4HXDB

Diversity of ubiquitin and isg15 specificity amongst nairoviruses viral ovarian tumor domain proteases
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
b'DFLDSLIWERVVDEQYITNPTFCVSDYFEVIRQPGDGNCFYHSIAELFFDVKTPSSFRKVKEHLQLAAEVYYDTEPEAVGTGISKDEYIKVAMKDNEWGGSLEASMLSKHLQTTIILWVVNSTEQVTAAIKFGPGRVSTALNLMHVGRTHFDALRII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyubiquitin-C
publication title Diversity of Ubiquitin and ISG15 Specificity among Nairoviruses' Viral Ovarian Tumor Domain Proteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
total genus 43
structure length 157
sequence length 157
chains with identical sequence D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4hxdB00
3PSEA 4BOQA 3PHUA 3BY4A 3PT2A 4BOUA 3PRPA 3PHXA 5JZEA 4BOPA 4BOSA 3PHWA 3TMPA 4BOZA 3PRMA 4HXDB 3C0RA 3ZNHA
chains in the Genus database with same CATH superfamily
2DCBA 2G7YA 4QRGA 4R3DA 3B21A 4RKXA 2PADA 3MTNA 2P0RA 2FRQA 1AU3A 2DCDA 3O1GA 5CVOB 4HXDB 4WA6A 3RVVA 1CS8A 1KHPA 5CVMA 1PE6A 1KHQA 3QSDA 3IV2A 4N4ZA 2HHNA 4D8IA 2ACTA 1ME3A 3P5VA 3QT4A 3CH2X 3LXSA 1A6RA 1KXRA 1U9WA 5A24A 3PNRA 1VSNA 1CTEA 3S3QA 1DEUA 3N3KA 3MJ5A 1AYUA 1YALA 3W31A 1THEA 5JA7A 1MHWA 2JQGR 3NHEA 1YZBA 4CDEB 4RF1A 2DOSA 3BCNA 3C0RA 3OVXA 4Q8HA 1U9QX 2OZ2A 2DZZA 1AYVA 2E00A 4YV8A 1GECE 1K3BB 5J94A 4A5UA 1U9VA 1KFUL 1PPOA 3LFYA 1EF7A 3OF8A 1BP4A 4MZSA 3F75A 4YYUA 4ZUXU 2Y5BA 4QRXA 2H7JA 2PREA 3S3RA 2PNSA 1MDWA 4N79A 2BTWB 3B79A 4K7CA 2FYEA 3CBJA 3IHPA 4M0WA 3RVWA 3OQCA 1PVJA 3P5WA 2HXZA 3BC3A 4D8BA 1YT7A 4YYVA 1TL9A 4YVAA 4XZXA 2FO5A 1NB3A 2P86A 2ARYA 3BOWA 1MEMA 5JH3A 2J7QA 2NQAA 2AGAA 3MTVA 1NLJA 3K8UA 2AYOA 4BPVA 1SNKA 2AUXA 2JRIA 3BPFA 2VHFA 2YJ2A 1TLOA 2F1GA 2DC6A 3HHAA 3F5VA 3HHIA 2R6NA 7PCKA 1BY8A 4RY2A 1AYWA 3H8CA 5CHVA 1EWLA 3OF9A 1HUCB 2AYNA 1VJVA 4X6HA 3PDFA 1AU2A 3MHHA 4GUAA 1SP4B 2XU4A 2FE8A 2UZJA 3IFUA 3P5UA 1F2CA 3M99A 1EWOA 2ATOA 2AUZA 3MHSA 3BB7A 1YVBA 1O0EA 4WURA 1PPDA 4I07A 3TRKA 2DC9A 4ZTBA 3V6EA 1MEGA 1QDQA 4BOQA 2BTWA 2P7UA 3KKUA 1EWPA 2AU1A 3DF0A 2YJCA 1ZCMA 3C9EA 2R9MA 4MSXA 4AXLA 1ZIVA 4PADA 3O0UA 2NQIA 4IUMA 4Q8GA 2OP3A 4DMYA 1U5IA 3H8BA 1ICFA 3H6SA 3PHUA 3PW3A 1AIMA 2CIOA 2WBFX 2FT2A 1NL6A 1QOLA 2G8EA 2E03A 1POPA 1MIRA 2FTDA 3O65A 4I04A 1PADA 3K9MA 2BU3A 5JZEA 4XR7A 2NQDB 1EWMA 2GHUA 3KX1A 1UKFA 1AU4A 2HH5A 2IBIA 4OEMA 4YYQA 1M6DA 1NB5A 4RNAA 4BOZA 4CDCB 1YK8A 3RNVA 3PT2A 3ZUAA 2DJFB 3D6SA 3E1ZB 1CB5A 5EGWA 3IUTA 2JTCA 3KWBX 2JQFR 3N4CA 2XU1A 2DJGB 1ATKA 3I06A 3CH3X 2B1NA 2AVWA 4YYRA 1F29A 3PHWA 3QJ3A 4MZOA 2BDLA 3IEJA 2C0YA 1DKIA 3E9SA 2DCCA 2HD5A 5PADA 3IMAA 1TU6A 4YYWA 2XU5A 2NQGA 3MP2A 3W30A 3WXFA 2B1MA 1F2BA 3ZNHA 4QH6A 3KSEA 3OISA 4CDFB 1DF0A 4QRVA 4W5CA 4MM3B 3BBAA 8PCHA 1BQIA 2YJ9A 2OULA 3TNXA 1FH0A 1Y08A 4PP2E 3CBKA 5E6JA 5EZQA 2IPPB 3BPMA 4FJCA 1KFXL 2AIMA 5EF4A 1PBHA 4KLBA 1PPNA 3PBHA 4PI3A 1AU0A 3WXEA 1STFE 4BSQA 2J7QC 3K24A 1CVZA 2DCAA 2DC7A 2GFOA 4N8WA 3U8EA 2BDZA 4PT5A 5F02A 4QBBA 4OVZA 5CVNB 3USVA 2R9OA 1JQPA 4XUIA 4BS6A 2Y6EA 3PRPA 4AXMA 3GCBA 4G54A 4IP3A 1GMYA 3I3TA 4W4UA 2DC8A 4OELA 4RF0A 4MI7A 3BWKA 6PADA 4D8EA 4FIPA 3IOQA 4P16A 3PHXA 1ME4A 2O6XA 3PRMA 2XU3A 4PP1A 1CV8A 2R9FA 2E02A 1PCIA 1QXPA 2YJ8A 4BOPA 1PPPA 2R9CA 1Y4HA 3KFQA 4P6GA 2FQ9A 2AS8A 2F7DA 4CDDB 2G6DA 3KW9A 1NQCA 1PIPA 1AECA 4X6JA 4CZWA 4BQVA 3KWZA 9PAPA 3HD3A 1CQDA 4DMXA 4FK5A 5KO3A 4OW0A 5K16A 1BGOA 1X9YA 3BY4A 4OVZB 5FPWA 4HWYA 2FRAA 4X6IA 1Q6KA 2FUDA 1QMYA 3MORA 1U9XA 3HWNA 2YJBA 3H7DA 3TMPA 3OVZA 2DZYA 3WXGA 1MS6A 3V6CA 4YYSA 1IWDA 1CJLA 2HWKA 3RVXA 2VHSA 3P5XA 1PXVA 2Z84A 2PBHA 4I05A 1ITOA 1CPJA 1GLOA 4BOUA 2E01A 1XKGA 1CSBB 2G8JA 5EZSA 1S4VA 1NPZA 3PSEA 4W5BA 4P6EA 3ERVA 5CHTA 2CB5A 3N3GA 1YK7A 4BS5A 2R9NA 1F2AA 3AI8A 4REZA 3H89A 4BOSA 1GCBA
chains in the Genus database with same CATH topology
4P16A 1UKFA 3PHXA 4XZXA 4RNAA 4R3DA 3PRMA 4BOZA 3B21A 4RKXA 3RNVA 3PT2A 4BOPA 2J7QA 2JTCA 2AGAA 3MTVA 4HXDB 2JRIA 3PHWA 3E9SA 1DKIA 4D8IA 5KO3A 4OW0A 3BY4A 4OVZB 3MP2A 3W30A 3ZNHA 3MJ5A 4GUAA 3W31A 2FE8A 2UZJA 3IFUA 4MM3B 3BBAA 3TMPA 1YZBA 3BB7A 4WURA 3TRKA 4RF1A 5E6JA 2DOSA 2HWKA 4ZTBA 5EZQA 3C0RA 4BOQA 2BTWA 2Z84A 4A5UA 2J7QC 4IUMA 4BOUA 5EZSA 3PHUA 4PT5A 4OVZA 3PSEA 3PRPA 4IP3A 3O65A 2BTWB 2BU3A 5JZEA 4RF0A 4REZA 4MI7A 4M0WA 3OQCA 1PVJA 4D8EA 4BOSA 4D8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSE A;  4BOQ A;  3PHU A;  3BY4 A;  3PT2 A;  4BOU A;  3PRP A;  3PHX A;  5JZE A;  4BOP A;  4BOS A;  3PHW A;  3TMP A;  4BOZ A;  3PRM A;  4HXD B;  3C0R A;  3ZNH A; 
#chains in the Genus database with same CATH topology
 2DCB A;  2G7Y A;  4QRG A;  4R3D A;  3B21 A;  4RKX A;  2PAD A;  3MTN A;  2P0R A;  2FRQ A;  1AU3 A;  2DCD A;  3O1G A;  5CVO B;  4HXD B;  4WA6 A;  3RVV A;  1CS8 A;  1KHP A;  5CVM A;  1PE6 A;  1KHQ A;  3QSD A;  3IV2 A;  4N4Z A;  2HHN A;  4D8I A;  2ACT A;  1ME3 A;  3P5V A;  3QT4 A;  3CH2 X;  3LXS A;  1A6R A;  1KXR A;  1U9W A;  5A24 A;  3PNR A;  1VSN A;  1CTE A;  3S3Q A;  1DEU A;  3N3K A;  3MJ5 A;  1AYU A;  1YAL A;  3W31 A;  1THE A;  5JA7 A;  1MHW A;  2JQG R;  3NHE A;  1YZB A;  4CDE B;  4RF1 A;  2DOS A;  3BCN A;  3C0R A;  3OVX A;  4Q8H A;  1U9Q X;  2OZ2 A;  2DZZ A;  1AYV A;  2E00 A;  4YV8 A;  1GEC E;  1K3B B;  5J94 A;  4A5U A;  1U9V A;  1KFU L;  1PPO A;  3LFY A;  1EF7 A;  3OF8 A;  1BP4 A;  4MZS A;  3F75 A;  4YYU A;  4ZUX U;  2Y5B A;  4QRX A;  2H7J A;  2PRE A;  3S3R A;  2PNS A;  1MDW A;  4N79 A;  2BTW B;  3B79 A;  4K7C A;  2FYE A;  3CBJ A;  3IHP A;  4M0W A;  3RVW A;  3OQC A;  1PVJ A;  3P5W A;  2HXZ A;  3BC3 A;  4D8B A;  1YT7 A;  4YYV A;  1TL9 A;  4YVA A;  4XZX A;  2FO5 A;  1NB3 A;  2P86 A;  2ARY A;  3BOW A;  1MEM A;  5JH3 A;  2J7Q A;  2NQA A;  2AGA A;  3MTV A;  1NLJ A;  3K8U A;  2AYO A;  4BPV A;  1SNK A;  2AUX A;  2JRI A;  3BPF A;  2VHF A;  2YJ2 A;  1TLO A;  2F1G A;  2DC6 A;  3HHA A;  3F5V A;  3HHI A;  2R6N A;  7PCK A;  1BY8 A;  4RY2 A;  1AYW A;  3H8C A;  5CHV A;  1EWL A;  3OF9 A;  1HUC B;  2AYN A;  1VJV A;  4X6H A;  3PDF A;  1AU2 A;  3MHH A;  4GUA A;  1SP4 B;  2XU4 A;  2FE8 A;  2UZJ A;  3IFU A;  3P5U A;  1F2C A;  3M99 A;  1EWO A;  2ATO A;  2AUZ A;  3MHS A;  3BB7 A;  1YVB A;  1O0E A;  4WUR A;  1PPD A;  4I07 A;  3TRK A;  2DC9 A;  4ZTB A;  3V6E A;  1MEG A;  1QDQ A;  4BOQ A;  2BTW A;  2P7U A;  3KKU A;  1EWP A;  2AU1 A;  3DF0 A;  2YJC A;  1ZCM A;  3C9E A;  2R9M A;  4MSX A;  4AXL A;  1ZIV A;  4PAD A;  3O0U A;  2NQI A;  4IUM A;  4Q8G A;  2OP3 A;  4DMY A;  1U5I A;  3H8B A;  1ICF A;  3H6S A;  3PHU A;  3PW3 A;  1AIM A;  2CIO A;  2WBF X;  2FT2 A;  1NL6 A;  1QOL A;  2G8E A;  2E03 A;  1POP A;  1MIR A;  2FTD A;  3O65 A;  4I04 A;  1PAD A;  3K9M A;  2BU3 A;  5JZE A;  4XR7 A;  2NQD B;  1EWM A;  2GHU A;  3KX1 A;  1UKF A;  1AU4 A;  2HH5 A;  2IBI A;  4OEM A;  4YYQ A;  1M6D A;  1NB5 A;  4RNA A;  4BOZ A;  4CDC B;  1YK8 A;  3RNV A;  3PT2 A;  3ZUA A;  2DJF B;  3D6S A;  3E1Z B;  1CB5 A;  5EGW A;  3IUT A;  2JTC A;  3KWB X;  2JQF R;  3N4C A;  2XU1 A;  2DJG B;  1ATK A;  3I06 A;  3CH3 X;  2B1N A;  2AVW A;  4YYR A;  1F29 A;  3PHW A;  3QJ3 A;  4MZO A;  2BDL A;  3IEJ A;  2C0Y A;  1DKI A;  3E9S A;  2DCC A;  2HD5 A;  5PAD A;  3IMA A;  1TU6 A;  4YYW A;  2XU5 A;  2NQG A;  3MP2 A;  3W30 A;  3WXF A;  2B1M A;  1F2B A;  3ZNH A;  4QH6 A;  3KSE A;  3OIS A;  4CDF B;  1DF0 A;  4QRV A;  4W5C A;  4MM3 B;  3BBA A;  8PCH A;  1BQI A;  2YJ9 A;  2OUL A;  3TNX A;  1FH0 A;  1Y08 A;  4PP2 E;  3CBK A;  5E6J A;  5EZQ A;  2IPP B;  3BPM A;  4FJC A;  1KFX L;  2AIM A;  5EF4 A;  1PBH A;  4KLB A;  1PPN A;  3PBH A;  4PI3 A;  1AU0 A;  3WXE A;  1STF E;  4BSQ A;  2J7Q C;  3K24 A;  1CVZ A;  2DCA A;  2DC7 A;  2GFO A;  4N8W A;  3U8E A;  2BDZ A;  4PT5 A;  5F02 A;  4QBB A;  4OVZ A;  5CVN B;  3USV A;  2R9O A;  1JQP A;  4XUI A;  4BS6 A;  2Y6E A;  3PRP A;  4AXM A;  3GCB A;  4G54 A;  4IP3 A;  1GMY A;  3I3T A;  4W4U A;  2DC8 A;  4OEL A;  4RF0 A;  4MI7 A;  3BWK A;  6PAD A;  4D8E A;  4FIP A;  3IOQ A;  4P16 A;  3PHX A;  1ME4 A;  2O6X A;  3PRM A;  2XU3 A;  4PP1 A;  1CV8 A;  2R9F A;  2E02 A;  1PCI A;  1QXP A;  2YJ8 A;  4BOP A;  1PPP A;  2R9C A;  1Y4H A;  3KFQ A;  4P6G A;  2FQ9 A;  2AS8 A;  2F7D A;  4CDD B;  2G6D A;  3KW9 A;  1NQC A;  1PIP A;  1AEC A;  4X6J A;  4CZW A;  4BQV A;  3KWZ A;  9PAP A;  3HD3 A;  1CQD A;  4DMX A;  4FK5 A;  5KO3 A;  4OW0 A;  5K16 A;  1BGO A;  1X9Y A;  3BY4 A;  4OVZ B;  5FPW A;  4HWY A;  2FRA A;  4X6I A;  1Q6K A;  2FUD A;  1QMY A;  3MOR A;  1U9X A;  3HWN A;  2YJB A;  3H7D A;  3TMP A;  3OVZ A;  2DZY A;  3WXG A;  1MS6 A;  3V6C A;  4YYS A;  1IWD A;  1CJL A;  2HWK A;  3RVX A;  2VHS A;  3P5X A;  1PXV A;  2Z84 A;  2PBH A;  4I05 A;  1ITO A;  1CPJ A;  1GLO A;  4BOU A;  2E01 A;  1XKG A;  1CSB B;  2G8J A;  5EZS A;  1S4V A;  1NPZ A;  3PSE A;  4W5B A;  4P6E A;  3ERV A;  5CHT A;  2CB5 A;  3N3G A;  1YK7 A;  4BS5 A;  2R9N A;  1F2A A;  3AI8 A;  4REZ A;  3H89 A;  4BOS A;  1GCB A; 
#chains in the Genus database with same CATH homology
 4P16 A;  1UKF A;  3PHX A;  4XZX A;  4RNA A;  4R3D A;  3PRM A;  4BOZ A;  3B21 A;  4RKX A;  3RNV A;  3PT2 A;  4BOP A;  2J7Q A;  2JTC A;  2AGA A;  3MTV A;  4HXD B;  2JRI A;  3PHW A;  3E9S A;  1DKI A;  4D8I A;  5KO3 A;  4OW0 A;  3BY4 A;  4OVZ B;  3MP2 A;  3W30 A;  3ZNH A;  3MJ5 A;  4GUA A;  3W31 A;  2FE8 A;  2UZJ A;  3IFU A;  4MM3 B;  3BBA A;  3TMP A;  1YZB A;  3BB7 A;  4WUR A;  3TRK A;  4RF1 A;  5E6J A;  2DOS A;  2HWK A;  4ZTB A;  5EZQ A;  3C0R A;  4BOQ A;  2BTW A;  2Z84 A;  4A5U A;  2J7Q C;  4IUM A;  4BOU A;  5EZS A;  3PHU A;  4PT5 A;  4OVZ A;  3PSE A;  3PRP A;  4IP3 A;  3O65 A;  2BTW B;  2BU3 A;  5JZE A;  4RF0 A;  4REZ A;  4MI7 A;  4M0W A;  3OQC A;  1PVJ A;  4D8E A;  4BOS A;  4D8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...