4HXDB

Diversity of ubiquitin and isg15 specificity amongst nairoviruses viral ovarian tumor domain proteases
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
DFLDSLIWERVVDEQYITNPTFCVSDYFEVIRQPGDGNCFYHSIAELFFDVKTPSSFRKVKEHLQLAAEVYYDTEPEAVGTGISKDEYIKVAMKDNEWGGSLEASMLSKHLQTTIILWVVNSTEQVTAAIKFGPGRVSTALNLMHVGRTHFDALRII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/viral protein
molecule keywords Polyubiquitin-C
publication title Diversity of Ubiquitin and ISG15 Specificity among Nairoviruses' Viral Ovarian Tumor Domain Proteases.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4hxdB00
3PRMA 4BOZA 4BOUA 3ZNHA 3PHXA 4BOQA 3PSEA 3PHWA 4BOSA 5JZEA 3C0RA 3PRPA 4BOPA 3TMPA 3BY4A 4HXDB 3PHUA 3PT2A
chains in the Genus database with same CATH superfamily
1KFUL 2FYEA 3D6SA 2IPPB 2R6NA 3P5XA 1UKFA 3KKUA 2PADA 3PRMA 2AUXA 3IHPA 3V6EA 4WA6A 1PVJA 2FE8A 4AXLA 2XU3A 3RVVA 4G54A 1PPOA 3S3RA 3W30A 3HHIA 1THEA 3MTNA 2G6DA 4K7CA 3QT4A 1CTEA 3K8UA 1VSNA 2AVWA 3MHSA 4DMXA 1DKIA 1PXVA 1S4VA 3P5UA 4YVAA 4XR7A 3IV2A 1M6DA 1NLJA 4XZXA 1IWDA 4PT5A 1BQIA 1XKGA 2HH5A 3IEJA 4N4ZA 3CH3X 4P16A 1AU2A 3GCBA 2JQFR 1NL6A 1YALA 3USVA 1U9QX 3CBJA 5JZEA 2E03A 3BC3A 3O1GA 1U5IA 1CVZA 4YV8A 1EWLA 1SP4B 3ZNHA 2AU1A 1ICFA 1ME3A 3I06A 9PAPA 2AYOA 4M0WA 2E02A 3V6CA 1NB3A 7PCKA 2ATOA 3WXEA 4OEMA 2Y5BA 2FO5A 2R9CA 4BOPA 1EF7A 1JQPA 2NQDB 3PHXA 1ZCMA 3OVZA 1SNKA 4FJCA 3PRPA 2NQAA 1QOLA 3QJ3A 3MHHA 3C9EA 3M99A 4BOQA 2YJBA 3B79A 2BDLA 1STFE 2CB5A 4PI3A 4BOSA 2YJ8A 5EZSA 1CB5A 1ZIVA 5E6JA 4DMYA 3LXSA 4W5BA 3C0RA 4I05A 2PREA 2E00A 5PADA 2GFOA 5FPWA 4BOUA 4YYWA 1PPNA 3KSEA 4AXMA 3HD3A 1NQCA 3BWKA 2WBFX 3BY4A 3H8BA 3MJ5A 3QSDA 1U9VA 3E9SA 1BP4A 3CBKA 1CS8A 2JQGR 1U9WA 1AU3A 4KLBA 4A5UA 3BPMA 1KXRA 1MS6A 1QXPA 4I04A 4BS6A 1PE6A 1TLOA 3U8EA 1CQDA 1ME4A 1YK7A 2DJGB 3H8CA 4N79A 3TMPA 3H7DA 5F02A 3KFQA 5K16A 4GUAA 2FQ9A 2UZJA 2PNSA 5J94A 4BOZA 1CSBB 1YK8A 4X6IA 3WXFA 2DCAA 2C0YA 2HWKA 4MZOA 4QRVA 2R9MA 3LFYA 2NQIA 1GMYA 3S3QA 3IUTA 4QBBA 2J7QC 2G8JA 4D8EA 1PADA 1NPZA 4RF1A 3ZUAA 4Q8HA 2HHNA 2JTCA 1YT7A 4CDEB 3OQCA 1ATKA 4OELA 2OULA 3K24A 2J7QA 2IBIA 2BTWB 2FT2A 4QH6A 1F2AA 4MSXA 4N8WA 3KWZA 3N3GA 1F2CA 3MTVA 2P7UA 1PCIA 4HXDB 1PPDA 3H89A 3IFUA 1KHQA 1AU0A 3O65A 1A6RA 3NHEA 4RY2A 2HD5A 4RKXA 1ITOA 4CDCB 2YJ9A 2AYNA 3RVWA 4OW0A 2DC6A 1EWMA 2DCDA 1HUCB 2E01A 3W31A 4D8IA 2HXZA 2AUZA 4CDFB 4BS5A 4W4UA 2G8EA 2DZZA 5EGWA 3PW3A 2XU5A 4PADA 4YYSA 5CVMA 1F2BA 5CVOB 3TNXA 1BGOA 2Z84A 3KWBX 3KW9A 1Y4HA 3I3TA 1DEUA 3PHUA 3ERVA 3HWNA 1F29A 4YYQA 1TL9A 3F5VA 4IUMA 2G7YA 2R9OA 2BTWA 2OP3A 4YYUA 5JH3A 4BPVA 3RNVA 2ARYA 4D8BA 1FH0A 3BOWA 5CHVA 1MIRA 2F1GA 6PADA 1QDQA 2BDZA 3MP2A 2DCBA 2FUDA 3BCNA 1TU6A 1NB5A 3OISA 4PP2E 5A24A 4YYRA 3N3KA 2NQGA 1CJLA 4HWYA 1AYUA 2OZ2A 1GCBA 5EZQA 4IP3A 4MI7A 3BB7A 2O6XA 3IMAA 2YJ2A 4BQVA 4BSQA 2B1MA 5JA7A 4CDDB 3K9MA 1AYWA 1K3BB 3PBHA 4PP1A 8PCHA 2CIOA 4P6GA 2P86A 1AYVA 4RNAA 5CHTA 2ACTA 3AI8A 2AS8A 2AIMA 1AIMA 2VHFA 4R3DA 4YYVA 2R9NA 1PPPA 1Q6KA 1PBHA 2AGAA 4ZUXU 2PBHA 3DF0A 3KX1A 1Y08A 5KO3A 1YZBA 1EWPA 5CVNB 3B21A 1BY8A 1O0EA 1CPJA 4WURA 3OF9A 1GECE 4X6HA 3PHWA 1AECA 3H6SA 3F75A 1CV8A 2F7DA 3N4CA 2JRIA 4RF0A 1VJVA 3MORA 3IOQA 2XU1A 3P5VA 3WXGA 1QMYA 3PDFA 4QRXA 4X6JA 4P6EA 3E1ZB 4OVZB 3BBAA 4FK5A 2DZYA 1MDWA 1GLOA 2VHSA 4ZTBA 2DCCA 1AU4A 4Q8GA 2B1NA 4W5CA 1MEMA 4XUIA 2Y6EA 1POPA 3PT2A 3TRKA 2FRAA 2FTDA 1MHWA 3BPFA 4QRGA 3P5WA 2GHUA 3RVXA 1YVBA 2DC7A 1KFXL 2R9FA 2FRQA 5EF4A 1MEGA 4FIPA 3OVXA 2DJFB 4MZSA 3O0UA 2BU3A 4CZWA 2DC8A 1EWOA 2H7JA 2P0RA 1U9XA 2YJCA 1DF0A 4REZA 3HHAA 3PSEA 4I07A 1X9YA 2XU4A 4MM3B 2DC9A 4OVZA 1PIPA 3OF8A 2DOSA 3CH2X 1KHPA 3PNRA
chains in the Genus database with same CATH topology
4BOQA 3IFUA 3O65A 2AGAA 4RKXA 1UKFA 4BOSA 5EZSA 5KO3A 5E6JA 1YZBA 3PRMA 4OW0A 3B21A 1PVJA 3C0RA 4WURA 2FE8A 3W31A 4BOUA 4D8IA 3PHWA 3BY4A 3W30A 3MJ5A 2JRIA 4RF0A 3E9SA 4A5UA 2Z84A 1DKIA 4OVZB 3BBAA 3PHUA 4IUMA 4XZXA 2BTWA 4PT5A 4ZTBA 3TMPA 3RNVA 3TRKA 3PT2A 4P16A 4D8BA 4GUAA 2UZJA 4BOZA 3MP2A 5JZEA 2HWKA 3ZNHA 2J7QC 4M0WA 2BU3A 5EZQA 4IP3A 4D8EA 4MI7A 3BB7A 4RF1A 4BOPA 2JTCA 4REZA 3PHXA 3PSEA 3OQCA 2J7QA 2BTWB 4MM3B 4OVZA 3PRPA 4RNAA 3MTVA 2DOSA 4R3DA 4HXDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRM A;  4BOZ A;  4BOU A;  3ZNH A;  3PHX A;  4BOQ A;  3PSE A;  3PHW A;  4BOS A;  5JZE A;  3C0R A;  3PRP A;  4BOP A;  3TMP A;  3BY4 A;  4HXD B;  3PHU A;  3PT2 A; 
#chains in the Genus database with same CATH topology
 1KFU L;  2FYE A;  3D6S A;  2IPP B;  2R6N A;  3P5X A;  1UKF A;  3KKU A;  2PAD A;  3PRM A;  2AUX A;  3IHP A;  3V6E A;  4WA6 A;  1PVJ A;  2FE8 A;  4AXL A;  2XU3 A;  3RVV A;  4G54 A;  1PPO A;  3S3R A;  3W30 A;  3HHI A;  1THE A;  3MTN A;  2G6D A;  4K7C A;  3QT4 A;  1CTE A;  3K8U A;  1VSN A;  2AVW A;  3MHS A;  4DMX A;  1DKI A;  1PXV A;  1S4V A;  3P5U A;  4YVA A;  4XR7 A;  3IV2 A;  1M6D A;  1NLJ A;  4XZX A;  1IWD A;  4PT5 A;  1BQI A;  1XKG A;  2HH5 A;  3IEJ A;  4N4Z A;  3CH3 X;  4P16 A;  1AU2 A;  3GCB A;  2JQF R;  1NL6 A;  1YAL A;  3USV A;  1U9Q X;  3CBJ A;  5JZE A;  2E03 A;  3BC3 A;  3O1G A;  1U5I A;  1CVZ A;  4YV8 A;  1EWL A;  1SP4 B;  3ZNH A;  2AU1 A;  1ICF A;  1ME3 A;  3I06 A;  9PAP A;  2AYO A;  4M0W A;  2E02 A;  3V6C A;  1NB3 A;  7PCK A;  2ATO A;  3WXE A;  4OEM A;  2Y5B A;  2FO5 A;  2R9C A;  4BOP A;  1EF7 A;  1JQP A;  2NQD B;  3PHX A;  1ZCM A;  3OVZ A;  1SNK A;  4FJC A;  3PRP A;  2NQA A;  1QOL A;  3QJ3 A;  3MHH A;  3C9E A;  3M99 A;  4BOQ A;  2YJB A;  3B79 A;  2BDL A;  1STF E;  2CB5 A;  4PI3 A;  4BOS A;  2YJ8 A;  5EZS A;  1CB5 A;  1ZIV A;  5E6J A;  4DMY A;  3LXS A;  4W5B A;  3C0R A;  4I05 A;  2PRE A;  2E00 A;  5PAD A;  2GFO A;  5FPW A;  4BOU A;  4YYW A;  1PPN A;  3KSE A;  4AXM A;  3HD3 A;  1NQC A;  3BWK A;  2WBF X;  3BY4 A;  3H8B A;  3MJ5 A;  3QSD A;  1U9V A;  3E9S A;  1BP4 A;  3CBK A;  1CS8 A;  2JQG R;  1U9W A;  1AU3 A;  4KLB A;  4A5U A;  3BPM A;  1KXR A;  1MS6 A;  1QXP A;  4I04 A;  4BS6 A;  1PE6 A;  1TLO A;  3U8E A;  1CQD A;  1ME4 A;  1YK7 A;  2DJG B;  3H8C A;  4N79 A;  3TMP A;  3H7D A;  5F02 A;  3KFQ A;  5K16 A;  4GUA A;  2FQ9 A;  2UZJ A;  2PNS A;  5J94 A;  4BOZ A;  1CSB B;  1YK8 A;  4X6I A;  3WXF A;  2DCA A;  2C0Y A;  2HWK A;  4MZO A;  4QRV A;  2R9M A;  3LFY A;  2NQI A;  1GMY A;  3S3Q A;  3IUT A;  4QBB A;  2J7Q C;  2G8J A;  4D8E A;  1PAD A;  1NPZ A;  4RF1 A;  3ZUA A;  4Q8H A;  2HHN A;  2JTC A;  1YT7 A;  4CDE B;  3OQC A;  1ATK A;  4OEL A;  2OUL A;  3K24 A;  2J7Q A;  2IBI A;  2BTW B;  2FT2 A;  4QH6 A;  1F2A A;  4MSX A;  4N8W A;  3KWZ A;  3N3G A;  1F2C A;  3MTV A;  2P7U A;  1PCI A;  4HXD B;  1PPD A;  3H89 A;  3IFU A;  1KHQ A;  1AU0 A;  3O65 A;  1A6R A;  3NHE A;  4RY2 A;  2HD5 A;  4RKX A;  1ITO A;  4CDC B;  2YJ9 A;  2AYN A;  3RVW A;  4OW0 A;  2DC6 A;  1EWM A;  2DCD A;  1HUC B;  2E01 A;  3W31 A;  4D8I A;  2HXZ A;  2AUZ A;  4CDF B;  4BS5 A;  4W4U A;  2G8E A;  2DZZ A;  5EGW A;  3PW3 A;  2XU5 A;  4PAD A;  4YYS A;  5CVM A;  1F2B A;  5CVO B;  3TNX A;  1BGO A;  2Z84 A;  3KWB X;  3KW9 A;  1Y4H A;  3I3T A;  1DEU A;  3PHU A;  3ERV A;  3HWN A;  1F29 A;  4YYQ A;  1TL9 A;  3F5V A;  4IUM A;  2G7Y A;  2R9O A;  2BTW A;  2OP3 A;  4YYU A;  5JH3 A;  4BPV A;  3RNV A;  2ARY A;  4D8B A;  1FH0 A;  3BOW A;  5CHV A;  1MIR A;  2F1G A;  6PAD A;  1QDQ A;  2BDZ A;  3MP2 A;  2DCB A;  2FUD A;  3BCN A;  1TU6 A;  1NB5 A;  3OIS A;  4PP2 E;  5A24 A;  4YYR A;  3N3K A;  2NQG A;  1CJL A;  4HWY A;  1AYU A;  2OZ2 A;  1GCB A;  5EZQ A;  4IP3 A;  4MI7 A;  3BB7 A;  2O6X A;  3IMA A;  2YJ2 A;  4BQV A;  4BSQ A;  2B1M A;  5JA7 A;  4CDD B;  3K9M A;  1AYW A;  1K3B B;  3PBH A;  4PP1 A;  8PCH A;  2CIO A;  4P6G A;  2P86 A;  1AYV A;  4RNA A;  5CHT A;  2ACT A;  3AI8 A;  2AS8 A;  2AIM A;  1AIM A;  2VHF A;  4R3D A;  4YYV A;  2R9N A;  1PPP A;  1Q6K A;  1PBH A;  2AGA A;  4ZUX U;  2PBH A;  3DF0 A;  3KX1 A;  1Y08 A;  5KO3 A;  1YZB A;  1EWP A;  5CVN B;  3B21 A;  1BY8 A;  1O0E A;  1CPJ A;  4WUR A;  3OF9 A;  1GEC E;  4X6H A;  3PHW A;  1AEC A;  3H6S A;  3F75 A;  1CV8 A;  2F7D A;  3N4C A;  2JRI A;  4RF0 A;  1VJV A;  3MOR A;  3IOQ A;  2XU1 A;  3P5V A;  3WXG A;  1QMY A;  3PDF A;  4QRX A;  4X6J A;  4P6E A;  3E1Z B;  4OVZ B;  3BBA A;  4FK5 A;  2DZY A;  1MDW A;  1GLO A;  2VHS A;  4ZTB A;  2DCC A;  1AU4 A;  4Q8G A;  2B1N A;  4W5C A;  1MEM A;  4XUI A;  2Y6E A;  1POP A;  3PT2 A;  3TRK A;  2FRA A;  2FTD A;  1MHW A;  3BPF A;  4QRG A;  3P5W A;  2GHU A;  3RVX A;  1YVB A;  2DC7 A;  1KFX L;  2R9F A;  2FRQ A;  5EF4 A;  1MEG A;  4FIP A;  3OVX A;  2DJF B;  4MZS A;  3O0U A;  2BU3 A;  4CZW A;  2DC8 A;  1EWO A;  2H7J A;  2P0R A;  1U9X A;  2YJC A;  1DF0 A;  4REZ A;  3HHA A;  3PSE A;  4I07 A;  1X9Y A;  2XU4 A;  4MM3 B;  2DC9 A;  4OVZ A;  1PIP A;  3OF8 A;  2DOS A;  3CH2 X;  1KHP A;  3PNR A; 
#chains in the Genus database with same CATH homology
 4BOQ A;  3IFU A;  3O65 A;  2AGA A;  4RKX A;  1UKF A;  4BOS A;  5EZS A;  5KO3 A;  5E6J A;  1YZB A;  3PRM A;  4OW0 A;  3B21 A;  1PVJ A;  3C0R A;  4WUR A;  2FE8 A;  3W31 A;  4BOU A;  4D8I A;  3PHW A;  3BY4 A;  3W30 A;  3MJ5 A;  2JRI A;  4RF0 A;  3E9S A;  4A5U A;  2Z84 A;  1DKI A;  4OVZ B;  3BBA A;  3PHU A;  4IUM A;  4XZX A;  2BTW A;  4PT5 A;  4ZTB A;  3TMP A;  3RNV A;  3TRK A;  3PT2 A;  4P16 A;  4D8B A;  4GUA A;  2UZJ A;  4BOZ A;  3MP2 A;  5JZE A;  2HWK A;  3ZNH A;  2J7Q C;  4M0W A;  2BU3 A;  5EZQ A;  4IP3 A;  4D8E A;  4MI7 A;  3BB7 A;  4RF1 A;  4BOP A;  2JTC A;  4REZ A;  3PHX A;  3PSE A;  3OQC A;  2J7Q A;  2BTW B;  4MM3 B;  4OVZ A;  3PRP A;  4RNA A;  3MTV A;  2DOS A;  4R3D A;  4HXD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...