4HXDB

Diversity of ubiquitin and isg15 specificity amongst nairoviruses viral ovarian tumor domain proteases
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
DFLDSLIWERVVDEQYITNPTFCVSDYFEVIRQPGDGNCFYHSIAELFFDVKTPSSFRKVKEHLQLAAEVYYDTEPEAVGTGISKDEYIKVAMKDNEWGGSLEASMLSKHLQTTIILWVVNSTEQVTAAIKFGPGRVSTALNLMHVGRTHFDALRII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of Ubiquitin and ISG15 Specificity among Nairoviruses' Viral Ovarian Tumor Domain Proteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
molecule keywords Polyubiquitin-C
total genus 43
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4hxdB00
3PHXA 3PHUA 3PRMA 3BY4A 3PSEA 3TMPA 3ZNHA 4BOPA 4BOQA 5JZEA 3PHWA 4HXDB 3PRPA 3C0RA 3PT2A 4BOZA 4BOSA 4BOUA
chains in the Genus database with same CATH superfamily
2F1GA 3WXEA 3IHPA 2IBIA 3P5XA 5CVMA 2DCAA 1M6DA 1YZBA 2BTWB 2DZYA 4YV8A 1AYWA 1YVBA 2YJ8A 1K3BB 1Q6KA 2NQDB 4Q8HA 3PRPA 4BS5A 2C0YA 1U9XA 3I06A 8PCHA 2AU1A 1PIPA 1NQCA 3H89A 5CHVA 1VSNA 2P0RA 1EWLA 4I05A 1HUCB 2FUDA 2NQGA 4REZA 3OF8A 4RNAA 5KO3A 1F29A 2R6NA 5JA7A 4BPVA 1QDQA 3I3TA 3B21A 4X6JA 1EF7A 3IUTA 1STFE 2O6XA 4AXMA 3K8UA 3KKUA 2FQ9A 4QRGA 1KFXL 2BTWA 4D8IA 3RVVA 3O65A 1ZCMA 1A6RA 1UKFA 2IPPB 4WA6A 1MHWA 1CS8A 4YYVA 3PDFA 1NPZA 2E03A 1Y4HA 4W5BA 2NQIA 2DJFB 2YJCA 3NHEA 3K9MA 1CSBB 2HWKA 2FTDA 2DC7A 2G7YA 1CV8A 1YK8A 1CVZA 3W30A 4OVZB 3HD3A 1ME4A 1AECA 3QJ3A 3E9SA 4YYQA 3O1GA 4KLBA 1AYUA 3CBJA 4FIPA 4RY2A 2XU4A 3H8CA 2DC6A 1AIMA 4RKXA 1EWOA 4PP2E 2Y6EA 4PP1A 2GHUA 4FK5A 1KHQA 4WURA 2ARYA 4HXDB 3CH3X 2DCCA 4XR7A 2PNSA 3MJ5A 4QRVA 3PSEA 2JQFR 3M99A 3BOWA 2NQAA 2R9MA 2YJBA 3ZUAA 5PADA 2BDZA 4P6EA 2Z84A 4YVAA 1CQDA 4QH6A 2AYNA 1DEUA 2FYEA 4D8EA 1BGOA 3DF0A 3USVA 4OELA 1BQIA 4OW0A 3GCBA 4BOUA 3H6SA 1GCBA 1TLOA 2YJ2A 4XZXA 3N4CA 1VJVA 5J94A 1BP4A 2YJ9A 1KXRA 1GECE 3HWNA 3MP2A 3QSDA 5JZEA 2VHFA 1PPDA 2R9OA 1QMYA 2BDLA 2JRIA 3CH2X 4BQVA 1PVJA 2FE8A 4ZUXU 1DF0A 3C0RA 4BOPA 2FRQA 2GFOA 5EGWA 3PRMA 3BPFA 1PE6A 2OZ2A 3S3RA 4PT5A 1QOLA 2JQGR 1CTEA 3WXFA 1THEA 2AYOA 1QXPA 1S4VA 4IUMA 1GMYA 2G8JA 2FRAA 3BY4A 1XKGA 1EWMA 4ZTBA 3ZNHA 3U8EA 3TRKA 4A5UA 4AXLA 4OEMA 2PADA 1YT7A 4QRXA 1ITOA 1TU6A 1PADA 3V6CA 1X9YA 2G6DA 3BWKA 3D6SA 1AU2A 2CIOA 4FJCA 2DC8A 2FT2A 7PCKA 2AUZA 4D8BA 4MZOA 5EZQA 1MDWA 5CVNB 3MHSA 3RNVA 3KWZA 2HHNA 2UZJA 1PPNA 2E00A 4QBBA 4BSQA 3F75A 4YYRA 3K24A 4HWYA 1ATKA 2CB5A 3OVXA 4W5CA 1MS6A 3QT4A 4MM3B 1JQPA 5CVOB 4K7CA 1F2AA 3MHHA 1U9VA 2H7JA 3P5VA 2B1MA 2DC9A 2DJGB 3W31A 1FH0A 2ACTA 4YYUA 1EWPA 1SNKA 2BU3A 1KFUL 2HD5A 2R9FA 5CHTA 3WXGA 4P16A 3KWBX 3KW9A 4P6GA 6PADA 3OISA 1POPA 2AUXA 2DCBA 1ICFA 1YALA 4GUAA 5EF4A 2B1NA 4MZSA 4IP3A 3PHWA 4N4ZA 3KFQA 3KX1A 4CDEB 4RF0A 2R9NA 1MEMA 3IOQA 3TMPA 3RVXA 3O0UA 3IV2A 5EZSA 5E6JA 1AU3A 1U5IA 4MI7A 3ERVA 3BCNA 3OVZA 2E02A 4YYWA 3LFYA 2VHSA 3MORA 1BY8A 1AYVA 3RVWA 5F02A 3IEJA 2AS8A 3HHIA 3P5UA 1PPOA 4M0WA 2DOSA 2HH5A 1IWDA 3E1ZB 4PI3A 1CB5A 3N3KA 1NB5A 1U9WA 3IMAA 4MSXA 4DMYA 1Y08A 1MEGA 4PADA 4BOSA 1AU4A 1TL9A 1DKIA 4R3DA 1CJLA 3H8BA 3BPMA 2E01A 3PBHA 2XU1A 1PPPA 4XUIA 4Q8GA 4W4UA 3PHUA 2DCDA 4BOZA 2R9CA 4G54A 2J7QA 3PT2A 2G8EA 4BOQA 1KHPA 3F5VA 2XU3A 1PBHA 4I07A 4X6HA 4CDDB 1NL6A 5K16A 3OQCA 3BBAA 1CPJA 5JH3A 2DZZA 3P5WA 5A24A 3IFUA 2PBHA 3PW3A 3BB7A 4CZWA 2Y5BA 2FO5A 2JTCA 2HXZA 3TNXA 4CDCB 1F2CA 1SP4B 4I04A 3CBKA 3B79A 3AI8A 3HHAA 1ME3A 1NLJA 1ZIVA 9PAPA 2OULA 3C9EA 3MTNA 2AGAA 1F2BA 2AIMA 2P7UA 2ATOA 2J7QC 2F7DA 2PREA 2XU5A 3OF9A 3V6EA 3S3QA 2P86A 2OP3A 1PXVA 1PCIA 5FPWA 4DMXA 4N8WA 1O0EA 2AVWA 1AU0A 3MTVA 3N3GA 4OVZA 1YK7A 4CDFB 3PNRA 1NB3A 3PHXA 3KSEA 3H7DA 4YYSA 1U9QX 3LXSA 4N79A 1GLOA 1MIRA 3BC3A 2WBFX 4BS6A 4X6IA 4RF1A
chains in the Genus database with same CATH topology
4XZXA 2Z84A 1DKIA 4IP3A 4R3DA 4BOQA 4D8BA 5EZQA 3PHWA 3PRPA 3W31A 3MTVA 4OVZA 3RNVA 3MP2A 4IUMA 4RF0A 3BY4A 3OQCA 4D8EA 1YZBA 4ZTBA 3BBAA 3TMPA 3ZNHA 5JZEA 4RKXA 2AGAA 2HWKA 2BTWB 2UZJA 3TRKA 5EZSA 3PHXA 4M0WA 5E6JA 2JRIA 3PHUA 4A5UA 2BU3A 3IFUA 2DOSA 4OW0A 1PVJA 2FE8A 4P16A 2BTWA 2J7QC 3BB7A 3C0RA 4HXDB 4MI7A 4REZA 4RNAA 4BOZA 4BOPA 3MJ5A 3O65A 4BOUA 4D8IA 5KO3A 3W30A 3PRMA 3PSEA 4WURA 4OVZB 2J7QA 1UKFA 2JTCA 4PT5A 3B21A 4GUAA 3PT2A 4MM3B 3E9SA 4BOSA 4RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHX A;  3PHU A;  3PRM A;  3BY4 A;  3PSE A;  3TMP A;  3ZNH A;  4BOP A;  4BOQ A;  5JZE A;  3PHW A;  4HXD B;  3PRP A;  3C0R A;  3PT2 A;  4BOZ A;  4BOS A;  4BOU A; 
#chains in the Genus database with same CATH topology
 2F1G A;  3WXE A;  3IHP A;  2IBI A;  3P5X A;  5CVM A;  2DCA A;  1M6D A;  1YZB A;  2BTW B;  2DZY A;  4YV8 A;  1AYW A;  1YVB A;  2YJ8 A;  1K3B B;  1Q6K A;  2NQD B;  4Q8H A;  3PRP A;  4BS5 A;  2C0Y A;  1U9X A;  3I06 A;  8PCH A;  2AU1 A;  1PIP A;  1NQC A;  3H89 A;  5CHV A;  1VSN A;  2P0R A;  1EWL A;  4I05 A;  1HUC B;  2FUD A;  2NQG A;  4REZ A;  3OF8 A;  4RNA A;  5KO3 A;  1F29 A;  2R6N A;  5JA7 A;  4BPV A;  1QDQ A;  3I3T A;  3B21 A;  4X6J A;  1EF7 A;  3IUT A;  1STF E;  2O6X A;  4AXM A;  3K8U A;  3KKU A;  2FQ9 A;  4QRG A;  1KFX L;  2BTW A;  4D8I A;  3RVV A;  3O65 A;  1ZCM A;  1A6R A;  1UKF A;  2IPP B;  4WA6 A;  1MHW A;  1CS8 A;  4YYV A;  3PDF A;  1NPZ A;  2E03 A;  1Y4H A;  4W5B A;  2NQI A;  2DJF B;  2YJC A;  3NHE A;  3K9M A;  1CSB B;  2HWK A;  2FTD A;  2DC7 A;  2G7Y A;  1CV8 A;  1YK8 A;  1CVZ A;  3W30 A;  4OVZ B;  3HD3 A;  1ME4 A;  1AEC A;  3QJ3 A;  3E9S A;  4YYQ A;  3O1G A;  4KLB A;  1AYU A;  3CBJ A;  4FIP A;  4RY2 A;  2XU4 A;  3H8C A;  2DC6 A;  1AIM A;  4RKX A;  1EWO A;  4PP2 E;  2Y6E A;  4PP1 A;  2GHU A;  4FK5 A;  1KHQ A;  4WUR A;  2ARY A;  4HXD B;  3CH3 X;  2DCC A;  4XR7 A;  2PNS A;  3MJ5 A;  4QRV A;  3PSE A;  2JQF R;  3M99 A;  3BOW A;  2NQA A;  2R9M A;  2YJB A;  3ZUA A;  5PAD A;  2BDZ A;  4P6E A;  2Z84 A;  4YVA A;  1CQD A;  4QH6 A;  2AYN A;  1DEU A;  2FYE A;  4D8E A;  1BGO A;  3DF0 A;  3USV A;  4OEL A;  1BQI A;  4OW0 A;  3GCB A;  4BOU A;  3H6S A;  1GCB A;  1TLO A;  2YJ2 A;  4XZX A;  3N4C A;  1VJV A;  5J94 A;  1BP4 A;  2YJ9 A;  1KXR A;  1GEC E;  3HWN A;  3MP2 A;  3QSD A;  5JZE A;  2VHF A;  1PPD A;  2R9O A;  1QMY A;  2BDL A;  2JRI A;  3CH2 X;  4BQV A;  1PVJ A;  2FE8 A;  4ZUX U;  1DF0 A;  3C0R A;  4BOP A;  2FRQ A;  2GFO A;  5EGW A;  3PRM A;  3BPF A;  1PE6 A;  2OZ2 A;  3S3R A;  4PT5 A;  1QOL A;  2JQG R;  1CTE A;  3WXF A;  1THE A;  2AYO A;  1QXP A;  1S4V A;  4IUM A;  1GMY A;  2G8J A;  2FRA A;  3BY4 A;  1XKG A;  1EWM A;  4ZTB A;  3ZNH A;  3U8E A;  3TRK A;  4A5U A;  4AXL A;  4OEM A;  2PAD A;  1YT7 A;  4QRX A;  1ITO A;  1TU6 A;  1PAD A;  3V6C A;  1X9Y A;  2G6D A;  3BWK A;  3D6S A;  1AU2 A;  2CIO A;  4FJC A;  2DC8 A;  2FT2 A;  7PCK A;  2AUZ A;  4D8B A;  4MZO A;  5EZQ A;  1MDW A;  5CVN B;  3MHS A;  3RNV A;  3KWZ A;  2HHN A;  2UZJ A;  1PPN A;  2E00 A;  4QBB A;  4BSQ A;  3F75 A;  4YYR A;  3K24 A;  4HWY A;  1ATK A;  2CB5 A;  3OVX A;  4W5C A;  1MS6 A;  3QT4 A;  4MM3 B;  1JQP A;  5CVO B;  4K7C A;  1F2A A;  3MHH A;  1U9V A;  2H7J A;  3P5V A;  2B1M A;  2DC9 A;  2DJG B;  3W31 A;  1FH0 A;  2ACT A;  4YYU A;  1EWP A;  1SNK A;  2BU3 A;  1KFU L;  2HD5 A;  2R9F A;  5CHT A;  3WXG A;  4P16 A;  3KWB X;  3KW9 A;  4P6G A;  6PAD A;  3OIS A;  1POP A;  2AUX A;  2DCB A;  1ICF A;  1YAL A;  4GUA A;  5EF4 A;  2B1N A;  4MZS A;  4IP3 A;  3PHW A;  4N4Z A;  3KFQ A;  3KX1 A;  4CDE B;  4RF0 A;  2R9N A;  1MEM A;  3IOQ A;  3TMP A;  3RVX A;  3O0U A;  3IV2 A;  5EZS A;  5E6J A;  1AU3 A;  1U5I A;  4MI7 A;  3ERV A;  3BCN A;  3OVZ A;  2E02 A;  4YYW A;  3LFY A;  2VHS A;  3MOR A;  1BY8 A;  1AYV A;  3RVW A;  5F02 A;  3IEJ A;  2AS8 A;  3HHI A;  3P5U A;  1PPO A;  4M0W A;  2DOS A;  2HH5 A;  1IWD A;  3E1Z B;  4PI3 A;  1CB5 A;  3N3K A;  1NB5 A;  1U9W A;  3IMA A;  4MSX A;  4DMY A;  1Y08 A;  1MEG A;  4PAD A;  4BOS A;  1AU4 A;  1TL9 A;  1DKI A;  4R3D A;  1CJL A;  3H8B A;  3BPM A;  2E01 A;  3PBH A;  2XU1 A;  1PPP A;  4XUI A;  4Q8G A;  4W4U A;  3PHU A;  2DCD A;  4BOZ A;  2R9C A;  4G54 A;  2J7Q A;  3PT2 A;  2G8E A;  4BOQ A;  1KHP A;  3F5V A;  2XU3 A;  1PBH A;  4I07 A;  4X6H A;  4CDD B;  1NL6 A;  5K16 A;  3OQC A;  3BBA A;  1CPJ A;  5JH3 A;  2DZZ A;  3P5W A;  5A24 A;  3IFU A;  2PBH A;  3PW3 A;  3BB7 A;  4CZW A;  2Y5B A;  2FO5 A;  2JTC A;  2HXZ A;  3TNX A;  4CDC B;  1F2C A;  1SP4 B;  4I04 A;  3CBK A;  3B79 A;  3AI8 A;  3HHA A;  1ME3 A;  1NLJ A;  1ZIV A;  9PAP A;  2OUL A;  3C9E A;  3MTN A;  2AGA A;  1F2B A;  2AIM A;  2P7U A;  2ATO A;  2J7Q C;  2F7D A;  2PRE A;  2XU5 A;  3OF9 A;  3V6E A;  3S3Q A;  2P86 A;  2OP3 A;  1PXV A;  1PCI A;  5FPW A;  4DMX A;  4N8W A;  1O0E A;  2AVW A;  1AU0 A;  3MTV A;  3N3G A;  4OVZ A;  1YK7 A;  4CDF B;  3PNR A;  1NB3 A;  3PHX A;  3KSE A;  3H7D A;  4YYS A;  1U9Q X;  3LXS A;  4N79 A;  1GLO A;  1MIR A;  3BC3 A;  2WBF X;  4BS6 A;  4X6I A;  4RF1 A; 
#chains in the Genus database with same CATH homology
 4XZX A;  2Z84 A;  1DKI A;  4IP3 A;  4R3D A;  4BOQ A;  4D8B A;  5EZQ A;  3PHW A;  3PRP A;  3W31 A;  3MTV A;  4OVZ A;  3RNV A;  3MP2 A;  4IUM A;  4RF0 A;  3BY4 A;  3OQC A;  4D8E A;  1YZB A;  4ZTB A;  3BBA A;  3TMP A;  3ZNH A;  5JZE A;  4RKX A;  2AGA A;  2HWK A;  2BTW B;  2UZJ A;  3TRK A;  5EZS A;  3PHX A;  4M0W A;  5E6J A;  2JRI A;  3PHU A;  4A5U A;  2BU3 A;  3IFU A;  2DOS A;  4OW0 A;  1PVJ A;  2FE8 A;  4P16 A;  2BTW A;  2J7Q C;  3BB7 A;  3C0R A;  4HXD B;  4MI7 A;  4REZ A;  4RNA A;  4BOZ A;  4BOP A;  3MJ5 A;  3O65 A;  4BOU A;  4D8I A;  5KO3 A;  3W30 A;  3PRM A;  3PSE A;  4WUR A;  4OVZ B;  2J7Q A;  1UKF A;  2JTC A;  4PT5 A;  3B21 A;  4GUA A;  3PT2 A;  4MM3 B;  3E9S A;  4BOS A;  4RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...