4HXDB

Diversity of ubiquitin and isg15 specificity amongst nairoviruses viral ovarian tumor domain proteases
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
DFLDSLIWERVVDEQYITNPTFCVSDYFEVIRQPGDGNCFYHSIAELFFDVKTPSSFRKVKEHLQLAAEVYYDTEPEAVGTGISKDEYIKVAMKDNEWGGSLEASMLSKHLQTTIILWVVNSTEQVTAAIKFGPGRVSTALNLMHVGRTHFDALRII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyubiquitin-C
publication title Diversity of Ubiquitin and ISG15 Specificity among Nairoviruses' Viral Ovarian Tumor Domain Proteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
total genus 43
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4hxdB00
3PT2A 3BY4A 4BOSA 3PHUA 4HXDB 3ZNHA 3C0RA 3PHWA 4BOZA 3TMPA 3PHXA 4BOUA 5JZEA 3PSEA 3PRPA 4BOPA 3PRMA 4BOQA
chains in the Genus database with same CATH superfamily
3IV2A 2AUZA 1PE6A 2AIMA 2AGAA 2DCAA 1U9XA 1BQIA 1NB5A 4D8IA 3ERVA 1TU6A 4PT5A 3OF9A 1ME4A 1ME3A 1PBHA 2DC9A 3H8BA 1YVBA 2BTWB 4FIPA 3IFUA 2VHSA 1S4VA 3ZNHA 3OQCA 2WBFX 2B1NA 1KXRA 3B21A 1PPDA 4P6GA 5PADA 1MHWA 3HHAA 3P5UA 2PADA 4N79A 4IUMA 3BCNA 1GCBA 1KHQA 4K7CA 1CVZA 2DCBA 1GLOA 2R6NA 1SP4B 4XUIA 3PDFA 4MZSA 1A6RA 2DZZA 5K16A 2AS8A 4OVZA 4XR7A 3PHUA 1Y4HA 4BOUA 2JRIA 1BY8A 7PCKA 1MS6A 1CQDA 1K3BB 2AU1A 4BSQA 4MSXA 4W5BA 2NQDB 4CDFB 2HWKA 3O1GA 6PADA 2YJ8A 3IMAA 2YJCA 3KWBX 2VHFA 3IEJA 3U8EA 1ZIVA 2ATOA 4BS6A 2R9CA 2FYEA 1EWOA 2HH5A 1NPZA 1CS8A 1YK8A 4ZUXU 4CDEB 2DCDA 3BC3A 3H8CA 3PRMA 3WXFA 3P5VA 3PHWA 1YT7A 3KFQA 4YYSA 2HD5A 1M6DA 1CJLA 2R9OA 3MTNA 4YVAA 4RKXA 1VSNA 2C0YA 2AYNA 1NQCA 2Z84A 3W31A 5CHTA 3MHSA 2J7QC 2E02A 3E9SA 3K24A 2XU1A 1PPOA 1Q6KA 3P5WA 4D8EA 2AVWA 2BDZA 5FPWA 4RNAA 1QOLA 3CH3X 1MDWA 4N4ZA 4REZA 4BOZA 1HUCB 4AXMA 4FJCA 2NQAA 1NL6A 4PP2E 2ACTA 1AECA 9PAPA 4M0WA 1AU3A 4PADA 2CIOA 2E03A 3H89A 3N3GA 1ATKA 1PPNA 3KX1A 3PW3A 3V6EA 4A5UA 4DMXA 2FE8A 4YYQA 4YYWA 1POPA 4BPVA 4RF0A 1QDQA 5EGWA 4I05A 2FQ9A 3MORA 2G7YA 4IP3A 3HHIA 3MP2A 2Y6EA 5KO3A 3BPFA 1AU4A 2H7JA 3WXGA 1BP4A 1UKFA 5CVNB 1ZCMA 4AXLA 2IBIA 4QH6A 2GFOA 1IWDA 3S3QA 2PNSA 3RNVA 3W30A 2BU3A 2YJ9A 4W5CA 4MZOA 1AYWA 1DF0A 4X6JA 4D8BA 5EZQA 4YYVA 1EF7A 2YJ2A 4YYRA 8PCHA 1NLJA 1PVJA 3C0RA 1AIMA 1O0EA 2F1GA 4Q8GA 3OISA 1AYUA 1QMYA 4YV8A 2HXZA 1PXVA 4MM3B 2JQGR 3BPMA 1THEA 2GHUA 3O65A 4CDDB 2PBHA 3RVVA 2G6DA 2BTWA 1MEMA 1PADA 1CTEA 3KW9A 4OELA 2FO5A 5JA7A 1CSBB 1U5IA 4RY2A 3AI8A 1PPPA 3PHXA 4WA6A 1F2BA 4PI3A 3BY4A 1KFXL 2BDLA 4DMYA 3C9EA 3CBJA 3H7DA 3P5XA 2P86A 3BOWA 4P16A 2ARYA 2R9NA 3LFYA 5CVMA 2B1MA 3I3TA 1CB5A 3I06A 1ITOA 5EF4A 4XZXA 3M99A 2DC8A 2R9MA 1SNKA 1YALA 4PP1A 5JZEA 3GCBA 4HXDB 2IPPB 1F29A 3PSEA 4OVZB 3F5VA 2DCCA 4N8WA 4R3DA 2DOSA 3TRKA 2Y5BA 3PT2A 3OVZA 1NB3A 1TL9A 2FUDA 1EWPA 2XU3A 1PIPA 4QRXA 2JTCA 3TMPA 1MEGA 3MJ5A 4X6HA 2AUXA 3BB7A 1TLOA 2E00A 2CB5A 2DZYA 3K9MA 4CZWA 2DJFB 1YK7A 4QRVA 2NQIA 3PRPA 2P7UA 3CH2X 4BOPA 2G8EA 1KFUL 2DC6A 1KHPA 3O0UA 3IUTA 3IOQA 1AYVA 3HD3A 1GMYA 3E1ZB 3IHPA 3BBAA 2AYOA 3QJ3A 3NHEA 3N4CA 4W4UA 3MTVA 3DF0A 1U9WA 1U9QX 3KSEA 3TNXA 4Q8HA 4HWYA 4BS5A 1F2CA 5A24A 3MHHA 3N3KA 4BOSA 4WURA 4X6IA 3WXEA 1QXPA 4CDCB 2YJBA 1VJVA 3LXSA 1Y08A 5E6JA 1MIRA 4OEMA 2OZ2A 1F2AA 1XKGA 3KKUA 4YYUA 4FK5A 1DKIA 3H6SA 1FH0A 4MI7A 2FRAA 3ZUAA 3RVWA 3CBKA 4BQVA 3OVXA 1ICFA 2F7DA 2HHNA 2OULA 5CVOB 3D6SA 4GUAA 2E01A 1GECE 3PNRA 4OW0A 3V6CA 3RVXA 2J7QA 1STFE 2UZJA 4I07A 3F75A 3QT4A 5J94A 4KLBA 2FT2A 3OF8A 4ZTBA 5EZSA 1EWMA 2XU5A 4I04A 5CHVA 5JH3A 2NQGA 1CV8A 2DC7A 2XU4A 1EWLA 1JQPA 3BWKA 1X9YA 1AU0A 2R9FA 1YZBA 4QRGA 3QSDA 3S3RA 2P0RA 3K8UA 1PCIA 1AU2A 2OP3A 4P6EA 1CPJA 4BOQA 2G8JA 2DJGB 3HWNA 3USVA 4G54A 2FTDA 1DEUA 3B79A 2FRQA 1U9VA 4RF1A 5F02A 3KWZA 1BGOA 3PBHA 2JQFR 2PREA 4QBBA 2O6XA
chains in the Genus database with same CATH topology
3W31A 2Z84A 4MM3B 2J7QC 3E9SA 3O65A 2AGAA 3MTVA 2BTWA 4D8IA 4PT5A 4D8EA 2BTWB 4RNAA 3IFUA 4BOSA 3ZNHA 4WURA 4REZA 3OQCA 3PHXA 4BOZA 3B21A 3BY4A 5E6JA 4P16A 4IUMA 1DKIA 4M0WA 4MI7A 4XZXA 4A5UA 2FE8A 4RF0A 3BBAA 4GUAA 5JZEA 4OW0A 4OVZA 2J7QA 3PHUA 4HXDB 4IP3A 2JRIA 3PSEA 2UZJA 3MP2A 4BOUA 4OVZB 5KO3A 4R3DA 2DOSA 3TRKA 3PT2A 4ZTBA 5EZSA 2HWKA 1UKFA 3RNVA 2JTCA 3TMPA 3W30A 2BU3A 1YZBA 3MJ5A 3BB7A 4D8BA 4BOQA 5EZQA 3PRMA 4RF1A 1PVJA 3C0RA 3PHWA 3PRPA 4BOPA 4RKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PT2 A;  3BY4 A;  4BOS A;  3PHU A;  4HXD B;  3ZNH A;  3C0R A;  3PHW A;  4BOZ A;  3TMP A;  3PHX A;  4BOU A;  5JZE A;  3PSE A;  3PRP A;  4BOP A;  3PRM A;  4BOQ A; 
#chains in the Genus database with same CATH topology
 3IV2 A;  2AUZ A;  1PE6 A;  2AIM A;  2AGA A;  2DCA A;  1U9X A;  1BQI A;  1NB5 A;  4D8I A;  3ERV A;  1TU6 A;  4PT5 A;  3OF9 A;  1ME4 A;  1ME3 A;  1PBH A;  2DC9 A;  3H8B A;  1YVB A;  2BTW B;  4FIP A;  3IFU A;  2VHS A;  1S4V A;  3ZNH A;  3OQC A;  2WBF X;  2B1N A;  1KXR A;  3B21 A;  1PPD A;  4P6G A;  5PAD A;  1MHW A;  3HHA A;  3P5U A;  2PAD A;  4N79 A;  4IUM A;  3BCN A;  1GCB A;  1KHQ A;  4K7C A;  1CVZ A;  2DCB A;  1GLO A;  2R6N A;  1SP4 B;  4XUI A;  3PDF A;  4MZS A;  1A6R A;  2DZZ A;  5K16 A;  2AS8 A;  4OVZ A;  4XR7 A;  3PHU A;  1Y4H A;  4BOU A;  2JRI A;  1BY8 A;  7PCK A;  1MS6 A;  1CQD A;  1K3B B;  2AU1 A;  4BSQ A;  4MSX A;  4W5B A;  2NQD B;  4CDF B;  2HWK A;  3O1G A;  6PAD A;  2YJ8 A;  3IMA A;  2YJC A;  3KWB X;  2VHF A;  3IEJ A;  3U8E A;  1ZIV A;  2ATO A;  4BS6 A;  2R9C A;  2FYE A;  1EWO A;  2HH5 A;  1NPZ A;  1CS8 A;  1YK8 A;  4ZUX U;  4CDE B;  2DCD A;  3BC3 A;  3H8C A;  3PRM A;  3WXF A;  3P5V A;  3PHW A;  1YT7 A;  3KFQ A;  4YYS A;  2HD5 A;  1M6D A;  1CJL A;  2R9O A;  3MTN A;  4YVA A;  4RKX A;  1VSN A;  2C0Y A;  2AYN A;  1NQC A;  2Z84 A;  3W31 A;  5CHT A;  3MHS A;  2J7Q C;  2E02 A;  3E9S A;  3K24 A;  2XU1 A;  1PPO A;  1Q6K A;  3P5W A;  4D8E A;  2AVW A;  2BDZ A;  5FPW A;  4RNA A;  1QOL A;  3CH3 X;  1MDW A;  4N4Z A;  4REZ A;  4BOZ A;  1HUC B;  4AXM A;  4FJC A;  2NQA A;  1NL6 A;  4PP2 E;  2ACT A;  1AEC A;  9PAP A;  4M0W A;  1AU3 A;  4PAD A;  2CIO A;  2E03 A;  3H89 A;  3N3G A;  1ATK A;  1PPN A;  3KX1 A;  3PW3 A;  3V6E A;  4A5U A;  4DMX A;  2FE8 A;  4YYQ A;  4YYW A;  1POP A;  4BPV A;  4RF0 A;  1QDQ A;  5EGW A;  4I05 A;  2FQ9 A;  3MOR A;  2G7Y A;  4IP3 A;  3HHI A;  3MP2 A;  2Y6E A;  5KO3 A;  3BPF A;  1AU4 A;  2H7J A;  3WXG A;  1BP4 A;  1UKF A;  5CVN B;  1ZCM A;  4AXL A;  2IBI A;  4QH6 A;  2GFO A;  1IWD A;  3S3Q A;  2PNS A;  3RNV A;  3W30 A;  2BU3 A;  2YJ9 A;  4W5C A;  4MZO A;  1AYW A;  1DF0 A;  4X6J A;  4D8B A;  5EZQ A;  4YYV A;  1EF7 A;  2YJ2 A;  4YYR A;  8PCH A;  1NLJ A;  1PVJ A;  3C0R A;  1AIM A;  1O0E A;  2F1G A;  4Q8G A;  3OIS A;  1AYU A;  1QMY A;  4YV8 A;  2HXZ A;  1PXV A;  4MM3 B;  2JQG R;  3BPM A;  1THE A;  2GHU A;  3O65 A;  4CDD B;  2PBH A;  3RVV A;  2G6D A;  2BTW A;  1MEM A;  1PAD A;  1CTE A;  3KW9 A;  4OEL A;  2FO5 A;  5JA7 A;  1CSB B;  1U5I A;  4RY2 A;  3AI8 A;  1PPP A;  3PHX A;  4WA6 A;  1F2B A;  4PI3 A;  3BY4 A;  1KFX L;  2BDL A;  4DMY A;  3C9E A;  3CBJ A;  3H7D A;  3P5X A;  2P86 A;  3BOW A;  4P16 A;  2ARY A;  2R9N A;  3LFY A;  5CVM A;  2B1M A;  3I3T A;  1CB5 A;  3I06 A;  1ITO A;  5EF4 A;  4XZX A;  3M99 A;  2DC8 A;  2R9M A;  1SNK A;  1YAL A;  4PP1 A;  5JZE A;  3GCB A;  4HXD B;  2IPP B;  1F29 A;  3PSE A;  4OVZ B;  3F5V A;  2DCC A;  4N8W A;  4R3D A;  2DOS A;  3TRK A;  2Y5B A;  3PT2 A;  3OVZ A;  1NB3 A;  1TL9 A;  2FUD A;  1EWP A;  2XU3 A;  1PIP A;  4QRX A;  2JTC A;  3TMP A;  1MEG A;  3MJ5 A;  4X6H A;  2AUX A;  3BB7 A;  1TLO A;  2E00 A;  2CB5 A;  2DZY A;  3K9M A;  4CZW A;  2DJF B;  1YK7 A;  4QRV A;  2NQI A;  3PRP A;  2P7U A;  3CH2 X;  4BOP A;  2G8E A;  1KFU L;  2DC6 A;  1KHP A;  3O0U A;  3IUT A;  3IOQ A;  1AYV A;  3HD3 A;  1GMY A;  3E1Z B;  3IHP A;  3BBA A;  2AYO A;  3QJ3 A;  3NHE A;  3N4C A;  4W4U A;  3MTV A;  3DF0 A;  1U9W A;  1U9Q X;  3KSE A;  3TNX A;  4Q8H A;  4HWY A;  4BS5 A;  1F2C A;  5A24 A;  3MHH A;  3N3K A;  4BOS A;  4WUR A;  4X6I A;  3WXE A;  1QXP A;  4CDC B;  2YJB A;  1VJV A;  3LXS A;  1Y08 A;  5E6J A;  1MIR A;  4OEM A;  2OZ2 A;  1F2A A;  1XKG A;  3KKU A;  4YYU A;  4FK5 A;  1DKI A;  3H6S A;  1FH0 A;  4MI7 A;  2FRA A;  3ZUA A;  3RVW A;  3CBK A;  4BQV A;  3OVX A;  1ICF A;  2F7D A;  2HHN A;  2OUL A;  5CVO B;  3D6S A;  4GUA A;  2E01 A;  1GEC E;  3PNR A;  4OW0 A;  3V6C A;  3RVX A;  2J7Q A;  1STF E;  2UZJ A;  4I07 A;  3F75 A;  3QT4 A;  5J94 A;  4KLB A;  2FT2 A;  3OF8 A;  4ZTB A;  5EZS A;  1EWM A;  2XU5 A;  4I04 A;  5CHV A;  5JH3 A;  2NQG A;  1CV8 A;  2DC7 A;  2XU4 A;  1EWL A;  1JQP A;  3BWK A;  1X9Y A;  1AU0 A;  2R9F A;  1YZB A;  4QRG A;  3QSD A;  3S3R A;  2P0R A;  3K8U A;  1PCI A;  1AU2 A;  2OP3 A;  4P6E A;  1CPJ A;  4BOQ A;  2G8J A;  2DJG B;  3HWN A;  3USV A;  4G54 A;  2FTD A;  1DEU A;  3B79 A;  2FRQ A;  1U9V A;  4RF1 A;  5F02 A;  3KWZ A;  1BGO A;  3PBH A;  2JQF R;  2PRE A;  4QBB A;  2O6X A; 
#chains in the Genus database with same CATH homology
 3W31 A;  2Z84 A;  4MM3 B;  2J7Q C;  3E9S A;  3O65 A;  2AGA A;  3MTV A;  2BTW A;  4D8I A;  4PT5 A;  4D8E A;  2BTW B;  4RNA A;  3IFU A;  4BOS A;  3ZNH A;  4WUR A;  4REZ A;  3OQC A;  3PHX A;  4BOZ A;  3B21 A;  3BY4 A;  5E6J A;  4P16 A;  4IUM A;  1DKI A;  4M0W A;  4MI7 A;  4XZX A;  4A5U A;  2FE8 A;  4RF0 A;  3BBA A;  4GUA A;  5JZE A;  4OW0 A;  4OVZ A;  2J7Q A;  3PHU A;  4HXD B;  4IP3 A;  2JRI A;  3PSE A;  2UZJ A;  3MP2 A;  4BOU A;  4OVZ B;  5KO3 A;  4R3D A;  2DOS A;  3TRK A;  3PT2 A;  4ZTB A;  5EZS A;  2HWK A;  1UKF A;  3RNV A;  2JTC A;  3TMP A;  3W30 A;  2BU3 A;  1YZB A;  3MJ5 A;  3BB7 A;  4D8B A;  4BOQ A;  5EZQ A;  3PRM A;  4RF1 A;  1PVJ A;  3C0R A;  3PHW A;  3PRP A;  4BOP A;  4RKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...