2FTDA

Crystal structure of cathepsin k complexed with 7-methyl-substituted azepan-3-one compound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Structure activity relationships of 5-, 6-, and 7-methyl-substituted azepan-3-one cathepsin K inhibitors.
pubmed doi rcsb
source organism Macaca mulatta
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ftdA00
5CHVA 1XKGA 3MHSA 3RVWA 1ME3A 4KLBA 4X6IA 1BP4A 2R9MA 1U9XA 1GCBA 2YJ2A 1AU2A 1PBHA 1U9VA 1PPDA 3BC3A 1NPZA 4OEMA 4YYRA 2FUDA 2OP3A 3U8EA 3N3GA 2FTDA 2G6DA 2F1GA 1CPJA 2BDLA 3C9EA 3IMAA 4PADA 4QRXA 3HHAA 3P5XA 2R9FA 2AIMA 1YVBA 1Q6KA 5J94A 1PCIA 3CH3X 1THEA 3H8CA 2PBHA 2AVWA 4I07A 2ARYA 2O6XA 3QT4A 1MHWA 1U9QX 3K24A 4X6HA 5EF4A 2FQ9A 3MHHA 4BSQA 3P5WA 1SP4B 2AYOA 1EF7A 5F02A 2F7DA 4BS5A 2FO5A 2ACTA 1U9WA 1JQPA 5FPWA 4BQVA 1F2BA 3S3QA 3LXSA 1YT7A 3WXEA 2VHFA 1F29A 3LFYA 4I05A 1VSNA 8PCHA 1Y08A 1MS6A 1ITOA 1NLJA 3MORA 3P5UA 1CS8A 5K16A 4PI3A 5CVNB 2CB5A 3BPFA 1DEUA 3IOQA 1M6DA 3E1ZB 2YJ9A 1AECA 3KFQA 4AXMA 1F2AA 2PADA 4CDCB 1YK7A 4BPVA 6PADA 1TLOA 2R6NA 2XU4A 4YYSA 1KFUL 1BQIA 1CV8A 1QDQA 3H6SA 3IV2A 4N79A 1MDWA 3BCNA 1AYVA 2FRAA 4XUIA 4RY2A 3P5VA 3F75A 2NQIA 4CDFB 5CHTA 2XU3A 2VHSA 3CH2X 3WXFA 7PCKA 1BGOA 1PADA 1STFE 3QSDA 1AU0A 2HXZA 1NQCA 1TU6A 4CDEB 2PNSA 3V6EA 5A24A 1AIMA 1QMYA 2DCDA 1EWPA 1CQDA 2AUXA 1EWMA 2AS8A 2E01A 1GLOA 2B1NA 3DF0A 2DC8A 2GHUA 2OZ2A 2R9CA 4AXLA 1FH0A 2OULA 4W4UA 2DCBA 4N4ZA 2ATOA 1ME4A 1F2CA 2NQDB 9PAPA 1CSBB 4XR7A 3WXGA 4MZOA 4DMYA 3IEJA 1KXRA 3B79A 3BPMA 2IBIA 3IHPA 4DMXA 3KKUA 1QXPA 1KHQA 3IUTA 2DZYA 2AYNA 4OELA 1AYUA 2JQFR 1POPA 4QBBA 4W5BA 2NQGA 1GECE 1SNKA 2FT2A 3OF9A 4WA6A 3OF8A 3M99A 1CJLA 2DJFB 1BY8A 3PNRA 1GMYA 4CZWA 4HWYA 1EWOA 1ATKA 4W5CA 2R9NA 1CTEA 2DJGB 5CVOB 2WBFX 3HHIA 2P86A 2H7JA 2GFOA 3KX1A 1HUCB 1MEMA 4MSXA 4X6JA 4CDDB 2AUZA 1ICFA 4Q8GA 4YYWA 4YV8A 1PE6A 5JA7A 1NL6A 2G7YA 2DC7A 1TL9A 1PPOA 2HD5A 2CIOA 4PP2E 2HH5A 4G54A 3ZUAA 1X9YA 4FJCA 1EWLA 3PDFA 4Q8HA 2E00A 2AU1A 1YK8A 2XU1A 3H8BA 1CB5A 4FIPA 1DF0A 2YJ8A 3I3TA 3F5VA 3KWZA 2PREA 4N8WA 2DC9A 1O0EA 1K3BB 2YJBA 2Y6EA 2P0RA 4MZSA 1CVZA 1MEGA 1AU4A 2IPPB 3HD3A 2B1MA 1A6RA 3RVVA 2P7UA 3S3RA 3OISA 1PXVA 3H7DA 3TNXA 1U5IA 2NQAA 1IWDA 3ERVA 1KHPA 4BS6A 3N3KA 2BDZA 2DZZA 3V6CA 3AI8A 3USVA 5JH3A 4QRVA 3QJ3A 3I06A 3CBJA 2DCCA 4YYUA 1MIRA 1QOLA 1PPPA 1VJVA 3BWKA 3NHEA 4YVAA 1KFXL 2Y5BA 4PP1A 4FK5A 4P6EA 3BOWA 2G8JA 1ZIVA 4QH6A 3CBKA 5PADA 2JQGR 3K9MA 3MTNA 3O0UA 1AYWA 2FYEA 4I04A 4YYVA 3OVXA 3KSEA 3GCBA 5CVMA 3OVZA 2DC6A 4QRGA 2DCAA 1ZCMA 4YYQA 1YALA 2R9OA 3KW9A 1PIPA 3PW3A 3RVXA 2E03A 3N4CA 1Y4HA 2C0YA 3KWBX 2HHNA 2FRQA 3PBHA 3H89A 4K7CA 4P6GA 1PPNA 3HWNA 4ZUXU 2XU5A 1NB3A 2G8EA 1AU3A 2E02A 3K8UA 2YJCA 5EGWA 3D6SA 1S4VA 1NB5A 3O1GA
chains in the Genus database with same CATH superfamily
5CHVA 1XKGA 3MHSA 3RVWA 1ME3A 4KLBA 1DKIA 4X6IA 1BP4A 2R9MA 1U9XA 1GCBA 2YJ2A 1AU2A 1PBHA 1U9VA 1PPDA 3BC3A 4BOSA 1NPZA 4OEMA 4YYRA 2FUDA 2OP3A 3U8EA 3N3GA 2FTDA 3RNVA 2G6DA 2F1GA 1CPJA 4MI7A 2BDLA 3C9EA 3IMAA 4PADA 4QRXA 3HHAA 3P5XA 2R9FA 3MJ5A 2AIMA 3PHUA 1YVBA 1Q6KA 5J94A 1PCIA 3CH3X 4A5UA 3TRKA 1THEA 3H8CA 2PBHA 2AVWA 4I07A 2ARYA 2O6XA 3QT4A 1MHWA 1U9QX 3K24A 4X6HA 5EF4A 2FQ9A 3MHHA 4BSQA 2BU3A 5E6JA 3P5WA 1SP4B 2AYOA 1EF7A 5F02A 2F7DA 4BS5A 2FO5A 2ACTA 1U9WA 1JQPA 2JTCA 5FPWA 4GUAA 4BQVA 2J7QC 3E9SA 1F2BA 3S3QA 3LXSA 1YT7A 3WXEA 3BBAA 2VHFA 1F29A 2UZJA 3LFYA 4I05A 1VSNA 8PCHA 1Y08A 1MS6A 3W30A 1ITOA 3IFUA 4OVZB 1NLJA 3MORA 3P5UA 1YZBA 1CS8A 1UKFA 5K16A 4PI3A 5CVNB 2CB5A 5EZQA 3BPFA 1DEUA 3IOQA 1M6DA 3E1ZB 3PHXA 2YJ9A 1AECA 3KFQA 4AXMA 1F2AA 2PADA 4CDCB 1YK7A 4BPVA 6PADA 1TLOA 2R6NA 4RF0A 2XU4A 4YYSA 1KFUL 1BQIA 1CV8A 4MM3B 1QDQA 3H6SA 3IV2A 4N79A 1MDWA 3BCNA 1AYVA 2FRAA 4XUIA 4RY2A 3ZNHA 3P5VA 3F75A 2NQIA 4CDFB 5CHTA 2XU3A 2VHSA 3CH2X 3WXFA 7PCKA 1BGOA 1PADA 3TMPA 4XZXA 1STFE 3QSDA 1AU0A 2HXZA 1NQCA 1TU6A 4CDEB 2PNSA 3V6EA 5A24A 1AIMA 1QMYA 2DCDA 1EWPA 1CQDA 2AUXA 4BOUA 1EWMA 2AS8A 2E01A 1GLOA 2B1NA 3DF0A 4BOPA 2DC8A 2GHUA 2OZ2A 2R9CA 4AXLA 1FH0A 2OULA 4W4UA 2DCBA 2HWKA 4OVZA 4N4ZA 2ATOA 1ME4A 3PRPA 3BB7A 1F2CA 2NQDB 9PAPA 1CSBB 4XR7A 3WXGA 4MZOA 4DMYA 3IEJA 1KXRA 3B79A 3O65A 3BPMA 2IBIA 3IHPA 4DMXA 3KKUA 1QXPA 1KHQA 3IUTA 4D8IA 2DZYA 2AYNA 4OELA 1AYUA 2JQFR 1POPA 3W31A 4QBBA 4W5BA 2NQGA 1GECE 1SNKA 4M0WA 2FT2A 3OF9A 4WA6A 3OF8A 3M99A 1CJLA 2DJFB 4BOQA 1BY8A 3PNRA 1GMYA 4CZWA 4HWYA 1EWOA 1ATKA 5JZEA 4W5CA 2R9NA 1CTEA 2DJGB 5CVOB 2WBFX 3HHIA 2P86A 2BTWA 2H7JA 2GFOA 3KX1A 1HUCB 2Z84A 1MEMA 2FE8A 4MSXA 4X6JA 4CDDB 2AUZA 2J7QA 1ICFA 4Q8GA 4YYWA 4YV8A 1PE6A 5JA7A 4RKXA 1NL6A 2G7YA 2DC7A 3MP2A 1TL9A 1PPOA 2HD5A 2CIOA 4PP2E 4ZTBA 2HH5A 4G54A 3ZUAA 1X9YA 4FJCA 1EWLA 3PDFA 4Q8HA 2E00A 2AU1A 1YK8A 2XU1A 3H8BA 1CB5A 4PT5A 2BTWB 1DF0A 4FIPA 2YJ8A 3I3TA 3F5VA 3KWZA 2PREA 3B21A 4N8WA 2DC9A 1O0EA 5EZSA 1K3BB 2YJBA 2Y6EA 2P0RA 4MZSA 1CVZA 1MEGA 1AU4A 2IPPB 4D8BA 4IUMA 4P16A 3HD3A 2B1MA 1A6RA 3PSEA 3RVVA 4R3DA 2P7UA 3S3RA 3OISA 1PXVA 3H7DA 3TNXA 1U5IA 2NQAA 1IWDA 3ERVA 1KHPA 4BS6A 3N3KA 2BDZA 2DZZA 3V6CA 2JRIA 4RNAA 3AI8A 4WURA 3USVA 5KO3A 5JH3A 3MTVA 4QRVA 3QJ3A 3I06A 3CBJA 2DCCA 4YYUA 1MIRA 1QOLA 1PPPA 4REZA 1VJVA 3BWKA 3NHEA 4YVAA 1KFXL 2Y5BA 3PRMA 4FK5A 4PP1A 4BOZA 4P6EA 3BOWA 2G8JA 1ZIVA 4QH6A 3CBKA 5PADA 2JQGR 1PVJA 3K9MA 3MTNA 3O0UA 1AYWA 2FYEA 4I04A 4YYVA 4OW0A 4IP3A 3OQCA 3OVXA 3KSEA 3GCBA 5CVMA 3OVZA 2DC6A 4QRGA 2DCAA 1ZCMA 4YYQA 1YALA 2R9OA 4RF1A 3KW9A 1PIPA 4D8EA 3PW3A 3RVXA 2E03A 2AGAA 3N4CA 1Y4HA 2C0YA 3KWBX 2HHNA 2FRQA 3PBHA 3H89A 4K7CA 3BY4A 4P6GA 1PPNA 3HWNA 4ZUXU 2XU5A 1NB3A 2G8EA 4HXDB 1AU3A 3C0RA 3PT2A 2E02A 3K8UA 2YJCA 5EGWA 2DOSA 3PHWA 3D6SA 1S4VA 1NB5A 3O1GA
chains in the Genus database with same CATH topology
5CHVA 1XKGA 3MHSA 3RVWA 1ME3A 4KLBA 4X6IA 1BP4A 2R9MA 1U9XA 1GCBA 2YJ2A 1AU2A 1PBHA 1W6FA 1U9VA 1PPDA 3BC3A 1NPZA 4OEMA 4YYRA 2FUDA 2OP3A 3U8EA 3N3GA 2FTDA 2G6DA 2F1GA 1CPJA 4BGFA 2BDLA 3C9EA 3IMAA 4PADA 4QRXA 3HHAA 3P5XA 4B55A 2R9FA 2AIMA 1YVBA 1Q6KA 5J94A 1PCIA 3CH3X 1THEA 3H8CA 2PBHA 2AVWA 4I07A 2ARYA 2O6XA 3QT4A 1MHWA 1U9QX 3K24A 4X6HA 5EF4A 2FQ9A 3MHHA 4BSQA 3P5WA 1SP4B 2AYOA 1EF7A 5F02A 1E2TA 2F7DA 4BS5A 2FO5A 2ACTA 1U9WA 1JQPA 5FPWA 4BQVA 1F2BA 3S3QA 3LXSA 1YT7A 3WXEA 2VHFA 1F29A 3LFYA 4I05A 2VFCA 1VSNA 8PCHA 1Y08A 1MS6A 4GUZA 1ITOA 1NLJA 3MORA 3P5UA 1CS8A 5K16A 4PI3A 5CVNB 2CB5A 3BPFA 1DEUA 3IOQA 1M6DA 3E1ZB 2YJ9A 1AECA 3KFQA 4AXMA 1F2AA 2PADA 4CDCB 1YK7A 4BPVA 6PADA 1TLOA 2R6NA 2XU4A 4YYSA 1KFUL 1BQIA 1CV8A 1QDQA 3H6SA 3IV2A 4N79A 1MDWA 3BCNA 1AYVA 2FRAA 4XUIA 4RY2A 3P5VA 3F75A 2NQIA 4CDFB 5CHTA 2XU3A 2VHSA 3CH2X 3WXFA 7PCKA 1BGOA 1PADA 1STFE 3QSDA 1AU0A 2HXZA 1NQCA 1TU6A 4CDEB 2PNSA 3V6EA 5A24A 1AIMA 1QMYA 2DCDA 1EWPA 1CQDA 2AUXA 1GX3A 1EWMA 2AS8A 2E01A 4NV7A 1GLOA 2B1NA 3DF0A 2DC8A 2GHUA 2OZ2A 2R9CA 4AXLA 1FH0A 2OULA 4W4UA 2DCBA 4N4ZA 2ATOA 1ME4A 1F2CA 2NQDB 9PAPA 1CSBB 4XR7A 3WXGA 4MZOA 4DMYA 3IEJA 1KXRA 3B79A 2VFBA 3BPMA 2IBIA 3IHPA 4DMXA 3KKUA 1QXPA 1KHQA 3IUTA 2DZYA 2AYNA 3LTWA 4OELA 1AYUA 2JQFR 1POPA 4QBBA 4W5BA 2NQGA 1GECE 1SNKA 2FT2A 3OF9A 4WA6A 3OF8A 3M99A 1CJLA 2DJFB 1BY8A 3PNRA 3D9WA 1GMYA 4CZWA 4HWYA 1EWOA 1ATKA 4W5CA 2R9NA 1CTEA 2DJGB 5CVOB 2WBFX 3HHIA 2P86A 2H7JA 2GFOA 3KX1A 1HUCB 1MEMA 4MSXA 4X6JA 4CDDB 2AUZA 1ICFA 4Q8GA 4YYWA 4YV8A 1PE6A 5JA7A 1NL6A 2G7YA 2DC7A 1TL9A 1PPOA 2HD5A 1W4TA 2CIOA 4PP2E 2HH5A 4G54A 4NV8A 3ZUAA 1X9YA 4FJCA 2BSZA 1EWLA 3PDFA 4Q8HA 2E00A 2AU1A 1YK8A 2XU1A 3H8BA 1CB5A 4FIPA 1DF0A 2YJ8A 3I3TA 3F5VA 3KWZA 2PREA 4N8WA 2DC9A 1O0EA 1K3BB 2YJBA 4C5PA 2Y6EA 2P0RA 4MZSA 1CVZA 1MEGA 1AU4A 2IPPB 3HD3A 2B1MA 1A6RA 3RVVA 2P7UA 3S3RA 3OISA 1PXVA 3H7DA 3TNXA 1U5IA 2NQAA 1IWDA 3ERVA 1KHPA 4BS6A 3N3KA 2BDZA 2DZZA 3V6CA 3AI8A 3USVA 5JH3A 4QRVA 3QJ3A 3I06A 3CBJA 2DCCA 4YYUA 1MIRA 1QOLA 1PPPA 1VJVA 3BWKA 3NHEA 4YVAA 1KFXL 2Y5BA 4PP1A 4FK5A 4P6EA 3BOWA 2G8JA 1ZIVA 4QH6A 3CBKA 5PADA 2JQGR 3K9MA 3MTNA 3O0UA 1AYWA 2FYEA 4I04A 4YYVA 3OVXA 3KSEA 3GCBA 5CVMA 3OVZA 2DC6A 4QRGA 2DCAA 1ZCMA 4YYQA 1YALA 2R9OA 3KW9A 1PIPA 3PW3A 3RVXA 2E03A 3N4CA 1Y4HA 2C0YA 3KWBX 2HHNA 2FRQA 3PBHA 3H89A 4K7CA 4P6GA 1PPNA 3HWNA 4ZUXU 2XU5A 1NB3A 2G8EA 1AU3A 2E02A 3K8UA 2YJCA 5EGWA 1W5RA 3D6SA 1S4VA 1NB5A 3O1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHV A;  1XKG A;  3MHS A;  3RVW A;  1ME3 A;  4KLB A;  4X6I A;  1BP4 A;  2R9M A;  1U9X A;  1GCB A;  2YJ2 A;  1AU2 A;  1PBH A;  1U9V A;  1PPD A;  3BC3 A;  1NPZ A;  4OEM A;  4YYR A;  2FUD A;  2OP3 A;  3U8E A;  3N3G A;  2FTD A;  2G6D A;  2F1G A;  1CPJ A;  2BDL A;  3C9E A;  3IMA A;  4PAD A;  4QRX A;  3HHA A;  3P5X A;  2R9F A;  2AIM A;  1YVB A;  1Q6K A;  5J94 A;  1PCI A;  3CH3 X;  1THE A;  3H8C A;  2PBH A;  2AVW A;  4I07 A;  2ARY A;  2O6X A;  3QT4 A;  1MHW A;  1U9Q X;  3K24 A;  4X6H A;  5EF4 A;  2FQ9 A;  3MHH A;  4BSQ A;  3P5W A;  1SP4 B;  2AYO A;  1EF7 A;  5F02 A;  2F7D A;  4BS5 A;  2FO5 A;  2ACT A;  1U9W A;  1JQP A;  5FPW A;  4BQV A;  1F2B A;  3S3Q A;  3LXS A;  1YT7 A;  3WXE A;  2VHF A;  1F29 A;  3LFY A;  4I05 A;  1VSN A;  8PCH A;  1Y08 A;  1MS6 A;  1ITO A;  1NLJ A;  3MOR A;  3P5U A;  1CS8 A;  5K16 A;  4PI3 A;  5CVN B;  2CB5 A;  3BPF A;  1DEU A;  3IOQ A;  1M6D A;  3E1Z B;  2YJ9 A;  1AEC A;  3KFQ A;  4AXM A;  1F2A A;  2PAD A;  4CDC B;  1YK7 A;  4BPV A;  6PAD A;  1TLO A;  2R6N A;  2XU4 A;  4YYS A;  1KFU L;  1BQI A;  1CV8 A;  1QDQ A;  3H6S A;  3IV2 A;  4N79 A;  1MDW A;  3BCN A;  1AYV A;  2FRA A;  4XUI A;  4RY2 A;  3P5V A;  3F75 A;  2NQI A;  4CDF B;  5CHT A;  2XU3 A;  2VHS A;  3CH2 X;  3WXF A;  7PCK A;  1BGO A;  1PAD A;  1STF E;  3QSD A;  1AU0 A;  2HXZ A;  1NQC A;  1TU6 A;  4CDE B;  2PNS A;  3V6E A;  5A24 A;  1AIM A;  1QMY A;  2DCD A;  1EWP A;  1CQD A;  2AUX A;  1EWM A;  2AS8 A;  2E01 A;  1GLO A;  2B1N A;  3DF0 A;  2DC8 A;  2GHU A;  2OZ2 A;  2R9C A;  4AXL A;  1FH0 A;  2OUL A;  4W4U A;  2DCB A;  4N4Z A;  2ATO A;  1ME4 A;  1F2C A;  2NQD B;  9PAP A;  1CSB B;  4XR7 A;  3WXG A;  4MZO A;  4DMY A;  3IEJ A;  1KXR A;  3B79 A;  3BPM A;  2IBI A;  3IHP A;  4DMX A;  3KKU A;  1QXP A;  1KHQ A;  3IUT A;  2DZY A;  2AYN A;  4OEL A;  1AYU A;  2JQF R;  1POP A;  4QBB A;  4W5B A;  2NQG A;  1GEC E;  1SNK A;  2FT2 A;  3OF9 A;  4WA6 A;  3OF8 A;  3M99 A;  1CJL A;  2DJF B;  1BY8 A;  3PNR A;  1GMY A;  4CZW A;  4HWY A;  1EWO A;  1ATK A;  4W5C A;  2R9N A;  1CTE A;  2DJG B;  5CVO B;  2WBF X;  3HHI A;  2P86 A;  2H7J A;  2GFO A;  3KX1 A;  1HUC B;  1MEM A;  4MSX A;  4X6J A;  4CDD B;  2AUZ A;  1ICF A;  4Q8G A;  4YYW A;  4YV8 A;  1PE6 A;  5JA7 A;  1NL6 A;  2G7Y A;  2DC7 A;  1TL9 A;  1PPO A;  2HD5 A;  2CIO A;  4PP2 E;  2HH5 A;  4G54 A;  3ZUA A;  1X9Y A;  4FJC A;  1EWL A;  3PDF A;  4Q8H A;  2E00 A;  2AU1 A;  1YK8 A;  2XU1 A;  3H8B A;  1CB5 A;  4FIP A;  1DF0 A;  2YJ8 A;  3I3T A;  3F5V A;  3KWZ A;  2PRE A;  4N8W A;  2DC9 A;  1O0E A;  1K3B B;  2YJB A;  2Y6E A;  2P0R A;  4MZS A;  1CVZ A;  1MEG A;  1AU4 A;  2IPP B;  3HD3 A;  2B1M A;  1A6R A;  3RVV A;  2P7U A;  3S3R A;  3OIS A;  1PXV A;  3H7D A;  3TNX A;  1U5I A;  2NQA A;  1IWD A;  3ERV A;  1KHP A;  4BS6 A;  3N3K A;  2BDZ A;  2DZZ A;  3V6C A;  3AI8 A;  3USV A;  5JH3 A;  4QRV A;  3QJ3 A;  3I06 A;  3CBJ A;  2DCC A;  4YYU A;  1MIR A;  1QOL A;  1PPP A;  1VJV A;  3BWK A;  3NHE A;  4YVA A;  1KFX L;  2Y5B A;  4PP1 A;  4FK5 A;  4P6E A;  3BOW A;  2G8J A;  1ZIV A;  4QH6 A;  3CBK A;  5PAD A;  2JQG R;  3K9M A;  3MTN A;  3O0U A;  1AYW A;  2FYE A;  4I04 A;  4YYV A;  3OVX A;  3KSE A;  3GCB A;  5CVM A;  3OVZ A;  2DC6 A;  4QRG A;  2DCA A;  1ZCM A;  4YYQ A;  1YAL A;  2R9O A;  3KW9 A;  1PIP A;  3PW3 A;  3RVX A;  2E03 A;  3N4C A;  1Y4H A;  2C0Y A;  3KWB X;  2HHN A;  2FRQ A;  3PBH A;  3H89 A;  4K7C A;  4P6G A;  1PPN A;  3HWN A;  4ZUX U;  2XU5 A;  1NB3 A;  2G8E A;  1AU3 A;  2E02 A;  3K8U A;  2YJC A;  5EGW A;  3D6S A;  1S4V A;  1NB5 A;  3O1G A; 
#chains in the Genus database with same CATH topology
 5CHV A;  1XKG A;  3MHS A;  3RVW A;  1ME3 A;  4KLB A;  1DKI A;  4X6I A;  1BP4 A;  2R9M A;  1U9X A;  1GCB A;  2YJ2 A;  1AU2 A;  1PBH A;  1U9V A;  1PPD A;  3BC3 A;  4BOS A;  1NPZ A;  4OEM A;  4YYR A;  2FUD A;  2OP3 A;  3U8E A;  3N3G A;  2FTD A;  3RNV A;  2G6D A;  2F1G A;  1CPJ A;  4MI7 A;  2BDL A;  3C9E A;  3IMA A;  4PAD A;  4QRX A;  3HHA A;  3P5X A;  2R9F A;  3MJ5 A;  2AIM A;  3PHU A;  1YVB A;  1Q6K A;  5J94 A;  1PCI A;  3CH3 X;  4A5U A;  3TRK A;  1THE A;  3H8C A;  2PBH A;  2AVW A;  4I07 A;  2ARY A;  2O6X A;  3QT4 A;  1MHW A;  1U9Q X;  3K24 A;  4X6H A;  5EF4 A;  2FQ9 A;  3MHH A;  4BSQ A;  2BU3 A;  5E6J A;  3P5W A;  1SP4 B;  2AYO A;  1EF7 A;  5F02 A;  2F7D A;  4BS5 A;  2FO5 A;  2ACT A;  1U9W A;  1JQP A;  2JTC A;  5FPW A;  4GUA A;  4BQV A;  2J7Q C;  3E9S A;  1F2B A;  3S3Q A;  3LXS A;  1YT7 A;  3WXE A;  3BBA A;  2VHF A;  1F29 A;  2UZJ A;  3LFY A;  4I05 A;  1VSN A;  8PCH A;  1Y08 A;  1MS6 A;  3W30 A;  1ITO A;  3IFU A;  4OVZ B;  1NLJ A;  3MOR A;  3P5U A;  1YZB A;  1CS8 A;  1UKF A;  5K16 A;  4PI3 A;  5CVN B;  2CB5 A;  5EZQ A;  3BPF A;  1DEU A;  3IOQ A;  1M6D A;  3E1Z B;  3PHX A;  2YJ9 A;  1AEC A;  3KFQ A;  4AXM A;  1F2A A;  2PAD A;  4CDC B;  1YK7 A;  4BPV A;  6PAD A;  1TLO A;  2R6N A;  4RF0 A;  2XU4 A;  4YYS A;  1KFU L;  1BQI A;  1CV8 A;  4MM3 B;  1QDQ A;  3H6S A;  3IV2 A;  4N79 A;  1MDW A;  3BCN A;  1AYV A;  2FRA A;  4XUI A;  4RY2 A;  3ZNH A;  3P5V A;  3F75 A;  2NQI A;  4CDF B;  5CHT A;  2XU3 A;  2VHS A;  3CH2 X;  3WXF A;  7PCK A;  1BGO A;  1PAD A;  3TMP A;  4XZX A;  1STF E;  3QSD A;  1AU0 A;  2HXZ A;  1NQC A;  1TU6 A;  4CDE B;  2PNS A;  3V6E A;  5A24 A;  1AIM A;  1QMY A;  2DCD A;  1EWP A;  1CQD A;  2AUX A;  4BOU A;  1EWM A;  2AS8 A;  2E01 A;  1GLO A;  2B1N A;  3DF0 A;  4BOP A;  2DC8 A;  2GHU A;  2OZ2 A;  2R9C A;  4AXL A;  1FH0 A;  2OUL A;  4W4U A;  2DCB A;  2HWK A;  4OVZ A;  4N4Z A;  2ATO A;  1ME4 A;  3PRP A;  3BB7 A;  1F2C A;  2NQD B;  9PAP A;  1CSB B;  4XR7 A;  3WXG A;  4MZO A;  4DMY A;  3IEJ A;  1KXR A;  3B79 A;  3O65 A;  3BPM A;  2IBI A;  3IHP A;  4DMX A;  3KKU A;  1QXP A;  1KHQ A;  3IUT A;  4D8I A;  2DZY A;  2AYN A;  4OEL A;  1AYU A;  2JQF R;  1POP A;  3W31 A;  4QBB A;  4W5B A;  2NQG A;  1GEC E;  1SNK A;  4M0W A;  2FT2 A;  3OF9 A;  4WA6 A;  3OF8 A;  3M99 A;  1CJL A;  2DJF B;  4BOQ A;  1BY8 A;  3PNR A;  1GMY A;  4CZW A;  4HWY A;  1EWO A;  1ATK A;  5JZE A;  4W5C A;  2R9N A;  1CTE A;  2DJG B;  5CVO B;  2WBF X;  3HHI A;  2P86 A;  2BTW A;  2H7J A;  2GFO A;  3KX1 A;  1HUC B;  2Z84 A;  1MEM A;  2FE8 A;  4MSX A;  4X6J A;  4CDD B;  2AUZ A;  2J7Q A;  1ICF A;  4Q8G A;  4YYW A;  4YV8 A;  1PE6 A;  5JA7 A;  4RKX A;  1NL6 A;  2G7Y A;  2DC7 A;  3MP2 A;  1TL9 A;  1PPO A;  2HD5 A;  2CIO A;  4PP2 E;  4ZTB A;  2HH5 A;  4G54 A;  3ZUA A;  1X9Y A;  4FJC A;  1EWL A;  3PDF A;  4Q8H A;  2E00 A;  2AU1 A;  1YK8 A;  2XU1 A;  3H8B A;  1CB5 A;  4PT5 A;  2BTW B;  1DF0 A;  4FIP A;  2YJ8 A;  3I3T A;  3F5V A;  3KWZ A;  2PRE A;  3B21 A;  4N8W A;  2DC9 A;  1O0E A;  5EZS A;  1K3B B;  2YJB A;  2Y6E A;  2P0R A;  4MZS A;  1CVZ A;  1MEG A;  1AU4 A;  2IPP B;  4D8B A;  4IUM A;  4P16 A;  3HD3 A;  2B1M A;  1A6R A;  3PSE A;  3RVV A;  4R3D A;  2P7U A;  3S3R A;  3OIS A;  1PXV A;  3H7D A;  3TNX A;  1U5I A;  2NQA A;  1IWD A;  3ERV A;  1KHP A;  4BS6 A;  3N3K A;  2BDZ A;  2DZZ A;  3V6C A;  2JRI A;  4RNA A;  3AI8 A;  4WUR A;  3USV A;  5KO3 A;  5JH3 A;  3MTV A;  4QRV A;  3QJ3 A;  3I06 A;  3CBJ A;  2DCC A;  4YYU A;  1MIR A;  1QOL A;  1PPP A;  4REZ A;  1VJV A;  3BWK A;  3NHE A;  4YVA A;  1KFX L;  2Y5B A;  3PRM A;  4FK5 A;  4PP1 A;  4BOZ A;  4P6E A;  3BOW A;  2G8J A;  1ZIV A;  4QH6 A;  3CBK A;  5PAD A;  2JQG R;  1PVJ A;  3K9M A;  3MTN A;  3O0U A;  1AYW A;  2FYE A;  4I04 A;  4YYV A;  4OW0 A;  4IP3 A;  3OQC A;  3OVX A;  3KSE A;  3GCB A;  5CVM A;  3OVZ A;  2DC6 A;  4QRG A;  2DCA A;  1ZCM A;  4YYQ A;  1YAL A;  2R9O A;  4RF1 A;  3KW9 A;  1PIP A;  4D8E A;  3PW3 A;  3RVX A;  2E03 A;  2AGA A;  3N4C A;  1Y4H A;  2C0Y A;  3KWB X;  2HHN A;  2FRQ A;  3PBH A;  3H89 A;  4K7C A;  3BY4 A;  4P6G A;  1PPN A;  3HWN A;  4ZUX U;  2XU5 A;  1NB3 A;  2G8E A;  4HXD B;  1AU3 A;  3C0R A;  3PT2 A;  2E02 A;  3K8U A;  2YJC A;  5EGW A;  2DOS A;  3PHW A;  3D6S A;  1S4V A;  1NB5 A;  3O1G A; 
#chains in the Genus database with same CATH homology
 5CHV A;  1XKG A;  3MHS A;  3RVW A;  1ME3 A;  4KLB A;  4X6I A;  1BP4 A;  2R9M A;  1U9X A;  1GCB A;  2YJ2 A;  1AU2 A;  1PBH A;  1W6F A;  1U9V A;  1PPD A;  3BC3 A;  1NPZ A;  4OEM A;  4YYR A;  2FUD A;  2OP3 A;  3U8E A;  3N3G A;  2FTD A;  2G6D A;  2F1G A;  1CPJ A;  4BGF A;  2BDL A;  3C9E A;  3IMA A;  4PAD A;  4QRX A;  3HHA A;  3P5X A;  4B55 A;  2R9F A;  2AIM A;  1YVB A;  1Q6K A;  5J94 A;  1PCI A;  3CH3 X;  1THE A;  3H8C A;  2PBH A;  2AVW A;  4I07 A;  2ARY A;  2O6X A;  3QT4 A;  1MHW A;  1U9Q X;  3K24 A;  4X6H A;  5EF4 A;  2FQ9 A;  3MHH A;  4BSQ A;  3P5W A;  1SP4 B;  2AYO A;  1EF7 A;  5F02 A;  1E2T A;  2F7D A;  4BS5 A;  2FO5 A;  2ACT A;  1U9W A;  1JQP A;  5FPW A;  4BQV A;  1F2B A;  3S3Q A;  3LXS A;  1YT7 A;  3WXE A;  2VHF A;  1F29 A;  3LFY A;  4I05 A;  2VFC A;  1VSN A;  8PCH A;  1Y08 A;  1MS6 A;  4GUZ A;  1ITO A;  1NLJ A;  3MOR A;  3P5U A;  1CS8 A;  5K16 A;  4PI3 A;  5CVN B;  2CB5 A;  3BPF A;  1DEU A;  3IOQ A;  1M6D A;  3E1Z B;  2YJ9 A;  1AEC A;  3KFQ A;  4AXM A;  1F2A A;  2PAD A;  4CDC B;  1YK7 A;  4BPV A;  6PAD A;  1TLO A;  2R6N A;  2XU4 A;  4YYS A;  1KFU L;  1BQI A;  1CV8 A;  1QDQ A;  3H6S A;  3IV2 A;  4N79 A;  1MDW A;  3BCN A;  1AYV A;  2FRA A;  4XUI A;  4RY2 A;  3P5V A;  3F75 A;  2NQI A;  4CDF B;  5CHT A;  2XU3 A;  2VHS A;  3CH2 X;  3WXF A;  7PCK A;  1BGO A;  1PAD A;  1STF E;  3QSD A;  1AU0 A;  2HXZ A;  1NQC A;  1TU6 A;  4CDE B;  2PNS A;  3V6E A;  5A24 A;  1AIM A;  1QMY A;  2DCD A;  1EWP A;  1CQD A;  2AUX A;  1GX3 A;  1EWM A;  2AS8 A;  2E01 A;  4NV7 A;  1GLO A;  2B1N A;  3DF0 A;  2DC8 A;  2GHU A;  2OZ2 A;  2R9C A;  4AXL A;  1FH0 A;  2OUL A;  4W4U A;  2DCB A;  4N4Z A;  2ATO A;  1ME4 A;  1F2C A;  2NQD B;  9PAP A;  1CSB B;  4XR7 A;  3WXG A;  4MZO A;  4DMY A;  3IEJ A;  1KXR A;  3B79 A;  2VFB A;  3BPM A;  2IBI A;  3IHP A;  4DMX A;  3KKU A;  1QXP A;  1KHQ A;  3IUT A;  2DZY A;  2AYN A;  3LTW A;  4OEL A;  1AYU A;  2JQF R;  1POP A;  4QBB A;  4W5B A;  2NQG A;  1GEC E;  1SNK A;  2FT2 A;  3OF9 A;  4WA6 A;  3OF8 A;  3M99 A;  1CJL A;  2DJF B;  1BY8 A;  3PNR A;  3D9W A;  1GMY A;  4CZW A;  4HWY A;  1EWO A;  1ATK A;  4W5C A;  2R9N A;  1CTE A;  2DJG B;  5CVO B;  2WBF X;  3HHI A;  2P86 A;  2H7J A;  2GFO A;  3KX1 A;  1HUC B;  1MEM A;  4MSX A;  4X6J A;  4CDD B;  2AUZ A;  1ICF A;  4Q8G A;  4YYW A;  4YV8 A;  1PE6 A;  5JA7 A;  1NL6 A;  2G7Y A;  2DC7 A;  1TL9 A;  1PPO A;  2HD5 A;  1W4T A;  2CIO A;  4PP2 E;  2HH5 A;  4G54 A;  4NV8 A;  3ZUA A;  1X9Y A;  4FJC A;  2BSZ A;  1EWL A;  3PDF A;  4Q8H A;  2E00 A;  2AU1 A;  1YK8 A;  2XU1 A;  3H8B A;  1CB5 A;  4FIP A;  1DF0 A;  2YJ8 A;  3I3T A;  3F5V A;  3KWZ A;  2PRE A;  4N8W A;  2DC9 A;  1O0E A;  1K3B B;  2YJB A;  4C5P A;  2Y6E A;  2P0R A;  4MZS A;  1CVZ A;  1MEG A;  1AU4 A;  2IPP B;  3HD3 A;  2B1M A;  1A6R A;  3RVV A;  2P7U A;  3S3R A;  3OIS A;  1PXV A;  3H7D A;  3TNX A;  1U5I A;  2NQA A;  1IWD A;  3ERV A;  1KHP A;  4BS6 A;  3N3K A;  2BDZ A;  2DZZ A;  3V6C A;  3AI8 A;  3USV A;  5JH3 A;  4QRV A;  3QJ3 A;  3I06 A;  3CBJ A;  2DCC A;  4YYU A;  1MIR A;  1QOL A;  1PPP A;  1VJV A;  3BWK A;  3NHE A;  4YVA A;  1KFX L;  2Y5B A;  4PP1 A;  4FK5 A;  4P6E A;  3BOW A;  2G8J A;  1ZIV A;  4QH6 A;  3CBK A;  5PAD A;  2JQG R;  3K9M A;  3MTN A;  3O0U A;  1AYW A;  2FYE A;  4I04 A;  4YYV A;  3OVX A;  3KSE A;  3GCB A;  5CVM A;  3OVZ A;  2DC6 A;  4QRG A;  2DCA A;  1ZCM A;  4YYQ A;  1YAL A;  2R9O A;  3KW9 A;  1PIP A;  3PW3 A;  3RVX A;  2E03 A;  3N4C A;  1Y4H A;  2C0Y A;  3KWB X;  2HHN A;  2FRQ A;  3PBH A;  3H89 A;  4K7C A;  4P6G A;  1PPN A;  3HWN A;  4ZUX U;  2XU5 A;  1NB3 A;  2G8E A;  1AU3 A;  2E02 A;  3K8U A;  2YJC A;  5EGW A;  1W5R A;  3D6S A;  1S4V A;  1NB5 A;  3O1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...