;  3D6S A;  4I04 A;  4BPV A;  2YJ9 A;  2BTW A;  1NB3 A;  3NHE A;  3ZNH A;  1U5I A;  5A24 A;  1MEG A;  2BDL A;  1PXV A;  2HHN A;  2P0R A;  3BCN A;  1CV8 A;  1KFU L;  4P16 A;  2H7J A;  1KHQ A;  3KWZ A;  1STF E;  4PP2 E;  2ATO A;  2DC7 A;  5E6J A;  4PI3 A;  3ZUA A;  4BOQ A;  4YVA A;  4Q8H A;  3W31 A;  4W5C A;  1UKF A;  3HWN A;  1TLO A;  4YYU A;  1ICF A;  1EWM A;  3OF8 A;  2OP3 A;  1XKG A;  4RNA A;  2NQD B;  1PPD A;  3OF9 A;  2XU3 A;  3O1G A;  2DC9 A;  3MOR A;  3P5U A;  1ZCM A;  1PAD A;  3PHW A;  1VJV A;  3N3K A;  3K8U A;  2FO5 A;  4MZS A;  2O6X A;  2DJG B;  4WA6 A;  3IHP A;  2AUZ A;  3BWK A;  1ATK A;  1MHW A;  1PBH A;  3OQC A;  2E01 A;  3GCB A;  4W4U A;  2DOS A;  2XU1 A;  3PDF A;  1KFX L;  3IMA A;  1PIP A;  4GUA A;  1Q6K A;  3KW9 A;  4PAD A;  3BPF A;  2VHS A;  3N4C A;  2VHF A;  2BU3 A;  4FK5 A;  1A6R A;  3BC3 A;  3MHS A;  3PBH A;  5CVM A;  1BQI A;  3KWB X;  1AEC A;  1KHP A;  3QSD A;  5JZE A;  4KLB A;  4YYR A;  2DZY A;  2AGA A;  2FYE A;  9PAP A;  1M6D A;  1ZIV A;  2BDZ A;  2YJ2 A;  3S3R A;  3I3T A;  5CHT A;  2FQ9 A;  4QH6 A;  3HHA A;  3OVZ A;  2AYN A;  1GLO A;  4CDF B;  6PAD A;  1ITO A;  2C0Y A;  1PCI A;  2HXZ A;  4IUM A;  1YT7 A;  2OUL A;  2R9O A;  4N8W A;  3OVX A;  4BQV A;  4WUR A;  1F29 A;  4OVZ B;  1PPO A;  3WXF A;  3RNV A;  1CJL A;  1CPJ A;  2E00 A;  1POP A;  2DCB A;  3B21 A;  3BOW A;  3MTV A;  4BOS A;  4CDC B;  4OEM A;  3LFY A;  4MM3 B; 
#chains in the Genus database with same CATH homology
 3IOQ A;  4P6G A;  2NQI A;  3E1Z B;  3DF0 A;  3K9M A;  2B1N A;  3RVX A;  4GUZ A;  1NL6 A;  2DC8 A;  2HH5 A;  3KSE A;  1NLJ A;  1DEU A;  2BSZ A;  5CVN B;  1PPN A;  3ERV A;  3KKU A;  1Y08 A;  4YYS A;  2B1M A;  1FH0 A;  3QT4 A;  2R9C A;  1GX3 A;  1U9W A;  2DZZ A;  1AYW A;  5K16 A;  7PCK A;  3AI8 A;  1Y4H A;  1MS6 A;  2G6D A;  2CB5 A;  1BGO A;  1QMY A;  1S4V A;  2R6N A;  1NPZ A;  1TL9 A;  2F1G A;  2AYO A;  2JQG R;  4X6J A;  1DF0 A;  1O0E A;  3CH3 X;  4DMY A;  1VSN A;  3PNR A;  1TU6 A;  4YV8 A;  4BS5 A;  4RY2 A;  4BSQ A;  3QJ3 A;  4N79 A;  3CBK A;  2DCA A;  2AUX A;  3LTW A;  4G54 A;  1ME3 A;  2CIO A;  4NV8 A;  1F2C A;  2JQF R;  4YYV A;  1F2A A;  2OZ2 A;  1YK7 A;  4MZO A;  2FRA A;  1NB5 A;  1EWO A;  1MIR A;  3K24 A;  1HUC B;  2DC6 A;  2E03 A;  1U9Q X;  1BY8 A;  2AS8 A;  2Y5B A;  1W5R A;  1THE A;  1CQD A;  4CDE B;  3WXG A;  3MTN A;  2GHU A;  2NQG A;  4ZUX U;  1AU2 A;  4K7C A;  5CHV A;  4FIP A;  3S3Q A;  1KXR A;  3I06 A;  5FPW A;  1AU3 A;  1YK8 A;  1CS8 A;  3KX1 A;  4P6E A;  1QOL A;  3H8B A;  1W4T A;  4BGF A;  3P5X A;  1CVZ A;  3OIS A;  2YJC A;  2P7U A;  3WXE A;  4X6I A;  2DJF B;  1QXP A;  4QBB A;  3O0U A;  5J94 A;  4HWY A;  1NQC A;  4XUI A;  2R9M A;  4QRV A;  3BPM A;  3TNX A;  1YVB A;  3RVW A;  3USV A;  1PPP A;  3F5V A;  4QRX A;  3KFQ A;  5EF4 A;  5JA7 A;  2VFC A;  3H6S A;  4PP1 A;  4YYQ A;  1JQP A;  4W5B A;  2FRQ A;  2DCD A;  4CZW A;  2XU4 A;  1GMY A;  4Q8G A;  2WBF X;  1ME4 A;  2PRE A;  3B79 A;  3U8E A;  2AVW A;  2E02 A;  1AU4 A;  1K3B B;  1GCB A;  3H8C A;  5PAD A;  3H89 A;  3P5V A;  4XR7 A;  4OEL A;  2XU5 A;  2YJB A;  4AXL A;  2AIM A;  3H7D A;  4X6H A;  1YAL A;  5JH3 A;  2PBH A;  2F7D A;  3CH2 X;  1CB5 A;  2GFO A;  3V6C A;  3LXS A;  1PE6 A;  3P5W A;  1BP4 A;  4AXM A;  1X9Y A;  3M99 A;  4QRG A;  3CBJ A;  3IEJ A;  4N4Z A;  4DMX A;  5F02 A;  8PCH A;  2PNS A;  1EF7 A;  1F2B A;  1EWL A;  1CSB B;  2IBI A;  3HD3 A;  1U9X A;  4CDD B;  2Y6E A;  4I05 A;  2AU1 A;  3N3G A;  2FTD A;  2VFB A;  1QDQ A;  3C9E A;  1CTE A;  3RVV A;  1AU0 A;  5CVO B;  3HHI A;  4B55 A;  1SP4 B;  1U9V A;  2P86 A;  1MDW A;  1E2T A;  2HD5 A;  2G7Y A;  1AYV A;  2ACT A;  2R9F A;  2DCC A;  1EWP A;  4YYW A;  1MEM A;  2IPP B;  3MHH A;  1IWD A;  2FT2 A;  2NQA A;  2R9N A;  1GEC E;  3F75 A;  4I07 A;  3IUT A;  2G8J A;  1AYU A;  3PW3 A;  4FJC A;  3IV2 A;  3V6E A;  5EGW A;  4BS6 A;  4MSX A;  1SNK A;  1AIM A;  2YJ8 A;  2G8E A;  2FUD A;  2PAD A;  2ARY A;  1W6F A;  3D6S A;  4I04 A;  4BPV A;  2YJ9 A;  1NB3 A;  3NHE A;  1U5I A;  5A24 A;  1MEG A;  2BDL A;  1PXV A;  2HHN A;  2P0R A;  3BCN A;  1CV8 A;  1KFU L;  2H7J A;  1KHQ A;  3KWZ A;  1STF E;  4PP2 E;  2ATO A;  2DC7 A;  4PI3 A;  3ZUA A;  4YVA A;  4Q8H A;  4W5C A;  3HWN A;  1TLO A;  4YYU A;  1ICF A;  1EWM A;  3OF8 A;  2OP3 A;  1XKG A;  2NQD B;  1PPD A;  3OF9 A;  2XU3 A;  3O1G A;  2DC9 A;  3MOR A;  3P5U A;  1ZCM A;  1PAD A;  1VJV A;  3N3K A;  3K8U A;  4NV7 A;  2FO5 A;  4MZS A;  2O6X A;  2DJG B;  4WA6 A;  3IHP A;  2AUZ A;  3BWK A;  1ATK A;  1MHW A;  1PBH A;  2E01 A;  3GCB A;  4W4U A;  2XU1 A;  3PDF A;  1KFX L;  3IMA A;  1PIP A;  3D9W A;  1Q6K A;  3KW9 A;  4PAD A;  3BPF A;  2VHS A;  3N4C A;  2VHF A;  4FK5 A;  1A6R A;  3BC3 A;  3MHS A;  3PBH A;  5CVM A;  1BQI A;  3KWB X;  1AEC A;  1KHP A;  3QSD A;  4KLB A;  4YYR A;  2DZY A;  2FYE A;  9PAP A;  1M6D A;  1ZIV A;  2BDZ A;  2YJ2 A;  3S3R A;  3I3T A;  5CHT A;  2FQ9 A;  4QH6 A;  3HHA A;  3OVZ A;  2AYN A;  1GLO A;  4CDF B;  6PAD A;  1ITO A;  2C0Y A;  1PCI A;  2HXZ A;  1YT7 A;  2OUL A;  2R9O A;  4N8W A;  3OVX A;  4BQV A;  4C5P A;  1F29 A;  1PPO A;  3WXF A;  1CJL A;  1CPJ A;  2E00 A;  1POP A;  2DCB A;  3BOW A;  4CDC B;  4OEM A;  3LFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...