2FTDA

Crystal structure of cathepsin k complexed with 7-methyl-substituted azepan-3-one compound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure activity relationships of 5-, 6-, and 7-methyl-substituted azepan-3-one cathepsin K inhibitors.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ftdA00
1FH0A 1AECA 1AU2A 1EWOA 3BPMA 2AS8A 3V6EA 1NL6A 1IWDA 3HWNA 1PPOA 4P6EA 3H89A 2OZ2A 2YJ9A 3PDFA 1Q6KA 3QJ3A 6PADA 2FRQA 2G6DA 2YJ8A 1GCBA 1AYVA 2PADA 4N8WA 2OP3A 3RVXA 3IMAA 1GLOA 5A24A 3S3RA 3P5UA 1ICFA 2AYNA 2YJCA 3PBHA 4I04A 4MSXA 2R9NA 2XU4A 2ARYA 2B1NA 1DEUA 2DC8A 4RY2A 2DC9A 4AXLA 2IBIA 5EF4A 1U9WA 3WXEA 2R6NA 4N4ZA 3IEJA 1YK7A 1JQPA 1NB3A 1ME4A 4CDEB 4BPVA 4ZUXU 3BC3A 4I05A 4W4UA 1K3BB 1Y08A 2DCAA 2HHNA 2F7DA 5CVMA 1MEGA 1YK8A 3CBKA 1F29A 3MHHA 4OEMA 1NQCA 5PADA 5JH3A 1QDQA 2E02A 4YV8A 2E03A 2XU3A 1U5IA 1EF7A 2CIOA 2FQ9A 1CB5A 4BS5A 3WXGA 3OVZA 4YYSA 2R9CA 1HUCB 3IOQA 3PW3A 1PCIA 1PPDA 3HD3A 4QRXA 2NQIA 1CS8A 1F2BA 3P5WA 3PNRA 3KW9A 4YYVA 1MHWA 1SNKA 1YT7A 5JA7A 2PREA 3RVWA 4KLBA 5J94A 1AU0A 1PBHA 4QRGA 1ATKA 3KFQA 1NPZA 2DCDA 4BQVA 1ZCMA 4CDFB 2P7UA 3U8EA 1EWMA 3M99A 4YYRA 1MEMA 1QXPA 1GECE 1CJLA 1THEA 4WA6A 3N4CA 3B79A 1ZIVA 3KKUA 1CSBB 2YJ2A 2P86A 2XU1A 2AVWA 2G7YA 3GCBA 2DC6A 1BGOA 3LXSA 3O1GA 3RVVA 2PBHA 1MS6A 1TU6A 2H7JA 3OF9A 4G54A 3O0UA 9PAPA 3MTNA 3CH2X 2R9FA 5CHTA 1M6DA 3V6CA 4W5CA 1PIPA 2NQDB 2FYEA 1U9XA 1PPPA 2NQGA 3F75A 2PNSA 2HXZA 4FIPA 1GMYA 4CZWA 1TLOA 3IUTA 3BOWA 1AYWA 2JQGR 4CDDB 2DZZA 3BWKA 4YYQA 3OF8A 5EGWA 3IV2A 3WXFA 7PCKA 3MORA 3CH3X 4PI3A 2AUZA 1F2AA 2ATOA 3TNXA 2B1MA 2DZYA 5CHVA 1YALA 3H6SA 4YVAA 2C0YA 1KHPA 3D6SA 4Q8HA 3K9MA 3N3KA 3LFYA 1F2CA 2VHSA 3ZUAA 4DMXA 1PADA 4XR7A 3K8UA 3P5XA 1U9QX 4QBBA 2ACTA 3E1ZB 4XUIA 3HHAA 3DF0A 5FPWA 2BDLA 5CVNB 1PXVA 2AU1A 4AXMA 2E00A 3KWBX 1EWLA 2DJGB 1QMYA 1STFE 2HH5A 1Y4HA 3CBJA 3K24A 1O0EA 1KFUL 3I06A 4X6JA 4HWYA 4I07A 3N3GA 2DC7A 1DF0A 4DMYA 1NB5A 1BQIA 2YJBA 3BPFA 2FUDA 5CVOB 2FT2A 2IPPB 1EWPA 4MZSA 2P0RA 3H8CA 4PP1A 5K16A 1ME3A 8PCHA 3H8BA 4PADA 4BSQA 3NHEA 3QSDA 3H7DA 2AYOA 1BY8A 2DJFB 3MHSA 2FTDA 4FK5A 3KX1A 4CDCB 2FO5A 2NQAA 3KSEA 4X6IA 4FJCA 2JQFR 1VSNA 3OVXA 1X9YA 2HD5A 1ITOA 4N79A 4YYUA 1KXRA 3BCNA 1CPJA 4PP2E 2AIMA 4P6GA 2DCCA 4X6HA 1AYUA 1NLJA 1AIMA 2VHFA 1CVZA 1MIRA 2G8EA 2OULA 4QRVA 1BP4A 1CV8A 1CTEA 1PE6A 1QOLA 1XKGA 1YVBA 2Y6EA 3P5VA 2G8JA 2GHUA 1KFXL 1CQDA 2Y5BA 3F5VA 4OELA 3HHIA 3I3TA 2XU5A 2O6XA 3QT4A 3C9EA 1MDWA 2F1GA 3IHPA 1PPNA 1KHQA 2CB5A 1AU3A 2GFOA 2R9MA 4Q8GA 4YYWA 2WBFX 2E01A 3OISA 4K7CA 1A6RA 1SP4B 2BDZA 4BS6A 1AU4A 4W5BA 1S4VA 3ERVA 3S3QA 2FRAA 3KWZA 3USVA 2AUXA 4MZOA 5F02A 4QH6A 3AI8A 1U9VA 1TL9A 1VJVA 2R9OA 1POPA 2DCBA
chains in the Genus database with same CATH superfamily
5EZSA 1FH0A 1AECA 1AU2A 1EWOA 3BPMA 2AS8A 3V6EA 1NL6A 1IWDA 3HWNA 1PPOA 4P6EA 3H89A 2OZ2A 2YJ9A 3B21A 3PDFA 1Q6KA 3QJ3A 5EZQA 5KO3A 4ZTBA 6PADA 2FRQA 2G6DA 2YJ8A 1GCBA 1AYVA 2PADA 4N8WA 2OP3A 3RVXA 2BU3A 3IMAA 1GLOA 5A24A 3S3RA 3P5UA 1ICFA 2AYNA 2YJCA 3MP2A 3PBHA 4I04A 4MSXA 2R9NA 2XU4A 2ARYA 2B1NA 1DEUA 2DC8A 3RNVA 4RY2A 2DC9A 4AXLA 2IBIA 5EF4A 1U9WA 3WXEA 2R6NA 4N4ZA 3IEJA 4A5UA 1YK7A 1JQPA 4BOZA 1NB3A 1ME4A 4CDEB 4BPVA 4ZUXU 3BC3A 4I05A 4W4UA 1K3BB 1Y08A 2DCAA 2HHNA 2F7DA 5CVMA 1MEGA 1YK8A 4REZA 5E6JA 3CBKA 4IP3A 1F29A 3MHHA 4OEMA 1NQCA 5PADA 5JH3A 3PT2A 1QDQA 2E02A 4MI7A 4YV8A 2E03A 2XU3A 1U5IA 1EF7A 2CIOA 2FQ9A 1CB5A 4BS5A 3WXGA 3OVZA 4RKXA 4YYSA 2R9CA 4D8BA 1HUCB 3IOQA 3PW3A 1PCIA 1PPDA 3HD3A 4QRXA 2NQIA 1CS8A 1F2BA 4RNAA 3P5WA 3PNRA 3KW9A 4YYVA 1MHWA 1SNKA 1YT7A 5JA7A 2PREA 4BOQA 2BTWB 3RVWA 4KLBA 5J94A 1AU0A 2J7QA 1PBHA 4QRGA 1ATKA 3KFQA 1NPZA 2DCDA 4BQVA 1ZCMA 4CDFB 2P7UA 4OVZB 3U8EA 1EWMA 3M99A 4YYRA 1MEMA 1QXPA 1GECE 1CJLA 1THEA 4WA6A 3N4CA 3B79A 1ZIVA 3KKUA 1CSBB 2YJ2A 2P86A 2XU1A 2AVWA 2G7YA 3GCBA 2DC6A 2UZJA 1BGOA 3LXSA 3O1GA 2PBHA 1MS6A 3RVVA 1TU6A 2H7JA 3OF9A 4G54A 3O0UA 9PAPA 3MTNA 3CH2X 2R9FA 5CHTA 1M6DA 3V6CA 4RF0A 4W5CA 1PIPA 2NQDB 2FYEA 1U9XA 4OW0A 1PPPA 2NQGA 3F75A 2PNSA 2DOSA 2HXZA 4FIPA 1GMYA 3TMPA 4CZWA 1TLOA 4MM3B 3IUTA 4M0WA 2JTCA 3BOWA 1AYWA 2JQGR 4CDDB 2DZZA 3MJ5A 3IFUA 3BWKA 4YYQA 1YZBA 3OF8A 5EGWA 3IV2A 3WXFA 7PCKA 4HXDB 3MORA 3CH3X 4BOUA 3BBAA 4PI3A 2AUZA 3W30A 1F2AA 2ATOA 3TNXA 2HWKA 1UKFA 2B1MA 2DZYA 5CHVA 1YALA 4D8EA 3H6SA 4YVAA 2AGAA 2C0YA 1KHPA 3D6SA 4Q8HA 3K9MA 3N3KA 3LFYA 1F2CA 2VHSA 3C0RA 3BY4A 4PT5A 4P16A 3ZUAA 4DMXA 1PADA 4XR7A 3K8UA 3P5XA 1U9QX 4OVZA 3PSEA 4QBBA 3MTVA 2ACTA 3E1ZB 4XUIA 3HHAA 3DF0A 5FPWA 2BDLA 5CVNB 1PXVA 2AU1A 4AXMA 2E00A 3KWBX 4WURA 1EWLA 2DJGB 3PHWA 1QMYA 1STFE 2HH5A 1Y4HA 3CBJA 3K24A 4GUAA 1O0EA 1KFUL 1PVJA 3I06A 4X6JA 4HWYA 2J7QC 4I07A 2FE8A 3N3GA 2DC7A 1DF0A 4DMYA 1NB5A 1BQIA 2YJBA 3BPFA 2FUDA 5CVOB 2FT2A 2IPPB 1EWPA 4MZSA 2P0RA 3H8CA 4PP1A 5K16A 1ME3A 3O65A 4XZXA 8PCHA 3H8BA 4PADA 4BSQA 3NHEA 3QSDA 3H7DA 2AYOA 1BY8A 3W31A 2DJFB 3MHSA 2FTDA 4FK5A 3PRMA 3KX1A 4CDCB 4D8IA 2FO5A 2NQAA 3KSEA 4X6IA 2JRIA 4FJCA 2JQFR 3TRKA 1VSNA 3OVXA 1X9YA 2HD5A 4IUMA 1ITOA 4N79A 4YYUA 1KXRA 3BCNA 1CPJA 4PP2E 2AIMA 4P6GA 2DCCA 4X6HA 1AYUA 1NLJA 1AIMA 2VHFA 1CVZA 1MIRA 2G8EA 2OULA 4QRVA 1BP4A 1CV8A 1CTEA 1PE6A 1QOLA 1XKGA 1YVBA 2Y6EA 3P5VA 2G8JA 2GHUA 1KFXL 1CQDA 3PHUA 2Y5BA 3F5VA 4OELA 3BB7A 1DKIA 3HHIA 4BOSA 3I3TA 2XU5A 2O6XA 3QT4A 4RF1A 4BOPA 3C9EA 1MDWA 2F1GA 3IHPA 3E9SA 1PPNA 1KHQA 2CB5A 1AU3A 2GFOA 2R9MA 4Q8GA 4YYWA 2BTWA 2WBFX 2E01A 4R3DA 5JZEA 3PRPA 3OISA 4K7CA 1A6RA 1SP4B 2BDZA 4BS6A 1AU4A 4W5BA 1S4VA 3ERVA 3S3QA 2FRAA 3ZNHA 3KWZA 3USVA 2AUXA 4MZOA 5F02A 3OQCA 4QH6A 3AI8A 1U9VA 1TL9A 1VJVA 3PHXA 2Z84A 2R9OA 1POPA 2DCBA
chains in the Genus database with same CATH topology
1GX3A 1FH0A 1AECA 1W4TA 1AU2A 1EWOA 3BPMA 2AS8A 3V6EA 1NL6A 1IWDA 3HWNA 1PPOA 4P6EA 3H89A 2OZ2A 2YJ9A 3PDFA 1Q6KA 2VFBA 3QJ3A 6PADA 2FRQA 2G6DA 2YJ8A 1GCBA 1AYVA 2PADA 4C5PA 4N8WA 2OP3A 3RVXA 3IMAA 1GLOA 5A24A 3S3RA 3P5UA 4GUZA 1ICFA 2AYNA 2YJCA 3PBHA 4I04A 4MSXA 2R9NA 2XU4A 4NV7A 2ARYA 2B1NA 4BGFA 1DEUA 2DC8A 4RY2A 1W6FA 2DC9A 4AXLA 2IBIA 5EF4A 1U9WA 3WXEA 2R6NA 4N4ZA 3IEJA 1YK7A 1JQPA 1NB3A 1ME4A 4CDEB 4BPVA 4ZUXU 3BC3A 4I05A 4W4UA 1K3BB 1Y08A 2DCAA 2HHNA 2F7DA 5CVMA 1MEGA 1YK8A 3CBKA 1F29A 3MHHA 4OEMA 1NQCA 5PADA 5JH3A 1QDQA 2E02A 4YV8A 2E03A 2XU3A 1U5IA 1EF7A 2CIOA 2FQ9A 1CB5A 4BS5A 3WXGA 3OVZA 4YYSA 2R9CA 1HUCB 3IOQA 3PW3A 1PCIA 1PPDA 3HD3A 4QRXA 2NQIA 1CS8A 1F2BA 3P5WA 3PNRA 3KW9A 4YYVA 1MHWA 1SNKA 1YT7A 5JA7A 2PREA 3RVWA 4KLBA 5J94A 1AU0A 1PBHA 4QRGA 1ATKA 3KFQA 1NPZA 2DCDA 4BQVA 1ZCMA 4CDFB 2P7UA 3U8EA 1EWMA 3M99A 4YYRA 1MEMA 1QXPA 1GECE 1CJLA 1THEA 4WA6A 3N4CA 3B79A 1ZIVA 3KKUA 1CSBB 2YJ2A 2P86A 2XU1A 2AVWA 2G7YA 3GCBA 2DC6A 1BGOA 3LXSA 3O1GA 2PBHA 1MS6A 3RVVA 1TU6A 2H7JA 3OF9A 1E2TA 4G54A 3O0UA 9PAPA 3MTNA 3CH2X 2R9FA 5CHTA 1M6DA 3V6CA 4W5CA 1PIPA 2NQDB 2FYEA 1U9XA 1PPPA 2NQGA 3F75A 2PNSA 2HXZA 4FIPA 1GMYA 4CZWA 1TLOA 3IUTA 3BOWA 1AYWA 2JQGR 4CDDB 2DZZA 3BWKA 4YYQA 3OF8A 5EGWA 3IV2A 3WXFA 7PCKA 3MORA 3CH3X 4PI3A 2AUZA 1F2AA 2ATOA 3TNXA 2B1MA 2DZYA 3LTWA 3D9WA 5CHVA 1YALA 2VFCA 3H6SA 4YVAA 2C0YA 2BSZA 1KHPA 3D6SA 4Q8HA 3K9MA 3N3KA 3LFYA 1F2CA 2VHSA 3ZUAA 4DMXA 1PADA 4XR7A 3K8UA 3P5XA 1U9QX 4QBBA 2ACTA 3E1ZB 4XUIA 3HHAA 3DF0A 5FPWA 2BDLA 5CVNB 1PXVA 2AU1A 4AXMA 2E00A 3KWBX 1EWLA 2DJGB 1QMYA 1STFE 2HH5A 1Y4HA 3CBJA 3K24A 1O0EA 1KFUL 3I06A 4X6JA 4HWYA 4I07A 3N3GA 2DC7A 1DF0A 4DMYA 4B55A 1NB5A 1BQIA 2YJBA 3BPFA 2FUDA 5CVOB 2FT2A 2IPPB 1EWPA 4MZSA 2P0RA 3H8CA 4PP1A 5K16A 1ME3A 8PCHA 3H8BA 4PADA 4BSQA 3NHEA 3QSDA 3H7DA 2AYOA 1BY8A 2DJFB 3MHSA 2FTDA 4FK5A 3KX1A 4CDCB 2FO5A 2NQAA 3KSEA 4X6IA 4FJCA 2JQFR 1VSNA 3OVXA 1X9YA 2HD5A 1ITOA 4N79A 4YYUA 1KXRA 3BCNA 1CPJA 4PP2E 2AIMA 4P6GA 2DCCA 4X6HA 1AYUA 1NLJA 1AIMA 2VHFA 1CVZA 1MIRA 2G8EA 2OULA 4QRVA 1BP4A 1CV8A 1CTEA 1PE6A 1QOLA 1XKGA 1YVBA 2Y6EA 3P5VA 2G8JA 2GHUA 1KFXL 1CQDA 2Y5BA 3F5VA 4OELA 3HHIA 3I3TA 2XU5A 2O6XA 3QT4A 3C9EA 1MDWA 2F1GA 3IHPA 1PPNA 1KHQA 2CB5A 1AU3A 4NV8A 2GFOA 1W5RA 2R9MA 4Q8GA 4YYWA 2WBFX 2E01A 3OISA 4K7CA 1A6RA 1SP4B 2BDZA 4BS6A 1AU4A 4W5BA 1S4VA 3ERVA 3S3QA 2FRAA 3KWZA 3USVA 2AUXA 4MZOA 5F02A 4QH6A 3AI8A 1U9VA 1TL9A 1VJVA 2R9OA 1POPA 2DCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FH0 A;  1AEC A;  1AU2 A;  1EWO A;  3BPM A;  2AS8 A;  3V6E A;  1NL6 A;  1IWD A;  3HWN A;  1PPO A;  4P6E A;  3H89 A;  2OZ2 A;  2YJ9 A;  3PDF A;  1Q6K A;  3QJ3 A;  6PAD A;  2FRQ A;  2G6D A;  2YJ8 A;  1GCB A;  1AYV A;  2PAD A;  4N8W A;  2OP3 A;  3RVX A;  3IMA A;  1GLO A;  5A24 A;  3S3R A;  3P5U A;  1ICF A;  2AYN A;  2YJC A;  3PBH A;  4I04 A;  4MSX A;  2R9N A;  2XU4 A;  2ARY A;  2B1N A;  1DEU A;  2DC8 A;  4RY2 A;  2DC9 A;  4AXL A;  2IBI A;  5EF4 A;  1U9W A;  3WXE A;  2R6N A;  4N4Z A;  3IEJ A;  1YK7 A;  1JQP A;  1NB3 A;  1ME4 A;  4CDE B;  4BPV A;  4ZUX U;  3BC3 A;  4I05 A;  4W4U A;  1K3B B;  1Y08 A;  2DCA A;  2HHN A;  2F7D A;  5CVM A;  1MEG A;  1YK8 A;  3CBK A;  1F29 A;  3MHH A;  4OEM A;  1NQC A;  5PAD A;  5JH3 A;  1QDQ A;  2E02 A;  4YV8 A;  2E03 A;  2XU3 A;  1U5I A;  1EF7 A;  2CIO A;  2FQ9 A;  1CB5 A;  4BS5 A;  3WXG A;  3OVZ A;  4YYS A;  2R9C A;  1HUC B;  3IOQ A;  3PW3 A;  1PCI A;  1PPD A;  3HD3 A;  4QRX A;  2NQI A;  1CS8 A;  1F2B A;  3P5W A;  3PNR A;  3KW9 A;  4YYV A;  1MHW A;  1SNK A;  1YT7 A;  5JA7 A;  2PRE A;  3RVW A;  4KLB A;  5J94 A;  1AU0 A;  1PBH A;  4QRG A;  1ATK A;  3KFQ A;  1NPZ A;  2DCD A;  4BQV A;  1ZCM A;  4CDF B;  2P7U A;  3U8E A;  1EWM A;  3M99 A;  4YYR A;  1MEM A;  1QXP A;  1GEC E;  1CJL A;  1THE A;  4WA6 A;  3N4C A;  3B79 A;  1ZIV A;  3KKU A;  1CSB B;  2YJ2 A;  2P86 A;  2XU1 A;  2AVW A;  2G7Y A;  3GCB A;  2DC6 A;  1BGO A;  3LXS A;  3O1G A;  3RVV A;  2PBH A;  1MS6 A;  1TU6 A;  2H7J A;  3OF9 A;  4G54 A;  3O0U A;  9PAP A;  3MTN A;  3CH2 X;  2R9F A;  5CHT A;  1M6D A;  3V6C A;  4W5C A;  1PIP A;  2NQD B;  2FYE A;  1U9X A;  1PPP A;  2NQG A;  3F75 A;  2PNS A;  2HXZ A;  4FIP A;  1GMY A;  4CZW A;  1TLO A;  3IUT A;  3BOW A;  1AYW A;  2JQG R;  4CDD B;  2DZZ A;  3BWK A;  4YYQ A;  3OF8 A;  5EGW A;  3IV2 A;  3WXF A;  7PCK A;  3MOR A;  3CH3 X;  4PI3 A;  2AUZ A;  1F2A A;  2ATO A;  3TNX A;  2B1M A;  2DZY A;  5CHV A;  1YAL A;  3H6S A;  4YVA A;  2C0Y A;  1KHP A;  3D6S A;  4Q8H A;  3K9M A;  3N3K A;  3LFY A;  1F2C A;  2VHS A;  3ZUA A;  4DMX A;  1PAD A;  4XR7 A;  3K8U A;  3P5X A;  1U9Q X;  4QBB A;  2ACT A;  3E1Z B;  4XUI A;  3HHA A;  3DF0 A;  5FPW A;  2BDL A;  5CVN B;  1PXV A;  2AU1 A;  4AXM A;  2E00 A;  3KWB X;  1EWL A;  2DJG B;  1QMY A;  1STF E;  2HH5 A;  1Y4H A;  3CBJ A;  3K24 A;  1O0E A;  1KFU L;  3I06 A;  4X6J A;  4HWY A;  4I07 A;  3N3G A;  2DC7 A;  1DF0 A;  4DMY A;  1NB5 A;  1BQI A;  2YJB A;  3BPF A;  2FUD A;  5CVO B;  2FT2 A;  2IPP B;  1EWP A;  4MZS A;  2P0R A;  3H8C A;  4PP1 A;  5K16 A;  1ME3 A;  8PCH A;  3H8B A;  4PAD A;  4BSQ A;  3NHE A;  3QSD A;  3H7D A;  2AYO A;  1BY8 A;  2DJF B;  3MHS A;  2FTD A;  4FK5 A;  3KX1 A;  4CDC B;  2FO5 A;  2NQA A;  3KSE A;  4X6I A;  4FJC A;  2JQF R;  1VSN A;  3OVX A;  1X9Y A;  2HD5 A;  1ITO A;  4N79 A;  4YYU A;  1KXR A;  3BCN A;  1CPJ A;  4PP2 E;  2AIM A;  4P6G A;  2DCC A;  4X6H A;  1AYU A;  1NLJ A;  1AIM A;  2VHF A;  1CVZ A;  1MIR A;  2G8E A;  2OUL A;  4QRV A;  1BP4 A;  1CV8 A;  1CTE A;  1PE6 A;  1QOL A;  1XKG A;  1YVB A;  2Y6E A;  3P5V A;  2G8J A;  2GHU A;  1KFX L;  1CQD A;  2Y5B A;  3F5V A;  4OEL A;  3HHI A;  3I3T A;  2XU5 A;  2O6X A;  3QT4 A;  3C9E A;  1MDW A;  2F1G A;  3IHP A;  1PPN A;  1KHQ A;  2CB5 A;  1AU3 A;  2GFO A;  2R9M A;  4Q8G A;  4YYW A;  2WBF X;  2E01 A;  3OIS A;  4K7C A;  1A6R A;  1SP4 B;  2BDZ A;  4BS6 A;  1AU4 A;  4W5B A;  1S4V A;  3ERV A;  3S3Q A;  2FRA A;  3KWZ A;  3USV A;  2AUX A;  4MZO A;  5F02 A;  4QH6 A;  3AI8 A;  1U9V A;  1TL9 A;  1VJV A;  2R9O A;  1POP A;  2DCB A; 
#chains in the Genus database with same CATH topology
 5EZS A;  1FH0 A;  1AEC A;  1AU2 A;  1EWO A;  3BPM A;  2AS8 A;  3V6E A;  1NL6 A;  1IWD A;  3HWN A;  1PPO A;  4P6E A;  3H89 A;  2OZ2 A;  2YJ9 A;  3B21 A;  3PDF A;  1Q6K A;  3QJ3 A;  5EZQ A;  5KO3 A;  4ZTB A;  6PAD A;  2FRQ A;  2G6D A;  2YJ8 A;  1GCB A;  1AYV A;  2PAD A;  4N8W A;  2OP3 A;  3RVX A;  2BU3 A;  3IMA A;  1GLO A;  5A24 A;  3S3R A;  3P5U A;  1ICF A;  2AYN A;  2YJC A;  3MP2 A;  3PBH A;  4I04 A;  4MSX A;  2R9N A;  2XU4 A;  2ARY A;  2B1N A;  1DEU A;  2DC8 A;  3RNV A;  4RY2 A;  2DC9 A;  4AXL A;  2IBI A;  5EF4 A;  1U9W A;  3WXE A;  2R6N A;  4N4Z A;  3IEJ A;  4A5U A;  1YK7 A;  1JQP A;  4BOZ A;  1NB3 A;  1ME4 A;  4CDE B;  4BPV A;  4ZUX U;  3BC3 A;  4I05 A;  4W4U A;  1K3B B;  1Y08 A;  2DCA A;  2HHN A;  2F7D A;  5CVM A;  1MEG A;  1YK8 A;  4REZ A;  5E6J A;  3CBK A;  4IP3 A;  1F29 A;  3MHH A;  4OEM A;  1NQC A;  5PAD A;  5JH3 A;  3PT2 A;  1QDQ A;  2E02 A;  4MI7 A;  4YV8 A;  2E03 A;  2XU3 A;  1U5I A;  1EF7 A;  2CIO A;  2FQ9 A;  1CB5 A;  4BS5 A;  3WXG A;  3OVZ A;  4RKX A;  4YYS A;  2R9C A;  4D8B A;  1HUC B;  3IOQ A;  3PW3 A;  1PCI A;  1PPD A;  3HD3 A;  4QRX A;  2NQI A;  1CS8 A;  1F2B A;  4RNA A;  3P5W A;  3PNR A;  3KW9 A;  4YYV A;  1MHW A;  1SNK A;  1YT7 A;  5JA7 A;  2PRE A;  4BOQ A;  2BTW B;  3RVW A;  4KLB A;  5J94 A;  1AU0 A;  2J7Q A;  1PBH A;  4QRG A;  1ATK A;  3KFQ A;  1NPZ A;  2DCD A;  4BQV A;  1ZCM A;  4CDF B;  2P7U A;  4OVZ B;  3U8E A;  1EWM A;  3M99 A;  4YYR A;  1MEM A;  1QXP A;  1GEC E;  1CJL A;  1THE A;  4WA6 A;  3N4C A;  3B79 A;  1ZIV A;  3KKU A;  1CSB B;  2YJ2 A;  2P86 A;  2XU1 A;  2AVW A;  2G7Y A;  3GCB A;  2DC6 A;  2UZJ A;  1BGO A;  3LXS A;  3O1G A;  2PBH A;  1MS6 A;  3RVV A;  1TU6 A;  2H7J A;  3OF9 A;  4G54 A;  3O0U A;  9PAP A;  3MTN A;  3CH2 X;  2R9F A;  5CHT A;  1M6D A;  3V6C A;  4RF0 A;  4W5C A;  1PIP A;  2NQD B;  2FYE A;  1U9X A;  4OW0 A;  1PPP A;  2NQG A;  3F75 A;  2PNS A;  2DOS A;  2HXZ A;  4FIP A;  1GMY A;  3TMP A;  4CZW A;  1TLO A;  4MM3 B;  3IUT A;  4M0W A;  2JTC A;  3BOW A;  1AYW A;  2JQG R;  4CDD B;  2DZZ A;  3MJ5 A;  3IFU A;  3BWK A;  4YYQ A;  1YZB A;  3OF8 A;  5EGW A;  3IV2 A;  3WXF A;  7PCK A;  4HXD B;  3MOR A;  3CH3 X;  4BOU A;  3BBA A;  4PI3 A;  2AUZ A;  3W30 A;  1F2A A;  2ATO A;  3TNX A;  2HWK A;  1UKF A;  2B1M A;  2DZY A;  5CHV A;  1YAL A;  4D8E A;  3H6S A;  4YVA A;  2AGA A;  2C0Y A;  1KHP A;  3D6S A;  4Q8H A;  3K9M A;  3N3K A;  3LFY A;  1F2C A;  2VHS A;  3C0R A;  3BY4 A;  4PT5 A;  4P16 A;  3ZUA A;  4DMX A;  1PAD A;  4XR7 A;  3K8U A;  3P5X A;  1U9Q X;  4OVZ A;  3PSE A;  4QBB A;  3MTV A;  2ACT A;  3E1Z B;  4XUI A;  3HHA A;  3DF0 A;  5FPW A;  2BDL A;  5CVN B;  1PXV A;  2AU1 A;  4AXM A;  2E00 A;  3KWB X;  4WUR A;  1EWL A;  2DJG B;  3PHW A;  1QMY A;  1STF E;  2HH5 A;  1Y4H A;  3CBJ A;  3K24 A;  4GUA A;  1O0E A;  1KFU L;  1PVJ A;  3I06 A;  4X6J A;  4HWY A;  2J7Q C;  4I07 A;  2FE8 A;  3N3G A;  2DC7 A;  1DF0 A;  4DMY A;  1NB5 A;  1BQI A;  2YJB A;  3BPF A;  2FUD A;  5CVO B;  2FT2 A;  2IPP B;  1EWP A;  4MZS A;  2P0R A;  3H8C A;  4PP1 A;  5K16 A;  1ME3 A;  3O65 A;  4XZX A;  8PCH A;  3H8B A;  4PAD A;  4BSQ A;  3NHE A;  3QSD A;  3H7D A;  2AYO A;  1BY8 A;  3W31 A;  2DJF B;  3MHS A;  2FTD A;  4FK5 A;  3PRM A;  3KX1 A;  4CDC B;  4D8I A;  2FO5 A;  2NQA A;  3KSE A;  4X6I A;  2JRI A;  4FJC A;  2JQF R;  3TRK A;  1VSN A;  3OVX A;  1X9Y A;  2HD5 A;  4IUM A;  1ITO A;  4N79 A;  4YYU A;  1KXR A;  3BCN A;  1CPJ A;  4PP2 E;  2AIM A;  4P6G A;  2DCC A;  4X6H A;  1AYU A;  1NLJ A;  1AIM A;  2VHF A;  1CVZ A;  1MIR A;  2G8E A;  2OUL A;  4QRV A;  1BP4 A;  1CV8 A;  1CTE A;  1PE6 A;  1QOL A;  1XKG A;  1YVB A;  2Y6E A;  3P5V A;  2G8J A;  2GHU A;  1KFX L;  1CQD A;  3PHU A;  2Y5B A;  3F5V A;  4OEL A;  3BB7 A;  1DKI A;  3HHI A;  4BOS A;  3I3T A;  2XU5 A;  2O6X A;  3QT4 A;  4RF1 A;  4BOP A;  3C9E A;  1MDW A;  2F1G A;  3IHP A;  3E9S A;  1PPN A;  1KHQ A;  2CB5 A;  1AU3 A;  2GFO A;  2R9M A;  4Q8G A;  4YYW A;  2BTW A;  2WBF X;  2E01 A;  4R3D A;  5JZE A;  3PRP A;  3OIS A;  4K7C A;  1A6R A;  1SP4 B;  2BDZ A;  4BS6 A;  1AU4 A;  4W5B A;  1S4V A;  3ERV A;  3S3Q A;  2FRA A;  3ZNH A;  3KWZ A;  3USV A;  2AUX A;  4MZO A;  5F02 A;  3OQC A;  4QH6 A;  3AI8 A;  1U9V A;  1TL9 A;  1VJV A;  3PHX A;  2Z84 A;  2R9O A;  1POP A;  2DCB A; 
#chains in the Genus database with same CATH homology
 1GX3 A;  1FH0 A;  1AEC A;  1W4T A;  1AU2 A;  1EWO A;  3BPM A;  2AS8 A;  3V6E A;  1NL6 A;  1IWD A;  3HWN A;  1PPO A;  4P6E A;  3H89 A;  2OZ2 A;  2YJ9 A;  3PDF A;  1Q6K A;  2VFB A;  3QJ3 A;  6PAD A;  2FRQ A;  2G6D A;  2YJ8 A;  1GCB A;  1AYV A;  2PAD A;  4C5P A;  4N8W A;  2OP3 A;  3RVX A;  3IMA A;  1GLO A;  5A24 A;  3S3R A;  3P5U A;  4GUZ A;  1ICF A;  2AYN A;  2YJC A;  3PBH A;  4I04 A;  4MSX A;  2R9N A;  2XU4 A;  4NV7 A;  2ARY A;  2B1N A;  4BGF A;  1DEU A;  2DC8 A;  4RY2 A;  1W6F A;  2DC9 A;  4AXL A;  2IBI A;  5EF4 A;  1U9W A;  3WXE A;  2R6N A;  4N4Z A;  3IEJ A;  1YK7 A;  1JQP A;  1NB3 A;  1ME4 A;  4CDE B;  4BPV A;  4ZUX U;  3BC3 A;  4I05 A;  4W4U A;  1K3B B;  1Y08 A;  2DCA A;  2HHN A;  2F7D A;  5CVM A;  1MEG A;  1YK8 A;  3CBK A;  1F29 A;  3MHH A;  4OEM A;  1NQC A;  5PAD A;  5JH3 A;  1QDQ A;  2E02 A;  4YV8 A;  2E03 A;  2XU3 A;  1U5I A;  1EF7 A;  2CIO A;  2FQ9 A;  1CB5 A;  4BS5 A;  3WXG A;  3OVZ A;  4YYS A;  2R9C A;  1HUC B;  3IOQ A;  3PW3 A;  1PCI A;  1PPD A;  3HD3 A;  4QRX A;  2NQI A;  1CS8 A;  1F2B A;  3P5W A;  3PNR A;  3KW9 A;  4YYV A;  1MHW A;  1SNK A;  1YT7 A;  5JA7 A;  2PRE A;  3RVW A;  4KLB A;  5J94 A;  1AU0 A;  1PBH A;  4QRG A;  1ATK A;  3KFQ A;  1NPZ A;  2DCD A;  4BQV A;  1ZCM A;  4CDF B;  2P7U A;  3U8E A;  1EWM A;  3M99 A;  4YYR A;  1MEM A;  1QXP A;  1GEC E;  1CJL A;  1THE A;  4WA6 A;  3N4C A;  3B79 A;  1ZIV A;  3KKU A;  1CSB B;  2YJ2 A;  2P86 A;  2XU1 A;  2AVW A;  2G7Y A;  3GCB A;  2DC6 A;  1BGO A;  3LXS A;  3O1G A;  2PBH A;  1MS6 A;  3RVV A;  1TU6 A;  2H7J A;  3OF9 A;  1E2T A;  4G54 A;  3O0U A;  9PAP A;  3MTN A;  3CH2 X;  2R9F A;  5CHT A;  1M6D A;  3V6C A;  4W5C A;  1PIP A;  2NQD B;  2FYE A;  1U9X A;  1PPP A;  2NQG A;  3F75 A;  2PNS A;  2HXZ A;  4FIP A;  1GMY A;  4CZW A;  1TLO A;  3IUT A;  3BOW A;  1AYW A;  2JQG R;  4CDD B;  2DZZ A;  3BWK A;  4YYQ A;  3OF8 A;  5EGW A;  3IV2 A;  3WXF A;  7PCK A;  3MOR A;  3CH3 X;  4PI3 A;  2AUZ A;  1F2A A;  2ATO A;  3TNX A;  2B1M A;  2DZY A;  3LTW A;  3D9W A;  5CHV A;  1YAL A;  2VFC A;  3H6S A;  4YVA A;  2C0Y A;  2BSZ A;  1KHP A;  3D6S A;  4Q8H A;  3K9M A;  3N3K A;  3LFY A;  1F2C A;  2VHS A;  3ZUA A;  4DMX A;  1PAD A;  4XR7 A;  3K8U A;  3P5X A;  1U9Q X;  4QBB A;  2ACT A;  3E1Z B;  4XUI A;  3HHA A;  3DF0 A;  5FPW A;  2BDL A;  5CVN B;  1PXV A;  2AU1 A;  4AXM A;  2E00 A;  3KWB X;  1EWL A;  2DJG B;  1QMY A;  1STF E;  2HH5 A;  1Y4H A;  3CBJ A;  3K24 A;  1O0E A;  1KFU L;  3I06 A;  4X6J A;  4HWY A;  4I07 A;  3N3G A;  2DC7 A;  1DF0 A;  4DMY A;  4B55 A;  1NB5 A;  1BQI A;  2YJB A;  3BPF A;  2FUD A;  5CVO B;  2FT2 A;  2IPP B;  1EWP A;  4MZS A;  2P0R A;  3H8C A;  4PP1 A;  5K16 A;  1ME3 A;  8PCH A;  3H8B A;  4PAD A;  4BSQ A;  3NHE A;  3QSD A;  3H7D A;  2AYO A;  1BY8 A;  2DJF B;  3MHS A;  2FTD A;  4FK5 A;  3KX1 A;  4CDC B;  2FO5 A;  2NQA A;  3KSE A;  4X6I A;  4FJC A;  2JQF R;  1VSN A;  3OVX A;  1X9Y A;  2HD5 A;  1ITO A;  4N79 A;  4YYU A;  1KXR A;  3BCN A;  1CPJ A;  4PP2 E;  2AIM A;  4P6G A;  2DCC A;  4X6H A;  1AYU A;  1NLJ A;  1AIM A;  2VHF A;  1CVZ A;  1MIR A;  2G8E A;  2OUL A;  4QRV A;  1BP4 A;  1CV8 A;  1CTE A;  1PE6 A;  1QOL A;  1XKG A;  1YVB A;  2Y6E A;  3P5V A;  2G8J A;  2GHU A;  1KFX L;  1CQD A;  2Y5B A;  3F5V A;  4OEL A;  3HHI A;  3I3T A;  2XU5 A;  2O6X A;  3QT4 A;  3C9E A;  1MDW A;  2F1G A;  3IHP A;  1PPN A;  1KHQ A;  2CB5 A;  1AU3 A;  4NV8 A;  2GFO A;  1W5R A;  2R9M A;  4Q8G A;  4YYW A;  2WBF X;  2E01 A;  3OIS A;  4K7C A;  1A6R A;  1SP4 B;  2BDZ A;  4BS6 A;  1AU4 A;  4W5B A;  1S4V A;  3ERV A;  3S3Q A;  2FRA A;  3KWZ A;  3USV A;  2AUX A;  4MZO A;  5F02 A;  4QH6 A;  3AI8 A;  1U9V A;  1TL9 A;  1VJV A;  2R9O A;  1POP A;  2DCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...