4RF0A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p6522)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
318
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Protein binding
molecule keywords ORF1ab protein
total genus 78
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf0A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf0A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf0A03
4OVZB 3MJ5A 4P16A 4REZA 4M0WA 4WURA 3MP2A 4RNAA 4RF1A 4RF0A 5KO3A 3E9SA 4PT5A 4OW0A 4R3DA 5E6JA 4MM3B 4OVZA 2FE8A
chains in the Genus database with same CATH superfamily
1AYVA 1X37A 4FN2A 2HL7A 4CDDB 2R9OA 4IDIA 3DVNU 1DGBA 1CQDA 1HEZE 2JY5A 1CK1A 3T6PA 4YSXB 5CHVA 2M5ZA 2JZPA 3H89A 3RFZB 4B7GA 3OJ3A 2A5UA 2MEKA 3W9CB 1EWLA 3ZDMC 4K7CA 4II2B 3P4RB 4LJ8A 3N32A 2P0RA 2ZNVB 3OISA 1R7RA 1HA5A 2ZAOA 1IYFA 4XWTA 4Q7JA 3MTVA 4L4UA 2DENA 4QRGA 3QWZB 1VJKA 2DWNA 5FLXS 3VH4B 2GRIA 1E9SA 1KHPA 3HM3A 5C3JB 3RGSA 3R2IA 4YWGG 1I4PA 1QZMA 1N62A 1KF6B 4KKJA 2D3BA 2IY1B 3PHXB 2BWES 4LDTB 2DC8A 1I4XA 3VVWB 1NO1A 1PIPA 3HWNA 2VQFM 3T3OA 4LJ9A 2BJVA 1TY0A 1YJIA 1TH4A 1XNQM 2RPVA 3PZDA 1PVJA 2JWZA 2NMQA 3U6DA 3KYDD 2E5LM 2N7DA 1AU3A 2AUXA 3VK8A 2LXCA 3SDLC 4S0RA 1OQRA 3MFGA 3SASA 3KH0A 2Y5BA 5ITRA 1LV7A 3GPPA 4BPVA 1VR9A 1XT9B 2LRUA 3AH7A 2BQQA 3PVSA 1R2ZA 2KJRA 2ZANA 3ZH9B 3SHGB 2OOBA 1IY0A 2CFOA 2I7NA 2H88B 3N4CA 3AFHA 4OHJA 2JRIA 1D5MC 4FWHA 1IGDA 3WCQA 4XWWA 2EKIA 3PVLA 4C7YA 3N30A 1NHWC 2BBCA 1ZGUB 2CEAA 2EO2A 2H1RA 1TZ1A 4EZKA 3CTWB 3PHUA 5DFLA 4WJPA 3AM9A 3U60B 1YUBA 2K1FA 2L1AA 4EZJA 1ZP0B 2XH9A 1E6EB 3D6SA 3HHIA 1QAQA 4KDIC 1F2RC 2WXGA 4LF4M 4QOSA 1FXAA 3H1UA 5C18A 1A5RA 1FPYA 3ZYYX 4AI6A 5IZ7D 3UGBB 2MCNB 2L32A 1GC7A 2EKEC 3ZRCA 2FCQA 2JZ3B 4KX6B 1QQRA 2R2OA 3NHEA 1N60A 2LVQD 1PCIA 3KVWA 3B1LX 4IBEA 1SE4A 2O6XA 4BOPA 4IBGA 1ISNA 4GIVA 5BMGA 4G0NB 2F7DA 2KNAA 5BO4B 2IO2B 4IOIE 1BT0A 1ZQ9A 3AXCA 2MJ3A 3NVWA 2GFOA 1RWSA 1JR3D 1NLJA 1TYGB 3TWKA 1GG3A 1ZV1A 4D8EA 4PI3A 1W5TA 4BOZA 1CPJA 3NVYA 3FE3A 1PJJA 1E7VA 2DXIA 1U9WA 2FO5A 1KFXL 4D8BA 3I9V1 3NHEB 2ZW0A 4LLGM 5J2RA 4BOSA 5ITYA 2DC7A 2GBJA 1M4VA 3AEBB 2FBWB 4GDLB 1GL7A 2DAIA 4W9GA 4XX5A 1JWBD 3GLHE 3E46A 4FK5A 2HKJA 3KVFB 4YSYB 1XXHA 3FKEA 2L8JA 3WHLA 2NR2A 4I6NB 1EM7A 3HU2A 2QBYA 1H8CA 3KQ4A 3NOBA 5KQ8A 1C76A 5E6NA 4AOFA 1OTRB 3L16A 4LJOB 3A9JB 2EJSA 2C9OA 1D0MA 3EIEA 1R5LA 4QHTA 1FRRA 2QHOA 1DF0A 2BTWB 2BNKA 4MGIE 3VTWA 1KFYB 1WI0A 4MB7A 1ZE3D 3M6AA 2KK8A 2GHUA 4AQYM 1KH0A 4MEMA 3BY4A 2PKOA 5G5HA 3LQRA 4A5UA 2MBHA 3NVZA 1YN4A 2ACZB 3J81S 2WNMA 4A3PA 2DWLA 1WX7A 4P7IA 1ESFA 2DZZA 1N34M 4CDCB 4FCVA 2LVPA 2MLBA 5FTJA 4CISA 5KHQA 4WQMA 5KO3A 2FNAA 3EGRA 3DBHI 4DMYA 1A5TA 5PADA 4DBGB 1L6VA 3KOWE 2QPAA 4XDDA 1FCCC 3NBIA 4FCTA 2FT2A 5HHDG 3ETRA 4W5WA 3N1XC 2LASA 4MSXA 2WSCF 4FWDA 2J7QA 3FILB 2CR5A 1B9RA 1WGKA 4L78A 1SJED 2JT4B 3M63B 4XUIA 3S3RA 3L54A 3PREA 4NXMM 5JHBA 3THGA 3KWLA 3FD9A 3GZNI 3OLMD 1AARA 4ANXA 2L6OA 2R4EA 2O01F 2P5TA 2R61A 2BYTA 3U52E 1Q10A 5FTMA 3B9JA 3I06A 2Z0EB 4QOZC 2DYOA 2ZCCA 3SAVA 3U7DA 2PNSA 1MX0A 3U6EA 4X66M 1E7UA 2G3QA 1NDDA 2QCZA 4BQVA 1BMLC 1FXIA 4DHJD 5ITXE 1IGCA 3P4SB 2V4IB 4C80A 1C3TA 5LLIA 2LHGA 3MC8A 4I6PA 1I42A 2APLA 4NQKE 3SU8X 3ZQ4A 1V80A 4ZUXU 4QAYA 4M9SA 3KUCB 2L00B 1BUIC 3OTOM 3ALBA 1PFDA 3IECA 4WIPA 3AU4A 3I4VA 1CQVA 1FMAD 1VCBA 4TSSA 1WR1B 2F5QA 1R4NI 2CB5A 2PVOD 4YV8A 4JLCA 2KX3A 2DCAA 2UYZB 2VF8A 2L3ZA 2A5YB 1I35A 3L17A 4WAFA 3KUZA 2DAGA 3SARA 4NJCA 5EE1A 3ZW3A 2YJ8A 2K8CA 2BJWA 3U5ZA 4NC6A 2N7JA 2BS4B 2JY7A 2ZW1A 4FJCA 4MI7A 2JY6A 1PDXA 4WWNA 4D2KA 1KRHA 1WR6E 4BBNC 5IT9S 2QSDA 2KDLA 2C9CA 3K92A 3AE4B 3R8BA 3K9OB 1KSFX 3OG5A 2JY8A 4OX9M 1GABA 2KRUA 1H6UA 4HPPA 1GB4A 3ZNHA 2D3CA 3ZIMA 1OEYJ 4W9LA 3TWLA 3P5VA 1CZPA 1SE2A 1N63A 4EOYA 1OQQA 1F9JA 4EE2A 4YYVA 5H92C 1VEGA 2LVNC 1WJNA 2LFIA 2HTHA 3FUTA 2IBIB 3EECA 2DCDA 4IBFA 1IXSB 4GH9A 4DHZE 4M01A 3RNCC 3DVGY 4BOUA 5D7GA 3Q8CA 4HKZE 5E26A 3GP7A 3KUDB 2INCC 4GITA 1RFAA 3IT6B 4NJ6A 1QDTA 4LJ4A 1QOBA 2K25A 3N1YC 3P1MA 3SFDB 2YNMD 2R62A 3HKPA 3ML8A 4B95A 1ZPSA 2V0GA 3GLFB 3L28A 1TS5A 3VK7A 2AGAA 2UZJA 2ICIA 4NL4H 4F7ZA 2FCMA 5EXTA 2Z4SA 5D3IB 2R0IA 2LWXA 4KLNA 1TH3A 1GC6A 1NYRA 4PS3A 2DNFA 3C9PA 2FE8A 3OF8A 3U6MA 3BINA 2DZYA 3AOGA 2WDTB 3P5UA 2NPTA 4K7UA 3LVWA 3NBXX 4X65M 1PPPA 4W5CA 2AYOA 4OEMA 2KC1A 4IBKA 1MHXA 1VZ8A 3JR4A 4GIPA 1FEHA 3VQIA 1J19A 3PSEB 3DBSA 1WHCA 5EXXA 1ME3A 3PNYA 5FPWA 2CHWA 1XMQM 3E4RA 4WW0A 2N1WA 5IAAC 2Q2EB 4W9IA 3QIJA 2ARYA 1WM2A 4HXDA 3LB8C 3IVFA 1QDRA 2D7HA 1QOFA 4QBBA 4G6ZA 1D4BA 2XSZD 1P98A 2WXHA 1R7SA 5BPVA 1YNTE 1C79A 4XYCA 1C4PA 3IXSA 3QYEA 3EFUA 5LNK1 4YXDB 1AIPC 3ECIA 3HD3A 2L7RA 1XMOM 2QEJC 2Z0DB 1T43A 3UZUA 3B21A 4M9ZA 5HKHA 2ZCBA 1JCKB 4BFRA 2E02A 1ZCMA 4K3BA 2JY6B 4GEWA 3LW5F 5LMNM 3D8LA 4DR4M 2MBBB 5AUKA 3WALA 4CQNA 1BP4A 1OIPA 3K1JA 4J6IA 2H7JA 2WXJA 4ANRA 4ZHOA 4IWOA 1GJTA 1K52A 2O6VD 3NJTA 4NAWA 1FH0A 2BVCA 3DQVA 4RY2A 2F5NA 3V3XA 1KJTA 3ZNZB 2ZAMA 1ZXIA 3KW9A 2N9PC 3FTCA 1V86A 3Q3MC 2KACA 1I4HA 3T38A 2WXOA 2KQSA 1SP4B 2DZKA 4C00A 3LQQA 3CSTA 4LZZA 3B9PA 2NQ8C 2RKOA 4LGYA 2J53A 2DC9A 2YR0A 2YFQA 4IBCA 1PJSA 1WGNA 3RE8A 1XD3B 2RGFA 4W5BA 4TUUA 3PLUA 4P1CC 1YK8A 2R9CA 1XXHE 2CWBA 3HJQA 3BVGA 3VKGA 3ZJUA 4GDKB 3DWGC 2AVWA 1YD8U 4I81A 2J5YA 1D3ZA 4GXBA 7PCKA 3TL5A 3PO0A 3KSEA 3USVA 5BR8M 3BYYB 2DZMA 4GC9A 4JWSC 4MT5A 2PTLA 2R46A 3AEDB 2KMMA 3O13A 3FUWA 4IWQA 3W30A 1G3IA 1MEMA 3PSEA 1S1QB 4MH0E 2ATOA 3AECB 5CVOB 4KVGB 4JX1C 3V61A 1HZ5A 1VJVA 2R9MA 3BXWA 4YYSA 2ERCA 2WHIA 4PK1A 2DI0A 3QYBA 4QNRA 4HXDB 3PLVA 2WX1A 4L1BA 2XK5A 3LCUA 3MC9A 3PDFA 3MP2A 5H37D 1WGLA 2ZTCA 4Z8XA 2R6NA 1EUVB 1U9XA 1U4AA 2O6VB 1P9DU 2D7EA 4R7GA 1RAXA 2J52A 2DNAA 4FD2A 2FQ9A 4YHHM 2PVGC 2CUZA 3IHPC 4ANUA 3TE6A 4X6JA 4LNOA 1YALA 2JNHA 2CJNA 2KZRA 3MHSD 3CSFA 3OF9A 1TS4A 2KA6B 4YL8A 1CVZA 2M17A 2OPFA 2J7NA 4LFBM 3DVGX 3CF0A 2YEPF 3ZCBB 5BYSA 1UKFA 2E00A 1N36M 3PV1A 4DXGA 2LXAA 4DUYM 4IM2A 1MI0A 2LI5A 1Z59A 4XK8F 3PPAA 5AZGA 3SD5A 4A8XC 5E6OA 2MH7A 4NOOB 3FKYA 2R6FA 1ZMWA 1L0XB 5JA7A 2E6XA 3F92A 1MVKA 3EUB2 1KHQA 5CHTA 1HZ6A 2FOIC 2DVWB 3J7AS 1HQRD 2LZ6A 3R7QA 3WXGA 1VDLA 2WU2B 2K39A 4Y28F 2R4JA 3PW3A 1CTEA 3U61A 5E6PA 5FSWA 2KANA 2PE6B 3CBKA 1G59A 2WDQB 1C7YA 1Y8RC 4IJFA 3X0WA 2WDVB 3L13A 5CHWA 3BIID 5G55A 1XCTL 3WHKA 4JGHB 4MH8A 4LJ7A 3W2DA 1E90A 3C0RA 4MGKE 1E8ZA 2BWBA 2KNZA 2Q5WD 2NQIA 5AZFA 5ITQA 3Q14C 2B3TA 1HT2E 1VEJA 2KWVB 3R3MA 4HCNB 1WXAA 3GPYA 1EWYC 2JQRB 2CU3A 1DO2A 2OJWA 2RPQA 1BGOA 4HROA 1ET9A 3RNAC 4X57B 3JYUA 1ZMUA 4LJ5A 4MM3B 3GLGB 1FNVA 2BGFA 3FRHA 1WXMA 2LGIA 3IG3A 4BOQA 5IWAM 4G4OA 3E1ZB 1TT5B 2QP9X 3Q69A 3TJPA 2VHSA 3HHXA 2M4NA 3VDUA 1NHGC 1WMHA 3PHWB 4UN2B 3GE3C 4LTUA 4AWJA 4URKA 3DHIC 1QMYA 3VUYA 1AU2A 2Y21A 3A4RA 1P3QQ 3HX3A 5TSSA 1NSFA 1K8RB 1WZ3A 3J80S 4DV0M 3A45A 1QZEA 1SIFA 4OVZB 4YYUA 1XHBA 3BOSA 1K3WA 2R44A 3SEBA 1UH6A 2ZNVC 4PT5A 1VDDA 3J2PB 2C98A 2B1MA 3U30A 4JI3M 2KO3A 3VXWA 1OEYA 4I05A 5FKAC 2J0JA 3D32A 4G11A 3ZO5B 2B3AA 4OZCA 1UZXB 4Q8GA 3ABVB 2L05A 3IG5A 3M99A 3V76A 1AECA 2AHMA 3DBHB 5EP2A 1X1MA 2ZPYA 3W68A 2FFJA 2X49A 1CJLA 5KPTA 3AV8A 3H8HA 4FVMA 2DZOB 4ANWA 2BYFA 4GHAA 1Q1OA 1VLBA 4BS5A 1WM3A 5LXIB 4FXCA 2JUJA 2LGSA 3U6PA 3NY5A 1VQ1A 4ZRJA 1WY8A 3MHHA 2Z59B 3Q3JA 2AUZA 3NS1A 1Q02A 4QRVA 3EFCA 2MBEA 3VH3B 4XGIA 4WJOA 2FNJB 3PRPB 4I4LA 1UBQA 1RYJA 2JRIB 1I4GA 3CMMB 2VF7A 3L4PA 3C0RB 1BXTA 4F8CB 4DK5A 2DAJA 2XFSA 2LVOC 4LK0M 1STFE 1CV8A 3U6SA 2W82A 3QJZA 4NSRA 1Y08A 3KDSE 1NJFA 4PDGA 3KYCD 2BF8B 4N9F4 2WU5B 2BTWA 4LNNA 4TKNA 2UXCM 2J0MA 3M7GA 2M19A 3TUOA 5JXVA 4ZPXA 4FLHA 4KO8A 3BK1A 3IFUA 3KS4A 3CBJA 4AJWA 1L0YB 4C7ZA 4EUTA 2RDGA 2IPKD 1GL6A 2ON8A 1MG8A 3Q8BA 1JR3E 1ATKA 1AWDA 1D0KA 2XEWA 4YTNB 3H7SA 3RYTA 3NRZA 1QDQA 4EZLA 5CHVC 2HCBA 1J7AA 3KW6A 1GAQB 1FFVA 5CHFA 2N9XA 1WGDA 4DV4M 2MBOA 2L4FA 3PT2A 2HXZA 2OULA 3VHTC 1SE9A 1SBBB 1JR3A 3MMPA 1IN6A 3U8EA 4KIKB 2K9XA 4BVUC 1ET6A 1JWUD 4HJGE 2MSED 4QNMA 2PEAA 1YLAA 3UJNA 2KEBA 2WLBA 4II3B 2M56B 4E71A 2J42A 3QWLA 3KFQA 2AYNA 2ACTA 2XU1A 3UI3A 4RGMA 4G4QA 1HE8A 1R4MI 2YJBA 1F2RI 1FD6A 1TY2A 3LDZE 3ZTDA 2V3NA 1PM5A 1FNNA 3QQ8B 2QMTA 3NS8A 3B2GA 2HD5B 1IXZA 2QILA 1C78A 2CIOA 1V92A 3FUXA 3BK2A 1UUPA 3ZKJC 1K82A 3AE8B 1P3QU 3L26A 3DHHC 5EZQA 1UFZA 2GBNA 2DZIA 3IAS1 4KKIA 4A20A 4BBNF 2YVCA 4LY6A 3BBZA 1DOIA 2NQGA 3Q3NC 2KLCA 3P5WA 3U6QA 2L4EA 4LCDE 2JSVX 2G8EA 4PADA 3H8CA 1LTMA 1TGZB 2OHFA 3RD2A 1YN3A 3KS8A 5ITTA 1ZDXA 1VRAB 3WXFA 2KJHB 1LXDA 2KX0A 2KOXA 4ZOHC 4JN6A 1OKSA 2DAMA 3BVMA 3K9PA 2VH1A 3BPMA 1W5SA 1OGWA 1WE6A 2KZUA 3UQBA 2JXTA 4CDEB 4LRTA 1OFFA 1NBFC 4OELA 3W0FA 4F1SA 5FTLA 2SAKA 3LYYA 2R9NA 2LH0A 4GHLA 2HE7A 2EA0A 3FAHA 3HHMA 3UGJA 3DWMA 3DBLB 5J17A 3BB7A 3ZJVA 4JXJA 2I38A 4OZBA 2R18A 3HHYA 3FYCA 4S12A 2XNAC 3H7PB 4NXNM 2CU1A 1NVMA 2GMIC 4YTMB 1IBXB 3KLSX 2DHZA 4LG2A 3AMZA 4RM8A 4C4VB 2RGHA 1IN4A 4JYAM 3ZQJA 1QLBB 3IBEA 4DDGD 3O65A 2IJ0A 1S3SA 2MA9B 4H2AA 1N75A 4CO7A 4I5SA 4R71A 3W5UB 3QAUA 3VKHA 3B7ZA 3GPUA 1WE7A 4M02A 2IO0B 1VSNA 4IBIA 2PLPA 4YVAA 4PCZA 3AEFB 1R2YA 2X8XX 3PGEA 2IBIA 3SAUA 2I1JA 3W1SA 4G4NA 4CIZA 3ENEA 1D0LA 1WJ4A 2TSSA 3QAQA 2Z4RA 4HEOA 3GLFA 3JSVA 2F5PA 2JZ0A 4MJSA 2DWQA 1XWIA 1ZIVA 2K47A 5DPSA 3RPFC 3B79A 4CDFB 1S4VA 3H9DA 3KXEC 3TSSA 5G5GA 4AKGA 3NZ3A 1SXJE 1LGRA 3KP1E 1I94M 3MC0B 5IOIA 3U6CA 1WGHA 3M3JA 3H4JA 1V5TA 3BPFA 3PHXA 3AE5B 2CKHB 2D5GA 4KSKC 5E6JA 1PXVA 2FYEA 1HQYE 1D5ZC 4JI8M 1FNUA 2KD0A 3TMPB 4WURA 3U4EG 1UELA 2QIEB 1FCLA 3J9CA 1IY2A 2NS5A 1EWOA 3H6SA 1F2CA 2JQGR 2IGHA 3PNRA 1RM6C 3DOWA 3SMPA 5BMHA 2I1KA 3IG8A 2NBUA 1DGFA 4DV1M 1QANA 1NI2A 1E8WA 2KWDA 5FTKA 1C4CA 3P2BA 3SBJA 2LTUA 3MHVC 2WXPA 4YYRA 4LNFA 1T3TA 3P4QB 5DYIA 4BB9A 4KLBA 3QHTA 2KN4A 4RGTA 4N79A 1AYFA 3I51A 1L8QA 3VFKA 3ZXVA 4K7SA 2R2QA 2IO1B 1V33A 1EIJA 1CUKA 4YTPB 2IY0B 1TKGA 4RKUF 1FO4A 1CSBB 4X6HA 1DGJA 2FUG1 1XXGA 2WXIA 2W55A 1KFUL 4AW4A 2W3SA 1G41A 2DENB 2LXEA 2UXDM 2KDBA 4REZA 1NYQA 4WA6A 3ZRFA 4A3OA 2R65A 4DV2M 4ITQA 4PP1A 3AOEC 1YOVB 1F1HA 1PE6A 1UWMA 3W5VB 1ITOA 2PMVA 4FA6A 5H8YE 1POPA 4FWGA 5F3WA 1UGMA 2KJ6A 5MPOA 2C9WB 1T0YA 1XB2B 4I8OA 1J7CA 2V3PA 1JWMD 2JQFR 5D94A 1HNZM 1N5XA 4HPLB 3RN9C 2WS3B 2EMTA 2F5SA 2BB6A 4BKTA 2KZSA 1EU4A 1C9FA 1ZUD2 3GO8A 3GLHB 1ME4A 4GKJM 1TKYA 2N9EB 4BZAA 3EIHA 3V6EA 4DXFA 4HJKA 1KOTA 1RRBA 3J7BA 1LQBA 4PS7A 4DV7M 4IIWA 4XDCA 3R7RA 2MJEA 1XNRM 3K9PB 1HQCA 4LDTD 3KWZA 2VQEM 2INDC 4DR1M 4M9XA 1I4RA 3F75A 2FIDA 2XGNA 2IZVB 2L2DA 1WF9A 2HAKA 3RNGC 4DR7M 2QHOB 1WJ7A 3A1QB 2FS1A 2IDYA 2IGGA 4AS1A 3TCAA 2KC2A 5AEKB 2CHVA 2RSUA 2BB5A 2LGXA 4ZTBA 2WXFA 4AP4C 1MS6A 2HWKA 2Y5PA 4KGSA 2KYWA 5FR6A 3RNVA 3PZ7A 2O25A 4HLEA 2DHYA 3RCZA 4WQOB 3BVZA 3PFIA 3ZXRA 2IGDA 3RUIB 1MEGA 1YE9A 4GC5A 2L52A 3PRMA 2HTME 3NUHB 1YJJA 3T3NA 1C1YB 1SXJD 2JYTA 3APDA 4YYQA 3ZUAA 1ICFA 2CV2A 4IWPA 3L29A 2Z8YM 4A90A 2MP2A 1NY6A 1YMHE 3JAMS 4M8MA 1SJHD 4PYZA 2L7HA 2G9HD 1PYWD 3Q8XA 1PPNA 3SHQA 3U6OA 1UF0A 2JTCA 2LVQA 2BWEA 3MJ5A 1JWAD 1AU0A 1HNXM 3RNEC 2KFJA 1SXJC 1E7PB 2FIFA 1JROA 4YT0B 3UIPB 3N3GA 3IFWB 5HG2A 3UINB 3FILA 1QYRA 1KLGD 2I2YA 2DYMA 2OO9A 3A46A 4N8WA 3HVDA 3D8BA 4A55A 3UK6A 1VDVA 1F4IA 4S17A 1ROEA 1MHWA 4BOZB 3HIZA 3SFEB 3AEAB 4FJYA 4CYEA 4CZWA 3B7QA 1DKIA 3KOXE 2V1YA 1JQJC 4IP3A 3A9KA 1NY5A 1HTOA 1N5WA 4O1NA 4FW9A 4L15A 1XLOA 4HDQA 3AJIB 2K3UA 3Q3OC 1D2NA 2JPHA 2LGDA 3DBLI 1BY8A 1P1AA 1GJZA 3DA1A 1MG4A 2XZFA 3U61B 3TMPA 4B7FA 4B3RM 1KLUD 5IP4D 1HT1E 3DF0A 1GMYA 1HJPA 1XC8A 1U9QX 2INPE 3AL0C 2QJLA 4M0DA 1QUSA 3O0UA 1PJQA 2HJ8A 3GLIA 2N35A 1WR1A 3T9LA 4FHJA 2YJ2A 4OU7A 1S3SG 3W1YA 1AN8A 4B0MA 1TF0B 4BBAA 3TWMA 5KPRA 3AEGB 1VG5A 2OOAA 2RDBC 3ZJTA 1TJEA 1F77A 2J7QB 1TU6A 1N33M 2KDIA 1NQCA 2D07B 1OAIA 3A1QA 4NPNA 1TBEA 2AEHA 3KSJA 3T8MA 1YVBA 4W9DA 1N77A 5GXGB 3GP1A 3TL4X 1T3QA 2QSFX 1PGXA 4PD2A 2W9NA 3K2LA 1N32M 1SNKA 3I63C 1R4MB 2N1VA 4KZ0A 4CHKA 2Y6EA 4MELA 3JR5A 1TTNA 2OEDA 4W9HA 3MORA 1J09A 4MGYE 3SR6A 3RFWA 4DV5M 3DOAA 5EGWA 1SE3A 4OVZA 4LNIA 1NNJA 1UM8A 3VFDA 3GLFE 1M94A 1TLOA 2RRUA 3GRUA 2WX0A 3TEXA 2R45A 4OVUA 2KDFB 3QJ3A 2J0KA 3DCGA 1FIQA 1QILA 1IXSA 3GLGE 5EQTA 4L8RC 3IMAA 2KHWB 4KV2A 2WSFF 4WWPA 2LBCA 3K8ZA 4AKIA 5C1ZA 2G6DA 3LXSA 3RVVA 4QH6A 3GQ4A 1TS3A 5DYGA 2QBYB 4JI4M 3N3KB 3ZNID 2PBHA 1G71A 1JALA 4W9KA 4J3OD 1PPDA 2DYBA 2GI9A 2CHQA 2M8SA 1MDWA 4W4UA 1XLQA 2K0PA 2XN9C 2DHRA 1TTEA 2DWZB 4AXLA 1BVSA 4GMQA 4RGOS 1Z5BA 4NY0A 2BKFA 1XLNA 3M95A 1L0VB 2K6QA 4A3VB 1L2DA 4ZRIA 2AYOB 3KSXA 1KLVA 3V60A 4L2YA 1MJGM 3VRBB 4RNAA 4RM9A 1KFVA 4DHJB 4XR7A 1E9MA 4USAA 2KFKB 2DJGB 3NZSA 4DUZM 3C58A 3TNXA 1T6OA 2BYVE 2CP8A 4JV5M 2OZ2A 1GKIA 2ZVOA 1NJGA 3BWUD 3P4PB 4XGAB 3DBRB 1EF5A 4KZCA 3WAOA 1WSPA 4WP2A 2KT7A 4LGMA 2UU9M 2DJFB 2MWSB 1XXHB 2QZ4A 2PE9A 2L76A 3KW5B 4ANVA 5JHAA 3IHPA 3BWKA 5EE9A 2CHZA 2PADA 1IM2A 3GLIB 3BBAA 3A9JA 1NVID 2C60A 3TEZA 3UIOB 2WWZA 4Z6YA 4GN1A 1J7KA 3DPDA 1WXSA 2FUDA 3KX1A 2LJIA 4OW0A 3GRVA 4ICUA 4DMXA 3I3TA 1SSNA 2PPHA 4D81A 4IKGA 1DOYA 2L0FA 2DZNB 1L4DB 1H4RA 2CS4A 4JI6M 1DO0A 1IBMM 3IEJA 5KPZA 4LCBA 5K16A 5L8RF 3GLHA 1E5WA 1Y4HA 3QC8B 3AULA 1T0QC 2WXKA 3CIRB 1YZBA 2EKKA 4DBGA 3KWVA 3A9KB 5J18A 3AOEA 4DR3M 1VZ6A 5G2NA 3ZUNA 4W9CA 5JZEB 1EF7A 2JP7A 4KT0F 3HU3A 1GNUA 2LGYA 2FUHB 1EWCA 3HU1A 3AU5A 4NJ7A 5DCNA 1Q39A 3SC3A 2C5RA 1V8CA 1KXRA 1YK7A 5TR5A 2Z84A 3Q8EA 3ERVA 4IBBA 3RVWA 2RGOA 5CTRC 5IREB 4ZYSA 2ZJDA 1PGYA 1MPEA 3PRPA 1QXPA 1F29A 3FYDA 4MSMB 2GBRA 2EKFA 3VDPA 2KXEA 1E8YA 1EO6A 1XLPA 2KTRB 3IT4B 1FNWA 1SXTA 4JI1M 4KSLC 1C1KA 3ZDTA 1F0ZA 3WA0A 2WQYB 3FRIA 5JI2E 3VLFB 1VD2A 4DR5M 2UXBM 2G4SA 2O2VA 4IG7B 4DXAB 4B3MM 4DV6M 2KDEB 1Q6KA 6PADA 1IUEA 3SYKA 3QCAA 4JI0M 4B3TM 4WJNA 1L1ZA 2GBKA 1U9VA 3KOYE 1B1ZA 1STEA 2ZPNA 3RGPA 3Q3FA 1WYGA 2AL6A 2MP2B 2CV1A 4GSWA 3VR8B 4G3OA 4XBOA 1UNSA 4NQLB 2KXJA 1WIVA 3H7PA 2DC6A 2KMCA 3AB5A 2GNOA 2D2QA 1T0SC 1YJ1A 1KTKA 2REXA 2G8JA 3R8FA 3NG0A 4NAWB 5DPTA 2D11A 2O5RA 4LJ6A 3SFZA 1CJEA 2VRRB 3RVXA 3U6LA 2MJ5B 1YX6B 4XE0A 2C5LC 1L1TA 3V6CA 2N7EA 3OVZA 4C4VA 2E3TA 3EC8A 5FTNA 4LJPB 1HTQA 1E9RA 4AG5A 3SHFA 2M1MA 2INNE 2CHGA 2KVRA 2G45B 3RZWC 4P6GA 1L7YA 1MJDA 3ONSA 2YLMA 4ZHPA 1XQQA 3RULA 2L7IA 4KODA 3P42A 1CB5A 1L6UA 4LFAM 4BKSD 3O1GA 4KHPM 4FJZA 3L25A 3W31A 3PS6A 1WGRA 2KN5A 2DWMA 1HNWM 3URYA 1SXJA 2FH0A 4RGNA 5C1BA 3VRAB 2XSZA 3V6CB 4P6EA 4WWOA 4GDLA 2BPSA 2VDBB 4MGHA 1EF1A 4PYUA 5D3DA 4W9FA 3V62A 4D8IA 1TGUA 1PPOA 2DLBA 2RD0A 4D80A 3LVVA 1F2BA 2V3SA 3TEWA 1TR8A 1YIWA 1IPGA 1E8XA 2FRAA 2IPPB 2JVCA 4B9KA 1ENFA 1JRPA 2LVOA 2VH2A 3EA6A 4PDIA 2LUMA 2YJCA 3HHWA 4HK2A 2J4XA 2G5GX 3GLIE 2J7OA 3AEEB 1IN5A 1QT9A 2KFKA 4BKSA 1AU4A 2LUEA 4AQ7A 2JU6X 4LF5M 3R2TA 3NWLA 1IN8A 2MH8A 5BYQA 1J5EM 3AE9B 4YSZB 1QOLA 1TH2A 2V1UA 1WGGA 2UUBM 2CE7A 2UWQA 3BY4B 4US9A 1PRBA 1WH3A 3S3QA 3IV2A 4IM3A 3F5VA 1YQ4B 3PTFC 1TZOA 2DCCA 4K3CA 2X8AA 4P6VF 2O2VB 2DCBA 3OAWA 3DFZA 4LRSA 2WXMA 3WXEA 2LJ5A 3I01M 2SEBD 3L0WB 3K9OA 3HHZA 3UQAA 1HR0M 3L08A 2WXQA 4UDUC 1GB1A 5IN7A 4P17A 2H89B 3HHAA 3MP9A 1QOAA 3Q6BA 5DPRA 5A24A 2CV0A 4TUWA 1MFWA 2ZM6M 4RMAA 2AWTA 3L10B 8CATA 3TIXA 5FK9C 1TKEA 2MGWA 2AQ1B 4R3DA 2ZEQA 2DAEA 3PT2B 1V1PA 4M0WB 2IO3B 1QOGA 1NV8A 2D10A 4MACA 2BWFA 3HVZA 1OJLA 3S2AA 5A2QS 4B08A 1WXVA 4A6QA 2WXLA 3OWEB 2LNHC 4K81A 3CH3X 4BLCA 2F1GA 1UWXA 1NB3A 3ML9A 3Q2AC 1JQPA 1PUTA 1V5OA 1R4NB 2LHEA 2BYEA 2N0SB 4ZDVA 4DV3M 1X9YA 3VDZA 4GKKM 5KQDA 3ZNGC 4DDID 2G7YA 1OTRA 2DOSA 1J8CA 4RF0A 3OJ4B 5AZHA 5CVMA 4JPSA 4LNKA 3QK0A 3ZC7B 4ARCA 1E10A 3K24A 4LZJA 1EWMA 2NPTB 4OVVA 2Y0QA 4JQWC 5C23A 4WH4A 4GU2A 4BOSC 1IY1A 2PREA 3E21A 3MTNB 2DAFA 1UBIA 1WRIA 1ZDVA 3PXGA 4EEWA 5FR3A 1WXQA 1NPZA 2MQJA 4HVBA 4FHKA 4DHZB 2NQAA 3HGIA 3B74A 1L2NA 2XF3A 4F1IA 1AYWA 2WGSA 4RH6A 3RNFC 1WX8A 1MIRA 1SIJA 3K8UA 4Q2JA 2L09A 1V6EA 2Z8LA 5CVNB 1IBLM 2LVAA 1PJTA 2NVUI 2E01A 1SB3C 1JQ4A 3N9YC 1P7EA 5EF4A 1UGJA 2KWUB 3MHZA 2KAJA 2XLJA 3NZUA 3FTFA 2NBWB 1ORYB 3HWSA 2LVPC 1HUCB 3FTEA 3W1SC 3SATA 4NRWA 4HKQA 2AS8A 5JZEA 3KFUG 2JZ1A 3IAM1 3RNBC 3VTUA 4FJVB 4WWMA 4ACFA 4ZRPA 1Z5AA 2CHXA 2P86A 3X23A 3N1ZC 1NNUC 1Z5SB 3AKZA 2IYDB 2N9KA 4QHSA 5GKNA 1NEKB 3UF8A 4GB9A 4HWYA 3LMMA 2L83A 3GQ5A 1V1PB 1A6RA 3ZLZA 2KNVA 2E03A 3C3EA 4RF1A 4X64M 2KWCA 4B6WA 3R9XB 3SAWA 3Q8AA 4M00A 5EE0A 2OP3A 2KVZA 2AQ3B 3HRDD 2P7UA 1E94E 3VTVA 2D3GA 3DDCB 2GQFA 2A4ZA 5D2MB 2V6ZM 3PZ8A 4IW0A 2VZKB 1YT7A 3CWIA 4L16A 4AUQC 1GVNA 2UU7A 2UUAM 2LEKA 3ZGZA 4GMVA 4MJSB 1EE8A 4IM0A 2KHHA 4PS8A 3N3KA 1YQBA 2BW2A 2AL3A 1K3BB 2Y5BB 5CX3A 4AXMA 4QRXA 2JXXA 3T15A 1WJUA 2ASQA 1QAOA 2XBBC 4G3XB 4ITKA 1J0GA 4JL9A 1AW7A 1K50A 1XO3A 1G6JA 2X38A 2W54A 3E9SA 2I7PA 2Y5CA 4HDOA 3V05A 4HWIB 1WMHB 3PHWA 1N61A 4HEA1 2C7NB 3M0EA 4ICVA 4NZLB 4K1RB 1L4ZB 4JI2M 2L0TA 1FM0D 4LF9M 2PIAA 1OQYA 3R66C 3TRKA 2XEPA 4GRIA 1GO5A 1NENB 2XU3A 4GOCA 4HLQA 2XK5B 2MR9A 4JWUC 4BKGA 2RDHA 1V34A 1CS8A 1RLFA 3N20C 1NI3A 2O6VA 2XU5A 4P1BC 4IUMA 3B08A 2VHFA 2HJ1A 4RFBA 4NSOB 4YY3M 3AE2B 5J94A 1XCQL 1O0EA 4JI5M 1C4AA 1J7BA 5EP3A 1IBXA 2K22A 3GRYA 1T6BX 3M62B 5ITUA 2C0YA 3BC3A 4L6V6 4A9AA 5DPWA 1GPXA 2X4AA 3MHSA 2WZJA 2VZKD 1THEA 3E56A 3AE6B 2YEPB 1JB0F 4P16A 4M0WA 4MDKE 3JSVB 1XEEA 1AIMA 2PJHA 3WAPA 3C19A 3B0AA 3LCVB 2DZLA 5IA7A 3BOWA 2W3RA 2JRHA 1DGHB 1ZAEA 3FTDA 1QKZA 2JX5A 1JMLA 2N4FA 2KTFA 2AX5A 4GDKA 3WAMA 3RT3B 3AV0A 1DGGA 4M8NA 2BDLA 1N6ZA 1GOZA 2K8HA 2BTEA 1DOXA 2QQ8A 5EJCA 4LF6M 2G3QB 2JXNA 1C77A 2V9HA 3H6NA 4KDLB 3P63A 1FFUA 4AKHA 2G1EA 1L2BA 4HPMB 1XF5L 3EHVA 2KQ4X 1DGHA 2QDFA 1ACCA 2XFTA 1PGBA 5IO9A 3ZVVA 1AYUA 2HHNA 4HRSA 1Z5CA 2NTTA 1MN3A 2MHJA 1WFYA 3I04M 5DNYA 3RMKC 1Z2MA 3JVZX 4K7WA 4LF8M 2R9FA 3C9EA 1GLNA 1LM8B 4FIPA 4L23A 1IQPA 1P7FA 4I07A 3AE3B 1K51A 1VEKA 1MHHE 2BS2B 3QX1A 4NNJB 5ITXA 2M60A 3BYTB 4KIKA 4ARIA 2NQDB 2GLSA 2M0AA 4MSQB 2QNJA 3K9MA 1V49A 2JYEA 4XZXA 5L83A 1IXRC 3Q8GA 3AE7B 3C8YA 3ILKA 4K0KM 1E0ZA 3ZTCA 3HK0A 4JI7M 1Y8GA 1CMXB 3HZJA 2HH5A 1IP9A 2KRKA 3NVVA 3HJSA 2QC8A 4N4ZA 2JUOA 3U8ZA 2F5OA 2C96A 4MM3A 1SG9A 1RU3A 1GUAB 3FUUA 3SMSA 2MBQA 3CGWA 4WAAA 1GLOA 1U5IA 2K0BX 1V97A 1ZW7A 4BAXA 2ZTDA 2KKCA 4EKUA 2NTSA 2RMMA 1T0RC 3I3TB 3BZDB 1VZ7A 2EELA 2FCSA 4RKXA 4IUMB 3I5JC 4MZOA 2MW5A 1V9JA 1T5XD 4FADA 4MZSA 8PCHA 3PRZA 2JWUA 4CHTB 2Y0TA 4I6LB 2D7GA 1SGHA 4US8A 1GJSA 3AN1A 4E74A 2ZZPB 3PBHA 1ZOYB 4D82A 1TS2A 3CF2A 3T1HM 3W0LB 2Y20A 1P0RA 4NRVA 1IFYA 2DBYA 2WXNA 1R6BX 5EXPA 3V6EB 5EZSA 1KYIA 2WP9B 3L27A 1JW9D 2WDRB 1Y56A 3L2AA 2NCNA 5T8IA 1PBHA 4TV3A 1ZMVA 4C56C 1NB5A 1E32A 2JZZA 1AUAA 2KDMA 3APFA 4TQ0A 1V81A 3IUTA 4N58A 4X6IA 5D6JB 3KOZE 3LXFA 3GS2A 2FAZA 2K6BA 2Z7JA 1EU3A 1I4QA 1OFIA 4LF7M 3O65B 3OQCA 4BS6A 3J27B 4XZ4A 2DAKA 3RZFA 2EUCA 3A42A 2XU4A 5F02A 3QA8A 3H8BA 2G4DB 2WYQA 3APCA 3ZNHB 2K9DA 2CJOA 2PW9A 3Q8FA 4OZAA 3PRMB 1TDHA 3GCBA 2HHHM 1PQSA 1WIAA 1OAOC 5KHOA 2Y3AA 2WSEF 1WGYA 2YJ9A 1MU5A 1KM7A 2EMSA 2KNBA 2KMAA 3P5XA 3DBRI 2C99A 2Z3XA 5C2TB 5EDSA 1TL9A 1M6DA 2B76B 2GB1A 4FULA 2FRQA 1G4AE 5LMUM 1WWTA 2UUCM 5L95C 4PP2E 2C7MB 2YQZA 1PADA 2QENA 1K3XA 1SF0A 3DVNV 1YN5A 2JA2A 2HWJA 2LWPA 1D5XC 5JH5C 1R4GA 1ZKHA 3UMMA 3QARA 4B0EA 4HL4A 1LO5D 3H4MA 2C7HA 4F2LA 2MJDA 4ZRQA 4LJAA 3VAWA 2K6DB 1PGAA 2BKRB 4ZYNA 5EE3A 3GE8C 4W9EA 3FUVA 1QVRA 3GRRA 3QT4A 3CH2X 4GGQA 3B2FA 1WX9A 5HFYA 2DKLA 1WRDB 5HI1A 2OJRA 2WBFX 3CF6E 2B1NA 4W9JA 3VUWA 3WIMA 4CJ6A 5LXHA 2MRPA 1EWPA 4GUAA 1OIZA 2FCNA 4AG6A 1GECE 5EXSA 1A70A 2G8LA 5JI3E 3A98B 2H5XA 1IWDA 3GB1A 5GMVA 2ZVNA 4AZFA 1Q3BA 5AUIA 2BT6A 4DR2M 1K53A 1OFHA 2N9LA 3GQ3A 2RR9A 1WJ6A 2FTDA 3GPXA 5I4DA 4TQ1A 4JIOU 1RFKA 5BMIA 3QSDA 4EFOA 1I4WA 3T1YM 1JRUA 4NAMA 2M0XA 4X62M 5BYRA 1F2AA 2XZUA 3MK6A 1IBKM 2LRWA 7CATA 2HDEA 2AIMA 4DR6M 3GZNB 4WJQA 3B89A 4BSQA 1UD7A 3KP0E 4RCOA 4KGTA 2F4VM 1Q3CA 3I57A 3C3DA 3U60A 2LMCA 2JWSA 2J7QC 1QF6A 4ZRKA 2QCUA 1V2YA 1L5PA 2D3AA 3JW0X 1TDZA 1FJGM 2KLGA 5EP4A 2VIIA 2NBVB 2LD9A 3W67A 4I04A 2GBMA 2BU3A 2DZJA 3TQSA 1F52A 1ZXHA 4LFCM 1BQIA 4IBDA 1NL6A 3BCNA 3KKUA 1LFDA 2K8BA 1SXJB 4GLSC 1QAMA 3OVXA 2ZBKB 1EFUB 2V4LA 1FRDA 3A33B 4DWFA 2HD5A 3AE1B 4B7HA 1YSYA 3PNVA 4G54A 3VR9B 2BDZA 1JWSD 4B3SM 3SYLA 1XKGA 1QQWA 4Q8HA 1WYWB 2LHDA 2DX5B 4II7A 2AQ2B 2KQ7A 1N78A 3HY5A 1HXYD 4IC7B 9PAPA 5JH3A 3B7NA 5IKCM 1DEUA 4E3CA 3DZDA 2JF5A 1DV0A 1TIFA 4KGRA 4G50A 3H7DA 3HM6X 4DQOC 3KWBX 4YYWA 2AU1A 1QUTA 4JE3B 3AI8A 4HCPB 2OOBB 3TPZA 4AJYB 2ONQA 3HUIA 2CRUA 1Q5WB 2LHCA 3A4SC 1YX5B 1PJIA 3RI7C 1G8PA 1I7HA 4FCWA 4IBJA 4MGZE 1YQ3B 2GOWA 4ASWC 1WZ0A 1SEBD 5EP1A 4N59A 2K5PA 3LJ3A 4G4RA 1Q0WB 3AI5A 3HJ8A 3TEYA 4IJEA 3MTNA 3I4YA 2MX2A 3MJWA 2OQ4A 3U2SC 1NV9A 2KTRA 1L2CA 1Z6TA 3FC4A 3TBLD 2MROB 3IOQA 3GOEA 4N6EB 1D6EC 4XC2A 2KW0A 4CGYB 2WXRA 3LFYA 1FXTB 3WANA 2V1CA 2BS3B 1GCBA 1V1OA 3VUXA 4FBJB 3DHGC 1DYQA 4EIWA 4TMAB 3U5ZB 3GLGA 3U7ZA 1IN7A
chains in the Genus database with same CATH topology
1X37A 2HL7A 4IDIA 1DGBA 1HEZE 1CK1A 4YSXB 2M5ZA 2JZPA 3RFZB 4B7GA 3W9CB 2MEKA 3P4RB 4LJ8A 1R7RA 1HA5A 2ZAOA 4XWTA 3MTVA 4L4UA 1VJKA 2DWNA 5FLXS 2GRIA 1E9SA 4D8BA 5C3JB 3RGSA 3R2IA 4YWGG 1I4PA 1QZMA 1N62A 1KF6B 4KKJA 1I4XA 2VQFM 3T3OA 4LJ9A 2BJVA 1TY0A 1YJIA 1TH4A 1XNQM 2RPVA 1PVJA 2NMQA 3U6DA 2E5LM 3VK8A 1OQRA 3MFGA 3SASA 5ITRA 1LV7A 3GPPA 1VR9A 3AH7A 3PVSA 1R2ZA 2ZANA 3ZH9B 3SHGB 1IY0A 2CFOA 2I7NA 2H88B 3AFHA 4OHJA 2JRIA 1D5MC 4FWHA 1IGDA 3WCQA 4XWWA 2EKIA 4C7YA 1NHWC 2BBCA 2CEAA 2EO2A 2H1RA 3CTWB 3PHUA 3AM9A 3U60B 1YUBA 2L1AA 1ZP0B 2XH9A 1E6EB 1QAQA 1F2RC 2WXGA 4LF4M 4QOSA 1FXAA 5C18A 3ZYYX 4AI6A 5IZ7D 2L32A 4KX6B 1QQRA 1N60A 3KVWA 4IBEA 1SE4A 4BOPA 4IBGA 5BMGA 4IOIE 1ZQ9A 2MJ3A 3NVWA 1JR3D 1RWSA 4D8EA 1TYGB 3TWKA 1W5TA 4BOZA 3NVYA 1PJJA 2DXIA 3I9V1 2ZW0A 4LLGM 4BOSA 5ITYA 1M4VA 3AEBB 2FBWB 4GDLB 1GL7A 1JWBD 2HKJA 4YSYB 1XXHA 3FKEA 3WHLA 1EM7A 3HU2A 2QBYA 3KQ4A 5KQ8A 1C76A 2C9OA 3EIEA 1FRRA 4QHTA 2BTWB 2BNKA 4MGIE 1KFYB 4MB7A 1ZE3D 3M6AA 4AQYM 1KH0A 3BY4A 2PKOA 5G5HA 3LQRA 4A5UA 3NVZA 1YN4A 2ACZB 3J81S 2WNMA 2DWLA 1ESFA 1N34M 4FCVA 5FTJA 4CISA 4WQMA 5KO3A 2FNAA 3EGRA 1L6VA 3KOWE 2QPAA 4XDDA 1FCCC 3NBIA 4FCTA 5HHDG 3ETRA 4W5WA 4FWDA 2J7QA 3FILB 1B9RA 1WGKA 4L78A 1SJED 4NXMM 3THGA 3KWLA 3FD9A 2L6OA 2R4EA 2P5TA 2R61A 2BYTA 3U52E 1Q10A 5FTMA 3B9JA 4QOZC 2DYOA 3SAVA 1MX0A 3U6EA 4X66M 1BMLC 1FXIA 5ITXE 1IGCA 3P4SB 2V4IB 4C80A 3ZQ4A 4M9SA 1BUIC 3OTOM 1PFDA 4WIPA 3I4VA 1CQVA 1FMAD 4TSSA 2F5QA 2PVOD 2A5YB 4WAFA 3SARA 4NJCA 5EE1A 2BJWA 3U5ZA 2N7JA 2BS4B 2ZW1A 4MI7A 1PDXA 4D2KA 1KRHA 5IT9S 2QSDA 2C9CA 3K92A 3AE4B 3R8BA 1KSFX 4OX9M 3ZNHA 2KRUA 1H6UA 1GB4A 3TWLA 1CZPA 1SE2A 1N63A 1OQQA 4EE2A 5H92C 2LFIA 3FUTA 4IBFA 1IXSB 4GH9A 4BOUA 5D7GA 3Q8CA 4HKZE 5E26A 3GP7A 4GITA 3IT6B 4LJ4A 1QOBA 3P1MA 3SFDB 2YNMD 2R62A 3HKPA 2V0GA 1ZPSA 3GLFB 3L28A 1TS5A 3VK7A 2AGAA 2UZJA 2ICIA 4NL4H 5EXTA 2Z4SA 5D3IB 2LWXA 4KLNA 1TH3A 1NYRA 2FE8A 3U6MA 3AOGA 3LVWA 4X65M 4IBKA 1MHXA 1VZ8A 3JR4A 4GIPA 1FEHA 3VQIA 5EXXA 3PNYA 1XMQM 3E4RA 4WW0A 2Q2EB 3LB8C 2D7HA 1QOFA 4G6ZA 1D4BA 2XSZD 2WXHA 1R7SA 5BPVA 1YNTE 1C79A 1C4PA 3IXSA 5LNK1 4YXDB 1XMOM 2QEJC 3B21A 3UZUA 4M9ZA 1JCKB 5LMNM 3D8LA 4DR4M 5AUKA 4CQNA 3K1JA 2WXJA 4ZHOA 1K52A 2F5NA 3V3XA 2ZAMA 1ZXIA 3FTCA 2KACA 1I4HA 3T38A 2WXOA 3LQQA 4LZZA 3B9PA 2NQ8C 2RKOA 4LGYA 2J53A 2YR0A 2YFQA 4IBCA 3RE8A 3HJQA 3BVGA 3VKGA 3ZJUA 4GDKB 3DWGC 4I81A 3PO0A 5BR8M 3BYYB 4GC9A 4JWSC 4MT5A 2PTLA 2R46A 3AEDB 2KMMA 3O13A 3FUWA 3W30A 1G3IA 3PSEA 4MH0E 3AECB 4JX1C 1HZ5A 2ERCA 4QNRA 4HXDB 4L1BA 3MP2A 5H37D 4Z8XA 2D7EA 4R7GA 2J52A 4FD2A 4YHHM 2PVGC 2CUZA 3TE6A 2CJNA 1TS4A 2KA6B 2OPFA 2J7NA 4LFBM 3CF0A 2YEPF 3ZCBB 5BYSA 1UKFA 1N36M 4DXGA 4DUYM 1MI0A 1Z59A 4A8XC 2MH7A 4NOOB 1L0XB 2E6XA 1MVKA 3EUB2 1HZ6A 2FOIC 2DVWB 3J7AS 1HQRD 2WU2B 2R4JA 3U61A 5FSWA 1G59A 2WDQB 4IJFA 2WDVB 3BIID 1XCTL 3WHKA 4MH8A 4LJ7A 3W2DA 3C0RA 4MGKE 2Q5WD 5ITQA 1HT2E 3GPYA 1EWYC 2JQRB 2CU3A 1DO2A 4HROA 1ET9A 4LJ5A 3GLGB 4MM3B 1FNVA 2LGIA 4BOQA 5IWAM 4G4OA 2QP9X 3Q69A 3HHXA 3VDUA 1NHGC 4LTUA 2Y21A 5TSSA 1NSFA 3J80S 4DV0M 3A45A 4OVZB 1XHBA 3BOSA 1K3WA 3SEBA 4PT5A 1VDDA 3J2PB 2C98A 4JI3M 5FKAC 4OZCA 3ABVB 3IG5A 2AHMA 5EP2A 2FFJA 2X49A 5KPTA 3AV8A 3H8HA 4FVMA 2DZOB 4GHAA 1VLBA 4FXCA 3U6PA 3NS1A 4XGIA 4I4LA 1RYJA 1I4GA 3L4PA 1BXTA 2XFSA 4LK0M 3U6SA 2W82A 4NSRA 3KDSE 1NJFA 4PDGA 2WU5B 2BTWA 3TUOA 2UXCM 2M19A 3M7GA 5JXVA 4ZPXA 4KO8A 3BK1A 3IFUA 3KS4A 1L0YB 4C7ZA 2RDGA 2IPKD 1GL6A 2ON8A 3Q8BA 1AWDA 4YTNB 3NRZA 2HCBA 1J7AA 3KW6A 1GAQB 1FFVA 4DV4M 3PT2A 1SBBB 1JR3A 1IN6A 2K9XA 1ET6A 1JWUD 4HJGE 4QNMA 3UJNA 2KEBA 2WLBA 2M56B 2J42A 3QWLA 3UI3A 4RGMA 4G4QA 1F2RI 1FD6A 1TY2A 2V3NA 1PM5A 1FNNA 2QMTA 3B2GA 1IXZA 2QILA 1C78A 3BK2A 3FUXA 1UUPA 1K82A 3AE8B 3L26A 5EZQA 3IAS1 4KKIA 4LY6A 1DOIA 3U6QA 2JSVX 2OHFA 1YN3A 3KS8A 5ITTA 1ZDXA 1VRAB 4ZOHC 4JN6A 3BVMA 1W5SA 2KZUA 2JXTA 4LRTA 1OFFA 3W0FA 5FTLA 2SAKA 3LYYA 2LH0A 4GHLA 2EA0A 3FAHA 3UGJA 3DWMA 3BB7A 3ZJVA 4JXJA 2I38A 4OZBA 2R18A 3HHYA 3FYCA 4S12A 2XNAC 4NXNM 1NVMA 4YTMB 1IBXB 3KLSX 3AMZA 4LG2A 2RGHA 1IN4A 4JYAM 1QLBB 3O65A 2IJ0A 1S3SA 4H2AA 1N75A 4I5SA 3W5UB 3QAUA 3VKHA 3GPUA 4IBIA 2PLPA 4PCZA 3AEFB 1R2YA 3SAUA 3W1SA 4G4NA 2TSSA 2Z4RA 3GLFA 2F5PA 2DWQA 1XWIA 2K47A 3RPFC 3KXEC 3TSSA 5G5GA 4AKGA 3NZ3A 1SXJE 3KP1E 1I94M 3MC0B 3U6CA 3PHXA 3AE5B 2D5GA 5E6JA 1HQYE 1D5ZC 4JI8M 1FNUA 4WURA 3U4EG 2QIEB 1FCLA 3J9CA 1IY2A 2IGHA 1RM6C 3SMPA 5BMHA 3IG8A 1DGFA 4DV1M 1QANA 2KWDA 5FTKA 1C4CA 3SBJA 2WXPA 3MHVC 1T3TA 3P4QB 5DYIA 4BB9A 2KN4A 4RGTA 1AYFA 3I51A 1L8QA 4YTPB 1TKGA 1FO4A 1DGJA 2FUG1 1XXGA 2WXIA 2W55A 4AW4A 2W3SA 1G41A 2LXEA 2UXDM 4REZA 1NYQA 2R65A 4DV2M 4ITQA 3AOEC 1UWMA 3W5VB 2PMVA 5H8YE 4FWGA 5F3WA 5MPOA 4I8OA 1J7CA 2V3PA 1JWMD 1HNZM 1N5XA 2WS3B 2F5SA 2BB6A 2KZSA 1EU4A 1C9FA 1ZUD2 3GO8A 3GLHB 4GKJM 1TKYA 3EIHA 4DXFA 3J7BA 4DV7M 4IIWA 4XDCA 2MJEA 1XNRM 1HQCA 2VQEM 4DR1M 4M9XA 1I4RA 2XGNA 4DR7M 2IDYA 2IGGA 4AS1A 2CHVA 2BB5A 4ZTBA 2WXFA 2HWKA 2Y5PA 4KGSA 3RNVA 3PZ7A 3BVZA 3PFIA 2IGDA 3PRMA 1YE9A 4GC5A 2L52A 2HTME 3NUHB 1YJJA 3T3NA 1SXJD 2JYTA 2CV2A 3L29A 4A90A 1NY6A 1YMHE 3JAMS 1SJHD 2L7HA 2G9HD 1PYWD 3Q8XA 3U6OA 2JTCA 3MJ5A 1JWAD 1HNXM 1SXJC 1E7PB 4YT0B 1JROA 5HG2A 3FILA 1QYRA 1KLGD 2I2YA 2DYMA 3A46A 3HVDA 3D8BA 4A55A 3UK6A 1VDVA 1ROEA 3SFEB 3AEAB 1DKIA 3KOXE 1JQJC 4IP3A 1NY5A 1N5WA 4O1NA 4FW9A 4L15A 1XLOA 3AJIB 2K3UA 1D2NA 3DA1A 2XZFA 3U61B 3TMPA 4B7FA 4B3RM 1KLUD 1HT1E 1XC8A 2INPE 3AL0C 2QJLA 4M0DA 3GLIA 4OU7A 1AN8A 4B0MA 4BBAA 3TWMA 5KPRA 3AEGB 3ZJTA 1TJEA 1F77A 1N33M 3KSJA 1N77A 5GXGB 3GP1A 3TL4X 1T3QA 1PGXA 4PD2A 3K2LA 1N32M 3JR5A 2OEDA 1J09A 4MGYE 3SR6A 3RFWA 4DV5M 3DOAA 1SE3A 4OVZA 1NNJA 1UM8A 3VFDA 3GRUA 3TEXA 2R45A 1FIQA 1QILA 4L8RC 5EQTA 3K8ZA 4AKIA 3GQ4A 1TS3A 5DYGA 2QBYB 4JI4M 1JALA 4J3OD 2GI9A 2CHQA 1XLQA 2K0PA 2XN9C 2DHRA 2DWZB 4GMQA 4RGOS 1Z5BA 1XLNA 1L0VB 4A3VB 1L2DA 3KSXA 4L2YA 3VRBB 4RNAA 1KFVA 1E9MA 4USAA 4DUZM 3C58A 4JV5M 1GKIA 1NJGA 3BWUD 3P4PB 1WSPA 4LGMA 2UU9M 1XXHB 2QZ4A 5EE9A 1IM2A 3GLIB 3BBAA 1NVID 3TEZA 4Z6YA 1J7KA 2LJIA 4OW0A 3GRVA 1SSNA 4D81A 4IKGA 1DOYA 2DZNB 1L4DB 4JI6M 1DO0A 1IBMM 5KPZA 4LCBA 3GLHA 2WXKA 3CIRB 1YZBA 3KWVA 3AOEA 4DR3M 1VZ6A 3HU3A 1EWCA 3HU1A 1Q39A 3SC3A 2C5RA 1V8CA 2Z84A 3Q8EA 4IBBA 2RGOA 5IREB 4ZYSA 1MPEA 3PRPA 3FYDA 3VDPA 2KXEA 1XLPA 3IT4B 1FNWA 1SXTA 4JI1M 1C1KA 1F0ZA 2WQYB 5JI2E 3VLFB 4DR5M 2UXBM 4B3MM 4DV6M 1IUEA 3SYKA 4JI0M 4B3TM 1L1ZA 3KOYE 1B1ZA 1STEA 3RGPA 3VR8B 1WYGA 2CV1A 4XBOA 1UNSA 3AB5A 1KTKA 3R8FA 4NAWB 2O5RA 4LJ6A 3SFZA 1CJEA 3U6LA 4XE0A 1L1TA 2E3TA 5FTNA 1E9RA 4AG5A 3SHFA 2INNE 2CHGA 4ZHPA 2L7IA 4KODA 3P42A 1L6UA 4LFAM 4KHPM 3W31A 3L25A 2DWMA 1HNWM 3URYA 1SXJA 4RGNA 5C1BA 3VRAB 2XSZA 4MGHA 5D3DA 4D8IA 1TGUA 2DLBA 4D80A 3LVVA 3TEWA 1ENFA 1JRPA 3EA6A 4PDIA 2LUMA 3HHWA 2J4XA 2G5GX 2J7OA 3AEEB 1IN5A 1QT9A 4AQ7A 2JU6X 4LF5M 3R2TA 3NWLA 1IN8A 5BYQA 1J5EM 3AE9B 4YSZB 1TH2A 2V1UA 2UUBM 2CE7A 4US9A 1YQ4B 1TZOA 2X8AA 4P6VF 3DFZA 4LRSA 2WXMA 2SEBD 3HHZA 1HR0M 4UDUC 2WXQA 1GB1A 2H89B 3MP9A 1QOAA 2CV0A 4TUWA 2ZM6M 8CATA 5FK9C 1TKEA 2AQ1B 4R3DA 1V1PA 1QOGA 4MACA 3HVZA 1OJLA 5A2QS 4B08A 4A6QA 2WXLA 3OWEB 2LNHC 4BLCA 1UWXA 1PUTA 2LHEA 2N0SB 4DV3M 4GKKM 5KQDA 2DOSA 4RF0A 4JPSA 3ZC7B 4ARCA 1E10A 4LZJA 2Y0QA 4WH4A 1IY1A 1WRIA 1ZDVA 3PXGA 5FR3A 1WXQA 3HGIA 2XF3A 4RH6A 1SIJA 4Q2JA 2L09A 2Z8LA 1IBLM 1SB3C 1JQ4A 3N9YC 1P7EA 1UGJA 3MHZA 2KAJA 2XLJA 3FTFA 1ORYB 3HWSA 3FTEA 3SATA 4NRWA 4HKQA 5JZEA 3KFUG 3IAM1 4WWMA 4ZRPA 1Z5AA 1NNUC 3AKZA 2N9KA 4QHSA 5GKNA 1NEKB 3LMMA 2L83A 3GQ5A 1V1PB 4RF1A 4X64M 3R9XB 3SAWA 3Q8AA 5EE0A 2AQ3B 3HRDD 1E94E 2V6ZM 3PZ8A 2VZKB 3CWIA 4L16A 1GVNA 2UUAM 2LEKA 3ZGZA 1EE8A 2BW2A 3T15A 4ITKA 1QAOA 1AW7A 1K50A 1XO3A 2X38A 2W54A 3E9SA 2I7PA 2Y5CA 3V05A 3PHWA 1N61A 4HEA1 3M0EA 4NZLB 1L4ZB 4JI2M 1FM0D 4LF9M 2PIAA 3TRKA 2XEPA 4GRIA 1NENB 4HLQA 4JWUC 2RDHA 1NI3A 4IUMA 4RFBA 4NSOB 4YY3M 3AE2B 1XCQL 4JI5M 1C4AA 1J7BA 5EP3A 1IBXA 2K22A 3GRYA 1T6BX 5ITUA 4A9AA 1GPXA 2X4AA 2VZKD 3E56A 3AE6B 2YEPB 4P16A 4M0WA 1XEEA 2W3RA 1DGHB 1ZAEA 3FTDA 1QKZA 2JX5A 1JMLA 2AX5A 3AV0A 1DGGA 1GOZA 2BTEA 1DOXA 5EJCA 4LF6M 1C77A 3P63A 1FFUA 4AKHA 2G1EA 1L2BA 1XF5L 2KQ4X 1DGHA 1ACCA 2XFTA 1PGBA 4HRSA 1Z5CA 2NTTA 5DNYA 4LF8M 1GLNA 4L23A 1IQPA 1P7FA 3AE3B 1K51A 1MHHE 2BS2B 4ARIA 5ITXA 2M60A 3BYTB 2M0AA 2JYEA 4XZXA 1IXRC 3AE7B 3C8YA 3ILKA 4K0KM 1E0ZA 4JI7M 2KRKA 3NVVA 3HJSA 2F5OA 2C96A 3FUUA 3SMSA 1V97A 2NTSA 2RMMA 3BZDB 1VZ7A 2EELA 4RKXA 1T5XD 2JWUA 4CHTB 2Y0TA 2D7GA 4US8A 3AN1A 1ZOYB 4D82A 1TS2A 3CF2A 3T1HM 3W0LB 2Y20A 2DBYA 4NRVA 2WXNA 5EZSA 1R6BX 5EXPA 1KYIA 2WP9B 3L27A 1JW9D 2WDRB 1Y56A 3L2AA 5T8IA 4C56C 1E32A 2KDMA 4TQ0A 4N58A 3KOZE 3LXFA 3GS2A 2Z7JA 1EU3A 1I4QA 1OFIA 4LF7M 3OQCA 3J27B 2EUCA 3A42A 2CJOA 2PW9A 3Q8FA 4OZAA 1TDHA 2HHHM 2Y3AA 1MU5A 2C99A 2Z3XA 5C2TB 2B76B 2GB1A 1G4AE 5LMUM 1WWTA 2UUCM 2YQZA 2QENA 1K3XA 1SF0A 2JA2A 1YN5A 1D5XC 3UMMA 4B0EA 4HL4A 1LO5D 3H4MA 2MJDA 4ZRQA 4LJAA 1PGAA 5EE3A 3FUVA 1QVRA 3GRRA 3B2FA 5HFYA 5HI1A 3CF6E 4GUAA 4AG6A 5EXSA 1A70A 2G8LA 5JI3E 3A98B 3GB1A 5AUIA 4AZFA 1Q3BA 2BT6A 4DR2M 1K53A 1OFHA 2N9LA 3GQ3A 3GPXA 5I4DA 4TQ1A 5BMIA 1RFKA 1I4WA 3T1YM 4NAMA 4X62M 5BYRA 2XZUA 3MK6A 1IBKM 7CATA 2HDEA 4DR6M 3KP0E 4RCOA 4KGTA 2F4VM 1Q3CA 3I57A 3U60A 2LMCA 2J7QC 1QF6A 2QCUA 1L5PA 1TDZA 1FJGM 5EP4A 2VIIA 2BU3A 3TQSA 1ZXHA 4LFCM 4IBDA 1SXJB 4GLSC 1QAMA 2ZBKB 1FRDA 3AE1B 4B7HA 1YSYA 3PNVA 3VR9B 1JWSD 4B3SM 3SYLA 1QQWA 2LHDA 4II7A 2AQ2B 1N78A 1HXYD 3DZDA 4KGRA 4DQOC 4JE3B 3TPZA 2ONQA 3HUIA 1PJIA 1G8PA 1I7HA 4FCWA 4IBJA 4MGZE 1YQ3B 1SEBD 5EP1A 4N59A 2K5PA 4G4RA 3HJ8A 3TEYA 4IJEA 3I4YA 2OQ4A 3U2SC 1L2CA 1Z6TA 3FC4A 4N6EB 1D6EC 2KW0A 4CGYB 2WXRA 2V1CA 2BS3B 1V1OA 1DYQA 4EIWA 4TMAB 3U5ZB 3GLGA 3U7ZA 1IN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVZ B;  3MJ5 A;  4P16 A;  4REZ A;  4M0W A;  4WUR A;  3MP2 A;  4RNA A;  4RF1 A;  4RF0 A;  5KO3 A;  3E9S A;  4PT5 A;  4OW0 A;  4R3D A;  5E6J A;  4MM3 B;  4OVZ A;  2FE8 A; 
#chains in the Genus database with same CATH topology
 1AYV A;  1X37 A;  4FN2 A;  2HL7 A;  4CDD B;  2R9O A;  4IDI A;  3DVN U;  1DGB A;  1CQD A;  1HEZ E;  2JY5 A;  1CK1 A;  3T6P A;  4YSX B;  5CHV A;  2M5Z A;  2JZP A;  3H89 A;  3RFZ B;  4B7G A;  3OJ3 A;  2A5U A;  2MEK A;  3W9C B;  1EWL A;  3ZDM C;  4K7C A;  4II2 B;  3P4R B;  4LJ8 A;  3N32 A;  2P0R A;  2ZNV B;  3OIS A;  1R7R A;  1HA5 A;  2ZAO A;  1IYF A;  4XWT A;  4Q7J A;  3MTV A;  4L4U A;  2DEN A;  4QRG A;  3QWZ B;  1VJK A;  2DWN A;  5FLX S;  3VH4 B;  2GRI A;  1E9S A;  1KHP A;  3HM3 A;  5C3J B;  3RGS A;  3R2I A;  4YWG G;  1I4P A;  1QZM A;  1N62 A;  1KF6 B;  4KKJ A;  2D3B A;  2IY1 B;  3PHX B;  2BWE S;  4LDT B;  2DC8 A;  1I4X A;  3VVW B;  1NO1 A;  1PIP A;  3HWN A;  2VQF M;  3T3O A;  4LJ9 A;  2BJV A;  1TY0 A;  1YJI A;  1TH4 A;  1XNQ M;  2RPV A;  3PZD A;  1PVJ A;  2JWZ A;  2NMQ A;  3U6D A;  3KYD D;  2E5L M;  2N7D A;  1AU3 A;  2AUX A;  3VK8 A;  2LXC A;  3SDL C;  4S0R A;  1OQR A;  3MFG A;  3SAS A;  3KH0 A;  2Y5B A;  5ITR A;  1LV7 A;  3GPP A;  4BPV A;  1VR9 A;  1XT9 B;  2LRU A;  3AH7 A;  2BQQ A;  3PVS A;  1R2Z A;  2KJR A;  2ZAN A;  3ZH9 B;  3SHG B;  2OOB A;  1IY0 A;  2CFO A;  2I7N A;  2H88 B;  3N4C A;  3AFH A;  4OHJ A;  2JRI A;  1D5M C;  4FWH A;  1IGD A;  3WCQ A;  4XWW A;  2EKI A;  3PVL A;  4C7Y A;  3N30 A;  1NHW C;  2BBC A;  1ZGU B;  2CEA A;  2EO2 A;  2H1R A;  1TZ1 A;  4EZK A;  3CTW B;  3PHU A;  5DFL A;  4WJP A;  3AM9 A;  3U60 B;  1YUB A;  2K1F A;  2L1A A;  4EZJ A;  1ZP0 B;  2XH9 A;  1E6E B;  3D6S A;  3HHI A;  1QAQ A;  4KDI C;  1F2R C;  2WXG A;  4LF4 M;  4QOS A;  1FXA A;  3H1U A;  5C18 A;  1A5R A;  1FPY A;  3ZYY X;  4AI6 A;  5IZ7 D;  3UGB B;  2MCN B;  2L32 A;  1GC7 A;  2EKE C;  3ZRC A;  2FCQ A;  2JZ3 B;  4KX6 B;  1QQR A;  2R2O A;  3NHE A;  1N60 A;  2LVQ D;  1PCI A;  3KVW A;  3B1L X;  4IBE A;  1SE4 A;  2O6X A;  4BOP A;  4IBG A;  1ISN A;  4GIV A;  5BMG A;  4G0N B;  2F7D A;  2KNA A;  5BO4 B;  2IO2 B;  4IOI E;  1BT0 A;  1ZQ9 A;  3AXC A;  2MJ3 A;  3NVW A;  2GFO A;  1RWS A;  1JR3 D;  1NLJ A;  1TYG B;  3TWK A;  1GG3 A;  1ZV1 A;  4D8E A;  4PI3 A;  1W5T A;  4BOZ A;  1CPJ A;  3NVY A;  3FE3 A;  1PJJ A;  1E7V A;  2DXI A;  1U9W A;  2FO5 A;  1KFX L;  4D8B A;  3I9V 1;  3NHE B;  2ZW0 A;  4LLG M;  5J2R A;  4BOS A;  5ITY A;  2DC7 A;  2GBJ A;  1M4V A;  3AEB B;  2FBW B;  4GDL B;  1GL7 A;  2DAI A;  4W9G A;  4XX5 A;  1JWB D;  3GLH E;  3E46 A;  4FK5 A;  2HKJ A;  3KVF B;  4YSY B;  1XXH A;  3FKE A;  2L8J A;  3WHL A;  2NR2 A;  4I6N B;  1EM7 A;  3HU2 A;  2QBY A;  1H8C A;  3KQ4 A;  3NOB A;  5KQ8 A;  1C76 A;  5E6N A;  4AOF A;  1OTR B;  3L16 A;  4LJO B;  3A9J B;  2EJS A;  2C9O A;  1D0M A;  3EIE A;  1R5L A;  4QHT A;  1FRR A;  2QHO A;  1DF0 A;  2BTW B;  2BNK A;  4MGI E;  3VTW A;  1KFY B;  1WI0 A;  4MB7 A;  1ZE3 D;  3M6A A;  2KK8 A;  2GHU A;  4AQY M;  1KH0 A;  4MEM A;  3BY4 A;  2PKO A;  5G5H A;  3LQR A;  4A5U A;  2MBH A;  3NVZ A;  1YN4 A;  2ACZ B;  3J81 S;  2WNM A;  4A3P A;  2DWL A;  1WX7 A;  4P7I A;  1ESF A;  2DZZ A;  1N34 M;  4CDC B;  4FCV A;  2LVP A;  2MLB A;  5FTJ A;  4CIS A;  5KHQ A;  4WQM A;  5KO3 A;  2FNA A;  3EGR A;  3DBH I;  4DMY A;  1A5T A;  5PAD A;  4DBG B;  1L6V A;  3KOW E;  2QPA A;  4XDD A;  1FCC C;  3NBI A;  4FCT A;  2FT2 A;  5HHD G;  3ETR A;  4W5W A;  3N1X C;  2LAS A;  4MSX A;  2WSC F;  4FWD A;  2J7Q A;  3FIL B;  2CR5 A;  1B9R A;  1WGK A;  4L78 A;  1SJE D;  2JT4 B;  3M63 B;  4XUI A;  3S3R A;  3L54 A;  3PRE A;  4NXM M;  5JHB A;  3THG A;  3KWL A;  3FD9 A;  3GZN I;  3OLM D;  1AAR A;  4ANX A;  2L6O A;  2R4E A;  2O01 F;  2P5T A;  2R61 A;  2BYT A;  3U52 E;  1Q10 A;  5FTM A;  3B9J A;  3I06 A;  2Z0E B;  4QOZ C;  2DYO A;  2ZCC A;  3SAV A;  3U7D A;  2PNS A;  1MX0 A;  3U6E A;  4X66 M;  1E7U A;  2G3Q A;  1NDD A;  2QCZ A;  4BQV A;  1BML C;  1FXI A;  4DHJ D;  5ITX E;  1IGC A;  3P4S B;  2V4I B;  4C80 A;  1C3T A;  5LLI A;  2LHG A;  3MC8 A;  4I6P A;  1I42 A;  2APL A;  4NQK E;  3SU8 X;  3ZQ4 A;  1V80 A;  4ZUX U;  4QAY A;  4M9S A;  3KUC B;  2L00 B;  1BUI C;  3OTO M;  3ALB A;  1PFD A;  3IEC A;  4WIP A;  3AU4 A;  3I4V A;  1CQV A;  1FMA D;  1VCB A;  4TSS A;  1WR1 B;  2F5Q A;  1R4N I;  2CB5 A;  2PVO D;  4YV8 A;  4JLC A;  2KX3 A;  2DCA A;  2UYZ B;  2VF8 A;  2L3Z A;  2A5Y B;  1I35 A;  3L17 A;  4WAF A;  3KUZ A;  2DAG A;  3SAR A;  4NJC A;  5EE1 A;  3ZW3 A;  2YJ8 A;  2K8C A;  2BJW A;  3U5Z A;  4NC6 A;  2N7J A;  2BS4 B;  2JY7 A;  2ZW1 A;  4FJC A;  4MI7 A;  2JY6 A;  1PDX A;  4WWN A;  4D2K A;  1KRH A;  1WR6 E;  4BBN C;  5IT9 S;  2QSD A;  2KDL A;  2C9C A;  3K92 A;  3AE4 B;  3R8B A;  3K9O B;  1KSF X;  3OG5 A;  2JY8 A;  4OX9 M;  1GAB A;  2KRU A;  1H6U A;  4HPP A;  1GB4 A;  3ZNH A;  2D3C A;  3ZIM A;  1OEY J;  4W9L A;  3TWL A;  3P5V A;  1CZP A;  1SE2 A;  1N63 A;  4EOY A;  1OQQ A;  1F9J A;  4EE2 A;  4YYV A;  5H92 C;  1VEG A;  2LVN C;  1WJN A;  2LFI A;  2HTH A;  3FUT A;  2IBI B;  3EEC A;  2DCD A;  4IBF A;  1IXS B;  4GH9 A;  4DHZ E;  4M01 A;  3RNC C;  3DVG Y;  4BOU A;  5D7G A;  3Q8C A;  4HKZ E;  5E26 A;  3GP7 A;  3KUD B;  2INC C;  4GIT A;  1RFA A;  3IT6 B;  4NJ6 A;  1QDT A;  4LJ4 A;  1QOB A;  2K25 A;  3N1Y C;  3P1M A;  3SFD B;  2YNM D;  2R62 A;  3HKP A;  3ML8 A;  4B95 A;  1ZPS A;  2V0G A;  3GLF B;  3L28 A;  1TS5 A;  3VK7 A;  2AGA A;  2UZJ A;  2ICI A;  4NL4 H;  4F7Z A;  2FCM A;  5EXT A;  2Z4S A;  5D3I B;  2R0I A;  2LWX A;  4KLN A;  1TH3 A;  1GC6 A;  1NYR A;  4PS3 A;  2DNF A;  3C9P A;  2FE8 A;  3OF8 A;  3U6M A;  3BIN A;  2DZY A;  3AOG A;  2WDT B;  3P5U A;  2NPT A;  4K7U A;  3LVW A;  3NBX X;  4X65 M;  1PPP A;  4W5C A;  2AYO A;  4OEM A;  2KC1 A;  4IBK A;  1MHX A;  1VZ8 A;  3JR4 A;  4GIP A;  1FEH A;  3VQI A;  1J19 A;  3PSE B;  3DBS A;  1WHC A;  5EXX A;  1ME3 A;  3PNY A;  5FPW A;  2CHW A;  1XMQ M;  3E4R A;  4WW0 A;  2N1W A;  5IAA C;  2Q2E B;  4W9I A;  3QIJ A;  2ARY A;  1WM2 A;  4HXD A;  3LB8 C;  3IVF A;  1QDR A;  2D7H A;  1QOF A;  4QBB A;  4G6Z A;  1D4B A;  2XSZ D;  1P98 A;  2WXH A;  1R7S A;  5BPV A;  1YNT E;  1C79 A;  4XYC A;  1C4P A;  3IXS A;  3QYE A;  3EFU A;  5LNK 1;  4YXD B;  1AIP C;  3ECI A;  3HD3 A;  2L7R A;  1XMO M;  2QEJ C;  2Z0D B;  1T43 A;  3UZU A;  3B21 A;  4M9Z A;  5HKH A;  2ZCB A;  1JCK B;  4BFR A;  2E02 A;  1ZCM A;  4K3B A;  2JY6 B;  4GEW A;  3LW5 F;  5LMN M;  3D8L A;  4DR4 M;  2MBB B;  5AUK A;  3WAL A;  4CQN A;  1BP4 A;  1OIP A;  3K1J A;  4J6I A;  2H7J A;  2WXJ A;  4ANR A;  4ZHO A;  4IWO A;  1GJT A;  1K52 A;  2O6V D;  3NJT A;  4NAW A;  1FH0 A;  2BVC A;  3DQV A;  4RY2 A;  2F5N A;  3V3X A;  1KJT A;  3ZNZ B;  2ZAM A;  1ZXI A;  3KW9 A;  2N9P C;  3FTC A;  1V86 A;  3Q3M C;  2KAC A;  1I4H A;  3T38 A;  2WXO A;  2KQS A;  1SP4 B;  2DZK A;  4C00 A;  3LQQ A;  3CST A;  4LZZ A;  3B9P A;  2NQ8 C;  2RKO A;  4LGY A;  2J53 A;  2DC9 A;  2YR0 A;  2YFQ A;  4IBC A;  1PJS A;  1WGN A;  3RE8 A;  1XD3 B;  2RGF A;  4W5B A;  4TUU A;  3PLU A;  4P1C C;  1YK8 A;  2R9C A;  1XXH E;  2CWB A;  3HJQ A;  3BVG A;  3VKG A;  3ZJU A;  4GDK B;  3DWG C;  2AVW A;  1YD8 U;  4I81 A;  2J5Y A;  1D3Z A;  4GXB A;  7PCK A;  3TL5 A;  3PO0 A;  3KSE A;  3USV A;  5BR8 M;  3BYY B;  2DZM A;  4GC9 A;  4JWS C;  4MT5 A;  2PTL A;  2R46 A;  3AED B;  2KMM A;  3O13 A;  3FUW A;  4IWQ A;  3W30 A;  1G3I A;  1MEM A;  3PSE A;  1S1Q B;  4MH0 E;  2ATO A;  3AEC B;  5CVO B;  4KVG B;  4JX1 C;  3V61 A;  1HZ5 A;  1VJV A;  2R9M A;  3BXW A;  4YYS A;  2ERC A;  2WHI A;  4PK1 A;  2DI0 A;  3QYB A;  4QNR A;  4HXD B;  3PLV A;  2WX1 A;  4L1B A;  2XK5 A;  3LCU A;  3MC9 A;  3PDF A;  3MP2 A;  5H37 D;  1WGL A;  2ZTC A;  4Z8X A;  2R6N A;  1EUV B;  1U9X A;  1U4A A;  2O6V B;  1P9D U;  2D7E A;  4R7G A;  1RAX A;  2J52 A;  2DNA A;  4FD2 A;  2FQ9 A;  4YHH M;  2PVG C;  2CUZ A;  3IHP C;  4ANU A;  3TE6 A;  4X6J A;  4LNO A;  1YAL A;  2JNH A;  2CJN A;  2KZR A;  3MHS D;  3CSF A;  3OF9 A;  1TS4 A;  2KA6 B;  4YL8 A;  1CVZ A;  2M17 A;  2OPF A;  2J7N A;  4LFB M;  3DVG X;  3CF0 A;  2YEP F;  3ZCB B;  5BYS A;  1UKF A;  2E00 A;  1N36 M;  3PV1 A;  4DXG A;  2LXA A;  4DUY M;  4IM2 A;  1MI0 A;  2LI5 A;  1Z59 A;  4XK8 F;  3PPA A;  5AZG A;  3SD5 A;  4A8X C;  5E6O A;  2MH7 A;  4NOO B;  3FKY A;  2R6F A;  1ZMW A;  1L0X B;  5JA7 A;  2E6X A;  3F92 A;  1MVK A;  3EUB 2;  1KHQ A;  5CHT A;  1HZ6 A;  2FOI C;  2DVW B;  3J7A S;  1HQR D;  2LZ6 A;  3R7Q A;  3WXG A;  1VDL A;  2WU2 B;  2K39 A;  4Y28 F;  2R4J A;  3PW3 A;  1CTE A;  3U61 A;  5E6P A;  5FSW A;  2KAN A;  2PE6 B;  3CBK A;  1G59 A;  2WDQ B;  1C7Y A;  1Y8R C;  4IJF A;  3X0W A;  2WDV B;  3L13 A;  5CHW A;  3BII D;  5G55 A;  1XCT L;  3WHK A;  4JGH B;  4MH8 A;  4LJ7 A;  3W2D A;  1E90 A;  3C0R A;  4MGK E;  1E8Z A;  2BWB A;  2KNZ A;  2Q5W D;  2NQI A;  5AZF A;  5ITQ A;  3Q14 C;  2B3T A;  1HT2 E;  1VEJ A;  2KWV B;  3R3M A;  4HCN B;  1WXA A;  3GPY A;  1EWY C;  2JQR B;  2CU3 A;  1DO2 A;  2OJW A;  2RPQ A;  1BGO A;  4HRO A;  1ET9 A;  3RNA C;  4X57 B;  3JYU A;  1ZMU A;  4LJ5 A;  4MM3 B;  3GLG B;  1FNV A;  2BGF A;  3FRH A;  1WXM A;  2LGI A;  3IG3 A;  4BOQ A;  5IWA M;  4G4O A;  3E1Z B;  1TT5 B;  2QP9 X;  3Q69 A;  3TJP A;  2VHS A;  3HHX A;  2M4N A;  3VDU A;  1NHG C;  1WMH A;  3PHW B;  4UN2 B;  3GE3 C;  4LTU A;  4AWJ A;  4URK A;  3DHI C;  1QMY A;  3VUY A;  1AU2 A;  2Y21 A;  3A4R A;  1P3Q Q;  3HX3 A;  5TSS A;  1NSF A;  1K8R B;  1WZ3 A;  3J80 S;  4DV0 M;  3A45 A;  1QZE A;  1SIF A;  4OVZ B;  4YYU A;  1XHB A;  3BOS A;  1K3W A;  2R44 A;  3SEB A;  1UH6 A;  2ZNV C;  4PT5 A;  1VDD A;  3J2P B;  2C98 A;  2B1M A;  3U30 A;  4JI3 M;  2KO3 A;  3VXW A;  1OEY A;  4I05 A;  5FKA C;  2J0J A;  3D32 A;  4G11 A;  3ZO5 B;  2B3A A;  4OZC A;  1UZX B;  4Q8G A;  3ABV B;  2L05 A;  3IG5 A;  3M99 A;  3V76 A;  1AEC A;  2AHM A;  3DBH B;  5EP2 A;  1X1M A;  2ZPY A;  3W68 A;  2FFJ A;  2X49 A;  1CJL A;  5KPT A;  3AV8 A;  3H8H A;  4FVM A;  2DZO B;  4ANW A;  2BYF A;  4GHA A;  1Q1O A;  1VLB A;  4BS5 A;  1WM3 A;  5LXI B;  4FXC A;  2JUJ A;  2LGS A;  3U6P A;  3NY5 A;  1VQ1 A;  4ZRJ A;  1WY8 A;  3MHH A;  2Z59 B;  3Q3J A;  2AUZ A;  3NS1 A;  1Q02 A;  4QRV A;  3EFC A;  2MBE A;  3VH3 B;  4XGI A;  4WJO A;  2FNJ B;  3PRP B;  4I4L A;  1UBQ A;  1RYJ A;  2JRI B;  1I4G A;  3CMM B;  2VF7 A;  3L4P A;  3C0R B;  1BXT A;  4F8C B;  4DK5 A;  2DAJ A;  2XFS A;  2LVO C;  4LK0 M;  1STF E;  1CV8 A;  3U6S A;  2W82 A;  3QJZ A;  4NSR A;  1Y08 A;  3KDS E;  1NJF A;  4PDG A;  3KYC D;  2BF8 B;  4N9F 4;  2WU5 B;  2BTW A;  4LNN A;  4TKN A;  2UXC M;  2J0M A;  3M7G A;  2M19 A;  3TUO A;  5JXV A;  4ZPX A;  4FLH A;  4KO8 A;  3BK1 A;  3IFU A;  3KS4 A;  3CBJ A;  4AJW A;  1L0Y B;  4C7Z A;  4EUT A;  2RDG A;  2IPK D;  1GL6 A;  2ON8 A;  1MG8 A;  3Q8B A;  1JR3 E;  1ATK A;  1AWD A;  1D0K A;  2XEW A;  4YTN B;  3H7S A;  3RYT A;  3NRZ A;  1QDQ A;  4EZL A;  5CHV C;  2HCB A;  1J7A A;  3KW6 A;  1GAQ B;  1FFV A;  5CHF A;  2N9X A;  1WGD A;  4DV4 M;  2MBO A;  2L4F A;  3PT2 A;  2HXZ A;  2OUL A;  3VHT C;  1SE9 A;  1SBB B;  1JR3 A;  3MMP A;  1IN6 A;  3U8E A;  4KIK B;  2K9X A;  4BVU C;  1ET6 A;  1JWU D;  4HJG E;  2MSE D;  4QNM A;  2PEA A;  1YLA A;  3UJN A;  2KEB A;  2WLB A;  4II3 B;  2M56 B;  4E71 A;  2J42 A;  3QWL A;  3KFQ A;  2AYN A;  2ACT A;  2XU1 A;  3UI3 A;  4RGM A;  4G4Q A;  1HE8 A;  1R4M I;  2YJB A;  1F2R I;  1FD6 A;  1TY2 A;  3LDZ E;  3ZTD A;  2V3N A;  1PM5 A;  1FNN A;  3QQ8 B;  2QMT A;  3NS8 A;  3B2G A;  2HD5 B;  1IXZ A;  2QIL A;  1C78 A;  2CIO A;  1V92 A;  3FUX A;  3BK2 A;  1UUP A;  3ZKJ C;  1K82 A;  3AE8 B;  1P3Q U;  3L26 A;  3DHH C;  5EZQ A;  1UFZ A;  2GBN A;  2DZI A;  3IAS 1;  4KKI A;  4A20 A;  4BBN F;  2YVC A;  4LY6 A;  3BBZ A;  1DOI A;  2NQG A;  3Q3N C;  2KLC A;  3P5W A;  3U6Q A;  2L4E A;  4LCD E;  2JSV X;  2G8E A;  4PAD A;  3H8C A;  1LTM A;  1TGZ B;  2OHF A;  3RD2 A;  1YN3 A;  3KS8 A;  5ITT A;  1ZDX A;  1VRA B;  3WXF A;  2KJH B;  1LXD A;  2KX0 A;  2KOX A;  4ZOH C;  4JN6 A;  1OKS A;  2DAM A;  3BVM A;  3K9P A;  2VH1 A;  3BPM A;  1W5S A;  1OGW A;  1WE6 A;  2KZU A;  3UQB A;  2JXT A;  4CDE B;  4LRT A;  1OFF A;  1NBF C;  4OEL A;  3W0F A;  4F1S A;  5FTL A;  2SAK A;  3LYY A;  2R9N A;  2LH0 A;  4GHL A;  2HE7 A;  2EA0 A;  3FAH A;  3HHM A;  3UGJ A;  3DWM A;  3DBL B;  5J17 A;  3BB7 A;  3ZJV A;  4JXJ A;  2I38 A;  4OZB A;  2R18 A;  3HHY A;  3FYC A;  4S12 A;  2XNA C;  3H7P B;  4NXN M;  2CU1 A;  1NVM A;  2GMI C;  4YTM B;  1IBX B;  3KLS X;  2DHZ A;  4LG2 A;  3AMZ A;  4RM8 A;  4C4V B;  2RGH A;  1IN4 A;  4JYA M;  3ZQJ A;  1QLB B;  3IBE A;  4DDG D;  3O65 A;  2IJ0 A;  1S3S A;  2MA9 B;  4H2A A;  1N75 A;  4CO7 A;  4I5S A;  4R71 A;  3W5U B;  3QAU A;  3VKH A;  3B7Z A;  3GPU A;  1WE7 A;  4M02 A;  2IO0 B;  1VSN A;  4IBI A;  2PLP A;  4YVA A;  4PCZ A;  3AEF B;  1R2Y A;  2X8X X;  3PGE A;  2IBI A;  3SAU A;  2I1J A;  3W1S A;  4G4N A;  4CIZ A;  3ENE A;  1D0L A;  1WJ4 A;  2TSS A;  3QAQ A;  2Z4R A;  4HEO A;  3GLF A;  3JSV A;  2F5P A;  2JZ0 A;  4MJS A;  2DWQ A;  1XWI A;  1ZIV A;  2K47 A;  5DPS A;  3RPF C;  3B79 A;  4CDF B;  1S4V A;  3H9D A;  3KXE C;  3TSS A;  5G5G A;  4AKG A;  3NZ3 A;  1SXJ E;  1LGR A;  3KP1 E;  1I94 M;  3MC0 B;  5IOI A;  3U6C A;  1WGH A;  3M3J A;  3H4J A;  1V5T A;  3BPF A;  3PHX A;  3AE5 B;  2CKH B;  2D5G A;  4KSK C;  5E6J A;  1PXV A;  2FYE A;  1HQY E;  1D5Z C;  4JI8 M;  1FNU A;  2KD0 A;  3TMP B;  4WUR A;  3U4E G;  1UEL A;  2QIE B;  1FCL A;  3J9C A;  1IY2 A;  2NS5 A;  1EWO A;  3H6S A;  1F2C A;  2JQG R;  2IGH A;  3PNR A;  1RM6 C;  3DOW A;  3SMP A;  5BMH A;  2I1K A;  3IG8 A;  2NBU A;  1DGF A;  4DV1 M;  1QAN A;  1NI2 A;  1E8W A;  2KWD A;  5FTK A;  1C4C A;  3P2B A;  3SBJ A;  2LTU A;  3MHV C;  2WXP A;  4YYR A;  4LNF A;  1T3T A;  3P4Q B;  5DYI A;  4BB9 A;  4KLB A;  3QHT A;  2KN4 A;  4RGT A;  4N79 A;  1AYF A;  3I51 A;  1L8Q A;  3VFK A;  3ZXV A;  4K7S A;  2R2Q A;  2IO1 B;  1V33 A;  1EIJ A;  1CUK A;  4YTP B;  2IY0 B;  1TKG A;  4RKU F;  1FO4 A;  1CSB B;  4X6H A;  1DGJ A;  2FUG 1;  1XXG A;  2WXI A;  2W55 A;  1KFU L;  4AW4 A;  2W3S A;  1G41 A;  2DEN B;  2LXE A;  2UXD M;  2KDB A;  4REZ A;  1NYQ A;  4WA6 A;  3ZRF A;  4A3O A;  2R65 A;  4DV2 M;  4ITQ A;  4PP1 A;  3AOE C;  1YOV B;  1F1H A;  1PE6 A;  1UWM A;  3W5V B;  1ITO A;  2PMV A;  4FA6 A;  5H8Y E;  1POP A;  4FWG A;  5F3W A;  1UGM A;  2KJ6 A;  5MPO A;  2C9W B;  1T0Y A;  1XB2 B;  4I8O A;  1J7C A;  2V3P A;  1JWM D;  2JQF R;  5D94 A;  1HNZ M;  1N5X A;  4HPL B;  3RN9 C;  2WS3 B;  2EMT A;  2F5S A;  2BB6 A;  4BKT A;  2KZS A;  1EU4 A;  1C9F A;  1ZUD 2;  3GO8 A;  3GLH B;  1ME4 A;  4GKJ M;  1TKY A;  2N9E B;  4BZA A;  3EIH A;  3V6E A;  4DXF A;  4HJK A;  1KOT A;  1RRB A;  3J7B A;  1LQB A;  4PS7 A;  4DV7 M;  4IIW A;  4XDC A;  3R7R A;  2MJE A;  1XNR M;  3K9P B;  1HQC A;  4LDT D;  3KWZ A;  2VQE M;  2IND C;  4DR1 M;  4M9X A;  1I4R A;  3F75 A;  2FID A;  2XGN A;  2IZV B;  2L2D A;  1WF9 A;  2HAK A;  3RNG C;  4DR7 M;  2QHO B;  1WJ7 A;  3A1Q B;  2FS1 A;  2IDY A;  2IGG A;  4AS1 A;  3TCA A;  2KC2 A;  5AEK B;  2CHV A;  2RSU A;  2BB5 A;  2LGX A;  4ZTB A;  2WXF A;  4AP4 C;  1MS6 A;  2HWK A;  2Y5P A;  4KGS A;  2KYW A;  5FR6 A;  3RNV A;  3PZ7 A;  2O25 A;  4HLE A;  2DHY A;  3RCZ A;  4WQO B;  3BVZ A;  3PFI A;  3ZXR A;  2IGD A;  3RUI B;  1MEG A;  1YE9 A;  4GC5 A;  2L52 A;  3PRM A;  2HTM E;  3NUH B;  1YJJ A;  3T3N A;  1C1Y B;  1SXJ D;  2JYT A;  3APD A;  4YYQ A;  3ZUA A;  1ICF A;  2CV2 A;  4IWP A;  3L29 A;  2Z8Y M;  4A90 A;  2MP2 A;  1NY6 A;  1YMH E;  3JAM S;  4M8M A;  1SJH D;  4PYZ A;  2L7H A;  2G9H D;  1PYW D;  3Q8X A;  1PPN A;  3SHQ A;  3U6O A;  1UF0 A;  2JTC A;  2LVQ A;  2BWE A;  3MJ5 A;  1JWA D;  1AU0 A;  1HNX M;  3RNE C;  2KFJ A;  1SXJ C;  1E7P B;  2FIF A;  1JRO A;  4YT0 B;  3UIP B;  3N3G A;  3IFW B;  5HG2 A;  3UIN B;  3FIL A;  1QYR A;  1KLG D;  2I2Y A;  2DYM A;  2OO9 A;  3A46 A;  4N8W A;  3HVD A;  3D8B A;  4A55 A;  3UK6 A;  1VDV A;  1F4I A;  4S17 A;  1ROE A;  1MHW A;  4BOZ B;  3HIZ A;  3SFE B;  3AEA B;  4FJY A;  4CYE A;  4CZW A;  3B7Q A;  1DKI A;  3KOX E;  2V1Y A;  1JQJ C;  4IP3 A;  3A9K A;  1NY5 A;  1HTO A;  1N5W A;  4O1N A;  4FW9 A;  4L15 A;  1XLO A;  4HDQ A;  3AJI B;  2K3U A;  3Q3O C;  1D2N A;  2JPH A;  2LGD A;  3DBL I;  1BY8 A;  1P1A A;  1GJZ A;  3DA1 A;  1MG4 A;  2XZF A;  3U61 B;  3TMP A;  4B7F A;  4B3R M;  1KLU D;  5IP4 D;  1HT1 E;  3DF0 A;  1GMY A;  1HJP A;  1XC8 A;  1U9Q X;  2INP E;  3AL0 C;  2QJL A;  4M0D A;  1QUS A;  3O0U A;  1PJQ A;  2HJ8 A;  3GLI A;  2N35 A;  1WR1 A;  3T9L A;  4FHJ A;  2YJ2 A;  4OU7 A;  1S3S G;  3W1Y A;  1AN8 A;  4B0M A;  1TF0 B;  4BBA A;  3TWM A;  5KPR A;  3AEG B;  1VG5 A;  2OOA A;  2RDB C;  3ZJT A;  1TJE A;  1F77 A;  2J7Q B;  1TU6 A;  1N33 M;  2KDI A;  1NQC A;  2D07 B;  1OAI A;  3A1Q A;  4NPN A;  1TBE A;  2AEH A;  3KSJ A;  3T8M A;  1YVB A;  4W9D A;  1N77 A;  5GXG B;  3GP1 A;  3TL4 X;  1T3Q A;  2QSF X;  1PGX A;  4PD2 A;  2W9N A;  3K2L A;  1N32 M;  1SNK A;  3I63 C;  1R4M B;  2N1V A;  4KZ0 A;  4CHK A;  2Y6E A;  4MEL A;  3JR5 A;  1TTN A;  2OED A;  4W9H A;  3MOR A;  1J09 A;  4MGY E;  3SR6 A;  3RFW A;  4DV5 M;  3DOA A;  5EGW A;  1SE3 A;  4OVZ A;  4LNI A;  1NNJ A;  1UM8 A;  3VFD A;  3GLF E;  1M94 A;  1TLO A;  2RRU A;  3GRU A;  2WX0 A;  3TEX A;  2R45 A;  4OVU A;  2KDF B;  3QJ3 A;  2J0K A;  3DCG A;  1FIQ A;  1QIL A;  1IXS A;  3GLG E;  5EQT A;  4L8R C;  3IMA A;  2KHW B;  4KV2 A;  2WSF F;  4WWP A;  2LBC A;  3K8Z A;  4AKI A;  5C1Z A;  2G6D A;  3LXS A;  3RVV A;  4QH6 A;  3GQ4 A;  1TS3 A;  5DYG A;  2QBY B;  4JI4 M;  3N3K B;  3ZNI D;  2PBH A;  1G71 A;  1JAL A;  4W9K A;  4J3O D;  1PPD A;  2DYB A;  2GI9 A;  2CHQ A;  2M8S A;  1MDW A;  4W4U A;  1XLQ A;  2K0P A;  2XN9 C;  2DHR A;  1TTE A;  2DWZ B;  4AXL A;  1BVS A;  4GMQ A;  4RGO S;  1Z5B A;  4NY0 A;  2BKF A;  1XLN A;  3M95 A;  1L0V B;  2K6Q A;  4A3V B;  1L2D A;  4ZRI A;  2AYO B;  3KSX A;  1KLV A;  3V60 A;  4L2Y A;  1MJG M;  3VRB B;  4RNA A;  4RM9 A;  1KFV A;  4DHJ B;  4XR7 A;  1E9M A;  4USA A;  2KFK B;  2DJG B;  3NZS A;  4DUZ M;  3C58 A;  3TNX A;  1T6O A;  2BYV E;  2CP8 A;  4JV5 M;  2OZ2 A;  1GKI A;  2ZVO A;  1NJG A;  3BWU D;  3P4P B;  4XGA B;  3DBR B;  1EF5 A;  4KZC A;  3WAO A;  1WSP A;  4WP2 A;  2KT7 A;  4LGM A;  2UU9 M;  2DJF B;  2MWS B;  1XXH B;  2QZ4 A;  2PE9 A;  2L76 A;  3KW5 B;  4ANV A;  5JHA A;  3IHP A;  3BWK A;  5EE9 A;  2CHZ A;  2PAD A;  1IM2 A;  3GLI B;  3BBA A;  3A9J A;  1NVI D;  2C60 A;  3TEZ A;  3UIO B;  2WWZ A;  4Z6Y A;  4GN1 A;  1J7K A;  3DPD A;  1WXS A;  2FUD A;  3KX1 A;  2LJI A;  4OW0 A;  3GRV A;  4ICU A;  4DMX A;  3I3T A;  1SSN A;  2PPH A;  4D81 A;  4IKG A;  1DOY A;  2L0F A;  2DZN B;  1L4D B;  1H4R A;  2CS4 A;  4JI6 M;  1DO0 A;  1IBM M;  3IEJ A;  5KPZ A;  4LCB A;  5K16 A;  5L8R F;  3GLH A;  1E5W A;  1Y4H A;  3QC8 B;  3AUL A;  1T0Q C;  2WXK A;  3CIR B;  1YZB A;  2EKK A;  4DBG A;  3KWV A;  3A9K B;  5J18 A;  3AOE A;  4DR3 M;  1VZ6 A;  5G2N A;  3ZUN A;  4W9C A;  5JZE B;  1EF7 A;  2JP7 A;  4KT0 F;  3HU3 A;  1GNU A;  2LGY A;  2FUH B;  1EWC A;  3HU1 A;  3AU5 A;  4NJ7 A;  5DCN A;  1Q39 A;  3SC3 A;  2C5R A;  1V8C A;  1KXR A;  1YK7 A;  5TR5 A;  2Z84 A;  3Q8E A;  3ERV A;  4IBB A;  3RVW A;  2RGO A;  5CTR C;  5IRE B;  4ZYS A;  2ZJD A;  1PGY A;  1MPE A;  3PRP A;  1QXP A;  1F29 A;  3FYD A;  4MSM B;  2GBR A;  2EKF A;  3VDP A;  2KXE A;  1E8Y A;  1EO6 A;  1XLP A;  2KTR B;  3IT4 B;  1FNW A;  1SXT A;  4JI1 M;  4KSL C;  1C1K A;  3ZDT A;  1F0Z A;  3WA0 A;  2WQY B;  3FRI A;  5JI2 E;  3VLF B;  1VD2 A;  4DR5 M;  2UXB M;  2G4S A;  2O2V A;  4IG7 B;  4DXA B;  4B3M M;  4DV6 M;  2KDE B;  1Q6K A;  6PAD A;  1IUE A;  3SYK A;  3QCA A;  4JI0 M;  4B3T M;  4WJN A;  1L1Z A;  2GBK A;  1U9V A;  3KOY E;  1B1Z A;  1STE A;  2ZPN A;  3RGP A;  3Q3F A;  1WYG A;  2AL6 A;  2MP2 B;  2CV1 A;  4GSW A;  3VR8 B;  4G3O A;  4XBO A;  1UNS A;  4NQL B;  2KXJ A;  1WIV A;  3H7P A;  2DC6 A;  2KMC A;  3AB5 A;  2GNO A;  2D2Q A;  1T0S C;  1YJ1 A;  1KTK A;  2REX A;  2G8J A;  3R8F A;  3NG0 A;  4NAW B;  5DPT A;  2D11 A;  2O5R A;  4LJ6 A;  3SFZ A;  1CJE A;  2VRR B;  3RVX A;  3U6L A;  2MJ5 B;  1YX6 B;  4XE0 A;  2C5L C;  1L1T A;  3V6C A;  2N7E A;  3OVZ A;  4C4V A;  2E3T A;  3EC8 A;  5FTN A;  4LJP B;  1HTQ A;  1E9R A;  4AG5 A;  3SHF A;  2M1M A;  2INN E;  2CHG A;  2KVR A;  2G45 B;  3RZW C;  4P6G A;  1L7Y A;  1MJD A;  3ONS A;  2YLM A;  4ZHP A;  1XQQ A;  3RUL A;  2L7I A;  4KOD A;  3P42 A;  1CB5 A;  1L6U A;  4LFA M;  4BKS D;  3O1G A;  4KHP M;  4FJZ A;  3L25 A;  3W31 A;  3PS6 A;  1WGR A;  2KN5 A;  2DWM A;  1HNW M;  3URY A;  1SXJ A;  2FH0 A;  4RGN A;  5C1B A;  3VRA B;  2XSZ A;  3V6C B;  4P6E A;  4WWO A;  4GDL A;  2BPS A;  2VDB B;  4MGH A;  1EF1 A;  4PYU A;  5D3D A;  4W9F A;  3V62 A;  4D8I A;  1TGU A;  1PPO A;  2DLB A;  2RD0 A;  4D80 A;  3LVV A;  1F2B A;  2V3S A;  3TEW A;  1TR8 A;  1YIW A;  1IPG A;  1E8X A;  2FRA A;  2IPP B;  2JVC A;  4B9K A;  1ENF A;  1JRP A;  2LVO A;  2VH2 A;  3EA6 A;  4PDI A;  2LUM A;  2YJC A;  3HHW A;  4HK2 A;  2J4X A;  2G5G X;  3GLI E;  2J7O A;  3AEE B;  1IN5 A;  1QT9 A;  2KFK A;  4BKS A;  1AU4 A;  2LUE A;  4AQ7 A;  2JU6 X;  4LF5 M;  3R2T A;  3NWL A;  1IN8 A;  2MH8 A;  5BYQ A;  1J5E M;  3AE9 B;  4YSZ B;  1QOL A;  1TH2 A;  2V1U A;  1WGG A;  2UUB M;  2CE7 A;  2UWQ A;  3BY4 B;  4US9 A;  1PRB A;  1WH3 A;  3S3Q A;  3IV2 A;  4IM3 A;  3F5V A;  1YQ4 B;  3PTF C;  1TZO A;  2DCC A;  4K3C A;  2X8A A;  4P6V F;  2O2V B;  2DCB A;  3OAW A;  3DFZ A;  4LRS A;  2WXM A;  3WXE A;  2LJ5 A;  3I01 M;  2SEB D;  3L0W B;  3K9O A;  3HHZ A;  3UQA A;  1HR0 M;  3L08 A;  2WXQ A;  4UDU C;  1GB1 A;  5IN7 A;  4P17 A;  2H89 B;  3HHA A;  3MP9 A;  1QOA A;  3Q6B A;  5DPR A;  5A24 A;  2CV0 A;  4TUW A;  1MFW A;  2ZM6 M;  4RMA A;  2AWT A;  3L10 B;  8CAT A;  3TIX A;  5FK9 C;  1TKE A;  2MGW A;  2AQ1 B;  4R3D A;  2ZEQ A;  2DAE A;  3PT2 B;  1V1P A;  4M0W B;  2IO3 B;  1QOG A;  1NV8 A;  2D10 A;  4MAC A;  2BWF A;  3HVZ A;  1OJL A;  3S2A A;  5A2Q S;  4B08 A;  1WXV A;  4A6Q A;  2WXL A;  3OWE B;  2LNH C;  4K81 A;  3CH3 X;  4BLC A;  2F1G A;  1UWX A;  1NB3 A;  3ML9 A;  3Q2A C;  1JQP A;  1PUT A;  1V5O A;  1R4N B;  2LHE A;  2BYE A;  2N0S B;  4ZDV A;  4DV3 M;  1X9Y A;  3VDZ A;  4GKK M;  5KQD A;  3ZNG C;  4DDI D;  2G7Y A;  1OTR A;  2DOS A;  1J8C A;  4RF0 A;  3OJ4 B;  5AZH A;  5CVM A;  4JPS A;  4LNK A;  3QK0 A;  3ZC7 B;  4ARC A;  1E10 A;  3K24 A;  4LZJ A;  1EWM A;  2NPT B;  4OVV A;  2Y0Q A;  4JQW C;  5C23 A;  4WH4 A;  4GU2 A;  4BOS C;  1IY1 A;  2PRE A;  3E21 A;  3MTN B;  2DAF A;  1UBI A;  1WRI A;  1ZDV A;  3PXG A;  4EEW A;  5FR3 A;  1WXQ A;  1NPZ A;  2MQJ A;  4HVB A;  4FHK A;  4DHZ B;  2NQA A;  3HGI A;  3B74 A;  1L2N A;  2XF3 A;  4F1I A;  1AYW A;  2WGS A;  4RH6 A;  3RNF C;  1WX8 A;  1MIR A;  1SIJ A;  3K8U A;  4Q2J A;  2L09 A;  1V6E A;  2Z8L A;  5CVN B;  1IBL M;  2LVA A;  1PJT A;  2NVU I;  2E01 A;  1SB3 C;  1JQ4 A;  3N9Y C;  1P7E A;  5EF4 A;  1UGJ A;  2KWU B;  3MHZ A;  2KAJ A;  2XLJ A;  3NZU A;  3FTF A;  2NBW B;  1ORY B;  3HWS A;  2LVP C;  1HUC B;  3FTE A;  3W1S C;  3SAT A;  4NRW A;  4HKQ A;  2AS8 A;  5JZE A;  3KFU G;  2JZ1 A;  3IAM 1;  3RNB C;  3VTU A;  4FJV B;  4WWM A;  4ACF A;  4ZRP A;  1Z5A A;  2CHX A;  2P86 A;  3X23 A;  3N1Z C;  1NNU C;  1Z5S B;  3AKZ A;  2IYD B;  2N9K A;  4QHS A;  5GKN A;  1NEK B;  3UF8 A;  4GB9 A;  4HWY A;  3LMM A;  2L83 A;  3GQ5 A;  1V1P B;  1A6R A;  3ZLZ A;  2KNV A;  2E03 A;  3C3E A;  4RF1 A;  4X64 M;  2KWC A;  4B6W A;  3R9X B;  3SAW A;  3Q8A A;  4M00 A;  5EE0 A;  2OP3 A;  2KVZ A;  2AQ3 B;  3HRD D;  2P7U A;  1E94 E;  3VTV A;  2D3G A;  3DDC B;  2GQF A;  2A4Z A;  5D2M B;  2V6Z M;  3PZ8 A;  4IW0 A;  2VZK B;  1YT7 A;  3CWI A;  4L16 A;  4AUQ C;  1GVN A;  2UU7 A;  2UUA M;  2LEK A;  3ZGZ A;  4GMV A;  4MJS B;  1EE8 A;  4IM0 A;  2KHH A;  4PS8 A;  3N3K A;  1YQB A;  2BW2 A;  2AL3 A;  1K3B B;  2Y5B B;  5CX3 A;  4AXM A;  4QRX A;  2JXX A;  3T15 A;  1WJU A;  2ASQ A;  1QAO A;  2XBB C;  4G3X B;  4ITK A;  1J0G A;  4JL9 A;  1AW7 A;  1K50 A;  1XO3 A;  1G6J A;  2X38 A;  2W54 A;  3E9S A;  2I7P A;  2Y5C A;  4HDO A;  3V05 A;  4HWI B;  1WMH B;  3PHW A;  1N61 A;  4HEA 1;  2C7N B;  3M0E A;  4ICV A;  4NZL B;  4K1R B;  1L4Z B;  4JI2 M;  2L0T A;  1FM0 D;  4LF9 M;  2PIA A;  1OQY A;  3R66 C;  3TRK A;  2XEP A;  4GRI A;  1GO5 A;  1NEN B;  2XU3 A;  4GOC A;  4HLQ A;  2XK5 B;  2MR9 A;  4JWU C;  4BKG A;  2RDH A;  1V34 A;  1CS8 A;  1RLF A;  3N20 C;  1NI3 A;  2O6V A;  2XU5 A;  4P1B C;  4IUM A;  3B08 A;  2VHF A;  2HJ1 A;  4RFB A;  4NSO B;  4YY3 M;  3AE2 B;  5J94 A;  1XCQ L;  1O0E A;  4JI5 M;  1C4A A;  1J7B A;  5EP3 A;  1IBX A;  2K22 A;  3GRY A;  1T6B X;  3M62 B;  5ITU A;  2C0Y A;  3BC3 A;  4L6V 6;  4A9A A;  5DPW A;  1GPX A;  2X4A A;  3MHS A;  2WZJ A;  2VZK D;  1THE A;  3E56 A;  3AE6 B;  2YEP B;  1JB0 F;  4P16 A;  4M0W A;  4MDK E;  3JSV B;  1XEE A;  1AIM A;  2PJH A;  3WAP A;  3C19 A;  3B0A A;  3LCV B;  2DZL A;  5IA7 A;  3BOW A;  2W3R A;  2JRH A;  1DGH B;  1ZAE A;  3FTD A;  1QKZ A;  2JX5 A;  1JML A;  2N4F A;  2KTF A;  2AX5 A;  4GDK A;  3WAM A;  3RT3 B;  3AV0 A;  1DGG A;  4M8N A;  2BDL A;  1N6Z A;  1GOZ A;  2K8H A;  2BTE A;  1DOX A;  2QQ8 A;  5EJC A;  4LF6 M;  2G3Q B;  2JXN A;  1C77 A;  2V9H A;  3H6N A;  4KDL B;  3P63 A;  1FFU A;  4AKH A;  2G1E A;  1L2B A;  4HPM B;  1XF5 L;  3EHV A;  2KQ4 X;  1DGH A;  2QDF A;  1ACC A;  2XFT A;  1PGB A;  5IO9 A;  3ZVV A;  1AYU A;  2HHN A;  4HRS A;  1Z5C A;  2NTT A;  1MN3 A;  2MHJ A;  1WFY A;  3I04 M;  5DNY A;  3RMK C;  1Z2M A;  3JVZ X;  4K7W A;  4LF8 M;  2R9F A;  3C9E A;  1GLN A;  1LM8 B;  4FIP A;  4L23 A;  1IQP A;  1P7F A;  4I07 A;  3AE3 B;  1K51 A;  1VEK A;  1MHH E;  2BS2 B;  3QX1 A;  4NNJ B;  5ITX A;  2M60 A;  3BYT B;  4KIK A;  4ARI A;  2NQD B;  2GLS A;  2M0A A;  4MSQ B;  2QNJ A;  3K9M A;  1V49 A;  2JYE A;  4XZX A;  5L83 A;  1IXR C;  3Q8G A;  3AE7 B;  3C8Y A;  3ILK A;  4K0K M;  1E0Z A;  3ZTC A;  3HK0 A;  4JI7 M;  1Y8G A;  1CMX B;  3HZJ A;  2HH5 A;  1IP9 A;  2KRK A;  3NVV A;  3HJS A;  2QC8 A;  4N4Z A;  2JUO A;  3U8Z A;  2F5O A;  2C96 A;  4MM3 A;  1SG9 A;  1RU3 A;  1GUA B;  3FUU A;  3SMS A;  2MBQ A;  3CGW A;  4WAA A;  1GLO A;  1U5I A;  2K0B X;  1V97 A;  1ZW7 A;  4BAX A;  2ZTD A;  2KKC A;  4EKU A;  2NTS A;  2RMM A;  1T0R C;  3I3T B;  3BZD B;  1VZ7 A;  2EEL A;  2FCS A;  4RKX A;  4IUM B;  3I5J C;  4MZO A;  2MW5 A;  1V9J A;  1T5X D;  4FAD A;  4MZS A;  8PCH A;  3PRZ A;  2JWU A;  4CHT B;  2Y0T A;  4I6L B;  2D7G A;  1SGH A;  4US8 A;  1GJS A;  3AN1 A;  4E74 A;  2ZZP B;  3PBH A;  1ZOY B;  4D82 A;  1TS2 A;  3CF2 A;  3T1H M;  3W0L B;  2Y20 A;  1P0R A;  4NRV A;  1IFY A;  2DBY A;  2WXN A;  1R6B X;  5EXP A;  3V6E B;  5EZS A;  1KYI A;  2WP9 B;  3L27 A;  1JW9 D;  2WDR B;  1Y56 A;  3L2A A;  2NCN A;  5T8I A;  1PBH A;  4TV3 A;  1ZMV A;  4C56 C;  1NB5 A;  1E32 A;  2JZZ A;  1AUA A;  2KDM A;  3APF A;  4TQ0 A;  1V81 A;  3IUT A;  4N58 A;  4X6I A;  5D6J B;  3KOZ E;  3LXF A;  3GS2 A;  2FAZ A;  2K6B A;  2Z7J A;  1EU3 A;  1I4Q A;  1OFI A;  4LF7 M;  3O65 B;  3OQC A;  4BS6 A;  3J27 B;  4XZ4 A;  2DAK A;  3RZF A;  2EUC A;  3A42 A;  2XU4 A;  5F02 A;  3QA8 A;  3H8B A;  2G4D B;  2WYQ A;  3APC A;  3ZNH B;  2K9D A;  2CJO A;  2PW9 A;  3Q8F A;  4OZA A;  3PRM B;  1TDH A;  3GCB A;  2HHH M;  1PQS A;  1WIA A;  1OAO C;  5KHO A;  2Y3A A;  2WSE F;  1WGY A;  2YJ9 A;  1MU5 A;  1KM7 A;  2EMS A;  2KNB A;  2KMA A;  3P5X A;  3DBR I;  2C99 A;  2Z3X A;  5C2T B;  5EDS A;  1TL9 A;  1M6D A;  2B76 B;  2GB1 A;  4FUL A;  2FRQ A;  1G4A E;  5LMU M;  1WWT A;  2UUC M;  5L95 C;  4PP2 E;  2C7M B;  2YQZ A;  1PAD A;  2QEN A;  1K3X A;  1SF0 A;  3DVN V;  1YN5 A;  2JA2 A;  2HWJ A;  2LWP A;  1D5X C;  5JH5 C;  1R4G A;  1ZKH A;  3UMM A;  3QAR A;  4B0E A;  4HL4 A;  1LO5 D;  3H4M A;  2C7H A;  4F2L A;  2MJD A;  4ZRQ A;  4LJA A;  3VAW A;  2K6D B;  1PGA A;  2BKR B;  4ZYN A;  5EE3 A;  3GE8 C;  4W9E A;  3FUV A;  1QVR A;  3GRR A;  3QT4 A;  3CH2 X;  4GGQ A;  3B2F A;  1WX9 A;  5HFY A;  2DKL A;  1WRD B;  5HI1 A;  2OJR A;  2WBF X;  3CF6 E;  2B1N A;  4W9J A;  3VUW A;  3WIM A;  4CJ6 A;  5LXH A;  2MRP A;  1EWP A;  4GUA A;  1OIZ A;  2FCN A;  4AG6 A;  1GEC E;  5EXS A;  1A70 A;  2G8L A;  5JI3 E;  3A98 B;  2H5X A;  1IWD A;  3GB1 A;  5GMV A;  2ZVN A;  4AZF A;  1Q3B A;  5AUI A;  2BT6 A;  4DR2 M;  1K53 A;  1OFH A;  2N9L A;  3GQ3 A;  2RR9 A;  1WJ6 A;  2FTD A;  3GPX A;  5I4D A;  4TQ1 A;  4JIO U;  1RFK A;  5BMI A;  3QSD A;  4EFO A;  1I4W A;  3T1Y M;  1JRU A;  4NAM A;  2M0X A;  4X62 M;  5BYR A;  1F2A A;  2XZU A;  3MK6 A;  1IBK M;  2LRW A;  7CAT A;  2HDE A;  2AIM A;  4DR6 M;  3GZN B;  4WJQ A;  3B89 A;  4BSQ A;  1UD7 A;  3KP0 E;  4RCO A;  4KGT A;  2F4V M;  1Q3C A;  3I57 A;  3C3D A;  3U60 A;  2LMC A;  2JWS A;  2J7Q C;  1QF6 A;  4ZRK A;  2QCU A;  1V2Y A;  1L5P A;  2D3A A;  3JW0 X;  1TDZ A;  1FJG M;  2KLG A;  5EP4 A;  2VII A;  2NBV B;  2LD9 A;  3W67 A;  4I04 A;  2GBM A;  2BU3 A;  2DZJ A;  3TQS A;  1F52 A;  1ZXH A;  4LFC M;  1BQI A;  4IBD A;  1NL6 A;  3BCN A;  3KKU A;  1LFD A;  2K8B A;  1SXJ B;  4GLS C;  1QAM A;  3OVX A;  2ZBK B;  1EFU B;  2V4L A;  1FRD A;  3A33 B;  4DWF A;  2HD5 A;  3AE1 B;  4B7H A;  1YSY A;  3PNV A;  4G54 A;  3VR9 B;  2BDZ A;  1JWS D;  4B3S M;  3SYL A;  1XKG A;  1QQW A;  4Q8H A;  1WYW B;  2LHD A;  2DX5 B;  4II7 A;  2AQ2 B;  2KQ7 A;  1N78 A;  3HY5 A;  1HXY D;  4IC7 B;  9PAP A;  5JH3 A;  3B7N A;  5IKC M;  1DEU A;  4E3C A;  3DZD A;  2JF5 A;  1DV0 A;  1TIF A;  4KGR A;  4G50 A;  3H7D A;  3HM6 X;  4DQO C;  3KWB X;  4YYW A;  2AU1 A;  1QUT A;  4JE3 B;  3AI8 A;  4HCP B;  2OOB B;  3TPZ A;  4AJY B;  2ONQ A;  3HUI A;  2CRU A;  1Q5W B;  2LHC A;  3A4S C;  1YX5 B;  1PJI A;  3RI7 C;  1G8P A;  1I7H A;  4FCW A;  4IBJ A;  4MGZ E;  1YQ3 B;  2GOW A;  4ASW C;  1WZ0 A;  1SEB D;  5EP1 A;  4N59 A;  2K5P A;  3LJ3 A;  4G4R A;  1Q0W B;  3AI5 A;  3HJ8 A;  3TEY A;  4IJE A;  3MTN A;  3I4Y A;  2MX2 A;  3MJW A;  2OQ4 A;  3U2S C;  1NV9 A;  2KTR A;  1L2C A;  1Z6T A;  3FC4 A;  3TBL D;  2MRO B;  3IOQ A;  3GOE A;  4N6E B;  1D6E C;  4XC2 A;  2KW0 A;  4CGY B;  2WXR A;  3LFY A;  1FXT B;  3WAN A;  2V1C A;  2BS3 B;  1GCB A;  1V1O A;  3VUX A;  4FBJ B;  3DHG C;  1DYQ A;  4EIW A;  4TMA B;  3U5Z B;  3GLG A;  3U7Z A;  1IN7 A; 
#chains in the Genus database with same CATH homology
 1X37 A;  2HL7 A;  4IDI A;  1DGB A;  1HEZ E;  1CK1 A;  4YSX B;  2M5Z A;  2JZP A;  3RFZ B;  4B7G A;  3W9C B;  2MEK A;  3P4R B;  4LJ8 A;  1R7R A;  1HA5 A;  2ZAO A;  4XWT A;  3MTV A;  4L4U A;  1VJK A;  2DWN A;  5FLX S;  2GRI A;  1E9S A;  4D8B A;  5C3J B;  3RGS A;  3R2I A;  4YWG G;  1I4P A;  1QZM A;  1N62 A;  1KF6 B;  4KKJ A;  1I4X A;  2VQF M;  3T3O A;  4LJ9 A;  2BJV A;  1TY0 A;  1YJI A;  1TH4 A;  1XNQ M;  2RPV A;  1PVJ A;  2NMQ A;  3U6D A;  2E5L M;  3VK8 A;  1OQR A;  3MFG A;  3SAS A;  5ITR A;  1LV7 A;  3GPP A;  1VR9 A;  3AH7 A;  3PVS A;  1R2Z A;  2ZAN A;  3ZH9 B;  3SHG B;  1IY0 A;  2CFO A;  2I7N A;  2H88 B;  3AFH A;  4OHJ A;  2JRI A;  1D5M C;  4FWH A;  1IGD A;  3WCQ A;  4XWW A;  2EKI A;  4C7Y A;  1NHW C;  2BBC A;  2CEA A;  2EO2 A;  2H1R A;  3CTW B;  3PHU A;  3AM9 A;  3U60 B;  1YUB A;  2L1A A;  1ZP0 B;  2XH9 A;  1E6E B;  1QAQ A;  1F2R C;  2WXG A;  4LF4 M;  4QOS A;  1FXA A;  5C18 A;  3ZYY X;  4AI6 A;  5IZ7 D;  2L32 A;  4KX6 B;  1QQR A;  1N60 A;  3KVW A;  4IBE A;  1SE4 A;  4BOP A;  4IBG A;  5BMG A;  4IOI E;  1ZQ9 A;  2MJ3 A;  3NVW A;  1JR3 D;  1RWS A;  4D8E A;  1TYG B;  3TWK A;  1W5T A;  4BOZ A;  3NVY A;  1PJJ A;  2DXI A;  3I9V 1;  2ZW0 A;  4LLG M;  4BOS A;  5ITY A;  1M4V A;  3AEB B;  2FBW B;  4GDL B;  1GL7 A;  1JWB D;  2HKJ A;  4YSY B;  1XXH A;  3FKE A;  3WHL A;  1EM7 A;  3HU2 A;  2QBY A;  3KQ4 A;  5KQ8 A;  1C76 A;  2C9O A;  3EIE A;  1FRR A;  4QHT A;  2BTW B;  2BNK A;  4MGI E;  1KFY B;  4MB7 A;  1ZE3 D;  3M6A A;  4AQY M;  1KH0 A;  3BY4 A;  2PKO A;  5G5H A;  3LQR A;  4A5U A;  3NVZ A;  1YN4 A;  2ACZ B;  3J81 S;  2WNM A;  2DWL A;  1ESF A;  1N34 M;  4FCV A;  5FTJ A;  4CIS A;  4WQM A;  5KO3 A;  2FNA A;  3EGR A;  1L6V A;  3KOW E;  2QPA A;  4XDD A;  1FCC C;  3NBI A;  4FCT A;  5HHD G;  3ETR A;  4W5W A;  4FWD A;  2J7Q A;  3FIL B;  1B9R A;  1WGK A;  4L78 A;  1SJE D;  4NXM M;  3THG A;  3KWL A;  3FD9 A;  2L6O A;  2R4E A;  2P5T A;  2R61 A;  2BYT A;  3U52 E;  1Q10 A;  5FTM A;  3B9J A;  4QOZ C;  2DYO A;  3SAV A;  1MX0 A;  3U6E A;  4X66 M;  1BML C;  1FXI A;  5ITX E;  1IGC A;  3P4S B;  2V4I B;  4C80 A;  3ZQ4 A;  4M9S A;  1BUI C;  3OTO M;  1PFD A;  4WIP A;  3I4V A;  1CQV A;  1FMA D;  4TSS A;  2F5Q A;  2PVO D;  2A5Y B;  4WAF A;  3SAR A;  4NJC A;  5EE1 A;  2BJW A;  3U5Z A;  2N7J A;  2BS4 B;  2ZW1 A;  4MI7 A;  1PDX A;  4D2K A;  1KRH A;  5IT9 S;  2QSD A;  2C9C A;  3K92 A;  3AE4 B;  3R8B A;  1KSF X;  4OX9 M;  3ZNH A;  2KRU A;  1H6U A;  1GB4 A;  3TWL A;  1CZP A;  1SE2 A;  1N63 A;  1OQQ A;  4EE2 A;  5H92 C;  2LFI A;  3FUT A;  4IBF A;  1IXS B;  4GH9 A;  4BOU A;  5D7G A;  3Q8C A;  4HKZ E;  5E26 A;  3GP7 A;  4GIT A;  3IT6 B;  4LJ4 A;  1QOB A;  3P1M A;  3SFD B;  2YNM D;  2R62 A;  3HKP A;  2V0G A;  1ZPS A;  3GLF B;  3L28 A;  1TS5 A;  3VK7 A;  2AGA A;  2UZJ A;  2ICI A;  4NL4 H;  5EXT A;  2Z4S A;  5D3I B;  2LWX A;  4KLN A;  1TH3 A;  1NYR A;  2FE8 A;  3U6M A;  3AOG A;  3LVW A;  4X65 M;  4IBK A;  1MHX A;  1VZ8 A;  3JR4 A;  4GIP A;  1FEH A;  3VQI A;  5EXX A;  3PNY A;  1XMQ M;  3E4R A;  4WW0 A;  2Q2E B;  3LB8 C;  2D7H A;  1QOF A;  4G6Z A;  1D4B A;  2XSZ D;  2WXH A;  1R7S A;  5BPV A;  1YNT E;  1C79 A;  1C4P A;  3IXS A;  5LNK 1;  4YXD B;  1XMO M;  2QEJ C;  3B21 A;  3UZU A;  4M9Z A;  1JCK B;  5LMN M;  3D8L A;  4DR4 M;  5AUK A;  4CQN A;  3K1J A;  2WXJ A;  4ZHO A;  1K52 A;  2F5N A;  3V3X A;  2ZAM A;  1ZXI A;  3FTC A;  2KAC A;  1I4H A;  3T38 A;  2WXO A;  3LQQ A;  4LZZ A;  3B9P A;  2NQ8 C;  2RKO A;  4LGY A;  2J53 A;  2YR0 A;  2YFQ A;  4IBC A;  3RE8 A;  3HJQ A;  3BVG A;  3VKG A;  3ZJU A;  4GDK B;  3DWG C;  4I81 A;  3PO0 A;  5BR8 M;  3BYY B;  4GC9 A;  4JWS C;  4MT5 A;  2PTL A;  2R46 A;  3AED B;  2KMM A;  3O13 A;  3FUW A;  3W30 A;  1G3I A;  3PSE A;  4MH0 E;  3AEC B;  4JX1 C;  1HZ5 A;  2ERC A;  4QNR A;  4HXD B;  4L1B A;  3MP2 A;  5H37 D;  4Z8X A;  2D7E A;  4R7G A;  2J52 A;  4FD2 A;  4YHH M;  2PVG C;  2CUZ A;  3TE6 A;  2CJN A;  1TS4 A;  2KA6 B;  2OPF A;  2J7N A;  4LFB M;  3CF0 A;  2YEP F;  3ZCB B;  5BYS A;  1UKF A;  1N36 M;  4DXG A;  4DUY M;  1MI0 A;  1Z59 A;  4A8X C;  2MH7 A;  4NOO B;  1L0X B;  2E6X A;  1MVK A;  3EUB 2;  1HZ6 A;  2FOI C;  2DVW B;  3J7A S;  1HQR D;  2WU2 B;  2R4J A;  3U61 A;  5FSW A;  1G59 A;  2WDQ B;  4IJF A;  2WDV B;  3BII D;  1XCT L;  3WHK A;  4MH8 A;  4LJ7 A;  3W2D A;  3C0R A;  4MGK E;  2Q5W D;  5ITQ A;  1HT2 E;  3GPY A;  1EWY C;  2JQR B;  2CU3 A;  1DO2 A;  4HRO A;  1ET9 A;  4LJ5 A;  3GLG B;  4MM3 B;  1FNV A;  2LGI A;  4BOQ A;  5IWA M;  4G4O A;  2QP9 X;  3Q69 A;  3HHX A;  3VDU A;  1NHG C;  4LTU A;  2Y21 A;  5TSS A;  1NSF A;  3J80 S;  4DV0 M;  3A45 A;  4OVZ B;  1XHB A;  3BOS A;  1K3W A;  3SEB A;  4PT5 A;  1VDD A;  3J2P B;  2C98 A;  4JI3 M;  5FKA C;  4OZC A;  3ABV B;  3IG5 A;  2AHM A;  5EP2 A;  2FFJ A;  2X49 A;  5KPT A;  3AV8 A;  3H8H A;  4FVM A;  2DZO B;  4GHA A;  1VLB A;  4FXC A;  3U6P A;  3NS1 A;  4XGI A;  4I4L A;  1RYJ A;  1I4G A;  3L4P A;  1BXT A;  2XFS A;  4LK0 M;  3U6S A;  2W82 A;  4NSR A;  3KDS E;  1NJF A;  4PDG A;  2WU5 B;  2BTW A;  3TUO A;  2UXC M;  2M19 A;  3M7G A;  5JXV A;  4ZPX A;  4KO8 A;  3BK1 A;  3IFU A;  3KS4 A;  1L0Y B;  4C7Z A;  2RDG A;  2IPK D;  1GL6 A;  2ON8 A;  3Q8B A;  1AWD A;  4YTN B;  3NRZ A;  2HCB A;  1J7A A;  3KW6 A;  1GAQ B;  1FFV A;  4DV4 M;  3PT2 A;  1SBB B;  1JR3 A;  1IN6 A;  2K9X A;  1ET6 A;  1JWU D;  4HJG E;  4QNM A;  3UJN A;  2KEB A;  2WLB A;  2M56 B;  2J42 A;  3QWL A;  3UI3 A;  4RGM A;  4G4Q A;  1F2R I;  1FD6 A;  1TY2 A;  2V3N A;  1PM5 A;  1FNN A;  2QMT A;  3B2G A;  1IXZ A;  2QIL A;  1C78 A;  3BK2 A;  3FUX A;  1UUP A;  1K82 A;  3AE8 B;  3L26 A;  5EZQ A;  3IAS 1;  4KKI A;  4LY6 A;  1DOI A;  3U6Q A;  2JSV X;  2OHF A;  1YN3 A;  3KS8 A;  5ITT A;  1ZDX A;  1VRA B;  4ZOH C;  4JN6 A;  3BVM A;  1W5S A;  2KZU A;  2JXT A;  4LRT A;  1OFF A;  3W0F A;  5FTL A;  2SAK A;  3LYY A;  2LH0 A;  4GHL A;  2EA0 A;  3FAH A;  3UGJ A;  3DWM A;  3BB7 A;  3ZJV A;  4JXJ A;  2I38 A;  4OZB A;  2R18 A;  3HHY A;  3FYC A;  4S12 A;  2XNA C;  4NXN M;  1NVM A;  4YTM B;  1IBX B;  3KLS X;  3AMZ A;  4LG2 A;  2RGH A;  1IN4 A;  4JYA M;  1QLB B;  3O65 A;  2IJ0 A;  1S3S A;  4H2A A;  1N75 A;  4I5S A;  3W5U B;  3QAU A;  3VKH A;  3GPU A;  4IBI A;  2PLP A;  4PCZ A;  3AEF B;  1R2Y A;  3SAU A;  3W1S A;  4G4N A;  2TSS A;  2Z4R A;  3GLF A;  2F5P A;  2DWQ A;  1XWI A;  2K47 A;  3RPF C;  3KXE C;  3TSS A;  5G5G A;  4AKG A;  3NZ3 A;  1SXJ E;  3KP1 E;  1I94 M;  3MC0 B;  3U6C A;  3PHX A;  3AE5 B;  2D5G A;  5E6J A;  1HQY E;  1D5Z C;  4JI8 M;  1FNU A;  4WUR A;  3U4E G;  2QIE B;  1FCL A;  3J9C A;  1IY2 A;  2IGH A;  1RM6 C;  3SMP A;  5BMH A;  3IG8 A;  1DGF A;  4DV1 M;  1QAN A;  2KWD A;  5FTK A;  1C4C A;  3SBJ A;  2WXP A;  3MHV C;  1T3T A;  3P4Q B;  5DYI A;  4BB9 A;  2KN4 A;  4RGT A;  1AYF A;  3I51 A;  1L8Q A;  4YTP B;  1TKG A;  1FO4 A;  1DGJ A;  2FUG 1;  1XXG A;  2WXI A;  2W55 A;  4AW4 A;  2W3S A;  1G41 A;  2LXE A;  2UXD M;  4REZ A;  1NYQ A;  2R65 A;  4DV2 M;  4ITQ A;  3AOE C;  1UWM A;  3W5V B;  2PMV A;  5H8Y E;  4FWG A;  5F3W A;  5MPO A;  4I8O A;  1J7C A;  2V3P A;  1JWM D;  1HNZ M;  1N5X A;  2WS3 B;  2F5S A;  2BB6 A;  2KZS A;  1EU4 A;  1C9F A;  1ZUD 2;  3GO8 A;  3GLH B;  4GKJ M;  1TKY A;  3EIH A;  4DXF A;  3J7B A;  4DV7 M;  4IIW A;  4XDC A;  2MJE A;  1XNR M;  1HQC A;  2VQE M;  4DR1 M;  4M9X A;  1I4R A;  2XGN A;  4DR7 M;  2IDY A;  2IGG A;  4AS1 A;  2CHV A;  2BB5 A;  4ZTB A;  2WXF A;  2HWK A;  2Y5P A;  4KGS A;  3RNV A;  3PZ7 A;  3BVZ A;  3PFI A;  2IGD A;  3PRM A;  1YE9 A;  4GC5 A;  2L52 A;  2HTM E;  3NUH B;  1YJJ A;  3T3N A;  1SXJ D;  2JYT A;  2CV2 A;  3L29 A;  4A90 A;  1NY6 A;  1YMH E;  3JAM S;  1SJH D;  2L7H A;  2G9H D;  1PYW D;  3Q8X A;  3U6O A;  2JTC A;  3MJ5 A;  1JWA D;  1HNX M;  1SXJ C;  1E7P B;  4YT0 B;  1JRO A;  5HG2 A;  3FIL A;  1QYR A;  1KLG D;  2I2Y A;  2DYM A;  3A46 A;  3HVD A;  3D8B A;  4A55 A;  3UK6 A;  1VDV A;  1ROE A;  3SFE B;  3AEA B;  1DKI A;  3KOX E;  1JQJ C;  4IP3 A;  1NY5 A;  1N5W A;  4O1N A;  4FW9 A;  4L15 A;  1XLO A;  3AJI B;  2K3U A;  1D2N A;  3DA1 A;  2XZF A;  3U61 B;  3TMP A;  4B7F A;  4B3R M;  1KLU D;  1HT1 E;  1XC8 A;  2INP E;  3AL0 C;  2QJL A;  4M0D A;  3GLI A;  4OU7 A;  1AN8 A;  4B0M A;  4BBA A;  3TWM A;  5KPR A;  3AEG B;  3ZJT A;  1TJE A;  1F77 A;  1N33 M;  3KSJ A;  1N77 A;  5GXG B;  3GP1 A;  3TL4 X;  1T3Q A;  1PGX A;  4PD2 A;  3K2L A;  1N32 M;  3JR5 A;  2OED A;  1J09 A;  4MGY E;  3SR6 A;  3RFW A;  4DV5 M;  3DOA A;  1SE3 A;  4OVZ A;  1NNJ A;  1UM8 A;  3VFD A;  3GRU A;  3TEX A;  2R45 A;  1FIQ A;  1QIL A;  4L8R C;  5EQT A;  3K8Z A;  4AKI A;  3GQ4 A;  1TS3 A;  5DYG A;  2QBY B;  4JI4 M;  1JAL A;  4J3O D;  2GI9 A;  2CHQ A;  1XLQ A;  2K0P A;  2XN9 C;  2DHR A;  2DWZ B;  4GMQ A;  4RGO S;  1Z5B A;  1XLN A;  1L0V B;  4A3V B;  1L2D A;  3KSX A;  4L2Y A;  3VRB B;  4RNA A;  1KFV A;  1E9M A;  4USA A;  4DUZ M;  3C58 A;  4JV5 M;  1GKI A;  1NJG A;  3BWU D;  3P4P B;  1WSP A;  4LGM A;  2UU9 M;  1XXH B;  2QZ4 A;  5EE9 A;  1IM2 A;  3GLI B;  3BBA A;  1NVI D;  3TEZ A;  4Z6Y A;  1J7K A;  2LJI A;  4OW0 A;  3GRV A;  1SSN A;  4D81 A;  4IKG A;  1DOY A;  2DZN B;  1L4D B;  4JI6 M;  1DO0 A;  1IBM M;  5KPZ A;  4LCB A;  3GLH A;  2WXK A;  3CIR B;  1YZB A;  3KWV A;  3AOE A;  4DR3 M;  1VZ6 A;  3HU3 A;  1EWC A;  3HU1 A;  1Q39 A;  3SC3 A;  2C5R A;  1V8C A;  2Z84 A;  3Q8E A;  4IBB A;  2RGO A;  5IRE B;  4ZYS A;  1MPE A;  3PRP A;  3FYD A;  3VDP A;  2KXE A;  1XLP A;  3IT4 B;  1FNW A;  1SXT A;  4JI1 M;  1C1K A;  1F0Z A;  2WQY B;  5JI2 E;  3VLF B;  4DR5 M;  2UXB M;  4B3M M;  4DV6 M;  1IUE A;  3SYK A;  4JI0 M;  4B3T M;  1L1Z A;  3KOY E;  1B1Z A;  1STE A;  3RGP A;  3VR8 B;  1WYG A;  2CV1 A;  4XBO A;  1UNS A;  3AB5 A;  1KTK A;  3R8F A;  4NAW B;  2O5R A;  4LJ6 A;  3SFZ A;  1CJE A;  3U6L A;  4XE0 A;  1L1T A;  2E3T A;  5FTN A;  1E9R A;  4AG5 A;  3SHF A;  2INN E;  2CHG A;  4ZHP A;  2L7I A;  4KOD A;  3P42 A;  1L6U A;  4LFA M;  4KHP M;  3W31 A;  3L25 A;  2DWM A;  1HNW M;  3URY A;  1SXJ A;  4RGN A;  5C1B A;  3VRA B;  2XSZ A;  4MGH A;  5D3D A;  4D8I A;  1TGU A;  2DLB A;  4D80 A;  3LVV A;  3TEW A;  1ENF A;  1JRP A;  3EA6 A;  4PDI A;  2LUM A;  3HHW A;  2J4X A;  2G5G X;  2J7O A;  3AEE B;  1IN5 A;  1QT9 A;  4AQ7 A;  2JU6 X;  4LF5 M;  3R2T A;  3NWL A;  1IN8 A;  5BYQ A;  1J5E M;  3AE9 B;  4YSZ B;  1TH2 A;  2V1U A;  2UUB M;  2CE7 A;  4US9 A;  1YQ4 B;  1TZO A;  2X8A A;  4P6V F;  3DFZ A;  4LRS A;  2WXM A;  2SEB D;  3HHZ A;  1HR0 M;  4UDU C;  2WXQ A;  1GB1 A;  2H89 B;  3MP9 A;  1QOA A;  2CV0 A;  4TUW A;  2ZM6 M;  8CAT A;  5FK9 C;  1TKE A;  2AQ1 B;  4R3D A;  1V1P A;  1QOG A;  4MAC A;  3HVZ A;  1OJL A;  5A2Q S;  4B08 A;  4A6Q A;  2WXL A;  3OWE B;  2LNH C;  4BLC A;  1UWX A;  1PUT A;  2LHE A;  2N0S B;  4DV3 M;  4GKK M;  5KQD A;  2DOS A;  4RF0 A;  4JPS A;  3ZC7 B;  4ARC A;  1E10 A;  4LZJ A;  2Y0Q A;  4WH4 A;  1IY1 A;  1WRI A;  1ZDV A;  3PXG A;  5FR3 A;  1WXQ A;  3HGI A;  2XF3 A;  4RH6 A;  1SIJ A;  4Q2J A;  2L09 A;  2Z8L A;  1IBL M;  1SB3 C;  1JQ4 A;  3N9Y C;  1P7E A;  1UGJ A;  3MHZ A;  2KAJ A;  2XLJ A;  3FTF A;  1ORY B;  3HWS A;  3FTE A;  3SAT A;  4NRW A;  4HKQ A;  5JZE A;  3KFU G;  3IAM 1;  4WWM A;  4ZRP A;  1Z5A A;  1NNU C;  3AKZ A;  2N9K A;  4QHS A;  5GKN A;  1NEK B;  3LMM A;  2L83 A;  3GQ5 A;  1V1P B;  4RF1 A;  4X64 M;  3R9X B;  3SAW A;  3Q8A A;  5EE0 A;  2AQ3 B;  3HRD D;  1E94 E;  2V6Z M;  3PZ8 A;  2VZK B;  3CWI A;  4L16 A;  1GVN A;  2UUA M;  2LEK A;  3ZGZ A;  1EE8 A;  2BW2 A;  3T15 A;  4ITK A;  1QAO A;  1AW7 A;  1K50 A;  1XO3 A;  2X38 A;  2W54 A;  3E9S A;  2I7P A;  2Y5C A;  3V05 A;  3PHW A;  1N61 A;  4HEA 1;  3M0E A;  4NZL B;  1L4Z B;  4JI2 M;  1FM0 D;  4LF9 M;  2PIA A;  3TRK A;  2XEP A;  4GRI A;  1NEN B;  4HLQ A;  4JWU C;  2RDH A;  1NI3 A;  4IUM A;  4RFB A;  4NSO B;  4YY3 M;  3AE2 B;  1XCQ L;  4JI5 M;  1C4A A;  1J7B A;  5EP3 A;  1IBX A;  2K22 A;  3GRY A;  1T6B X;  5ITU A;  4A9A A;  1GPX A;  2X4A A;  2VZK D;  3E56 A;  3AE6 B;  2YEP B;  4P16 A;  4M0W A;  1XEE A;  2W3R A;  1DGH B;  1ZAE A;  3FTD A;  1QKZ A;  2JX5 A;  1JML A;  2AX5 A;  3AV0 A;  1DGG A;  1GOZ A;  2BTE A;  1DOX A;  5EJC A;  4LF6 M;  1C77 A;  3P63 A;  1FFU A;  4AKH A;  2G1E A;  1L2B A;  1XF5 L;  2KQ4 X;  1DGH A;  1ACC A;  2XFT A;  1PGB A;  4HRS A;  1Z5C A;  2NTT A;  5DNY A;  4LF8 M;  1GLN A;  4L23 A;  1IQP A;  1P7F A;  3AE3 B;  1K51 A;  1MHH E;  2BS2 B;  4ARI A;  5ITX A;  2M60 A;  3BYT B;  2M0A A;  2JYE A;  4XZX A;  1IXR C;  3AE7 B;  3C8Y A;  3ILK A;  4K0K M;  1E0Z A;  4JI7 M;  2KRK A;  3NVV A;  3HJS A;  2F5O A;  2C96 A;  3FUU A;  3SMS A;  1V97 A;  2NTS A;  2RMM A;  3BZD B;  1VZ7 A;  2EEL A;  4RKX A;  1T5X D;  2JWU A;  4CHT B;  2Y0T A;  2D7G A;  4US8 A;  3AN1 A;  1ZOY B;  4D82 A;  1TS2 A;  3CF2 A;  3T1H M;  3W0L B;  2Y20 A;  2DBY A;  4NRV A;  2WXN A;  5EZS A;  1R6B X;  5EXP A;  1KYI A;  2WP9 B;  3L27 A;  1JW9 D;  2WDR B;  1Y56 A;  3L2A A;  5T8I A;  4C56 C;  1E32 A;  2KDM A;  4TQ0 A;  4N58 A;  3KOZ E;  3LXF A;  3GS2 A;  2Z7J A;  1EU3 A;  1I4Q A;  1OFI A;  4LF7 M;  3OQC A;  3J27 B;  2EUC A;  3A42 A;  2CJO A;  2PW9 A;  3Q8F A;  4OZA A;  1TDH A;  2HHH M;  2Y3A A;  1MU5 A;  2C99 A;  2Z3X A;  5C2T B;  2B76 B;  2GB1 A;  1G4A E;  5LMU M;  1WWT A;  2UUC M;  2YQZ A;  2QEN A;  1K3X A;  1SF0 A;  2JA2 A;  1YN5 A;  1D5X C;  3UMM A;  4B0E A;  4HL4 A;  1LO5 D;  3H4M A;  2MJD A;  4ZRQ A;  4LJA A;  1PGA A;  5EE3 A;  3FUV A;  1QVR A;  3GRR A;  3B2F A;  5HFY A;  5HI1 A;  3CF6 E;  4GUA A;  4AG6 A;  5EXS A;  1A70 A;  2G8L A;  5JI3 E;  3A98 B;  3GB1 A;  5AUI A;  4AZF A;  1Q3B A;  2BT6 A;  4DR2 M;  1K53 A;  1OFH A;  2N9L A;  3GQ3 A;  3GPX A;  5I4D A;  4TQ1 A;  5BMI A;  1RFK A;  1I4W A;  3T1Y M;  4NAM A;  4X62 M;  5BYR A;  2XZU A;  3MK6 A;  1IBK M;  7CAT A;  2HDE A;  4DR6 M;  3KP0 E;  4RCO A;  4KGT A;  2F4V M;  1Q3C A;  3I57 A;  3U60 A;  2LMC A;  2J7Q C;  1QF6 A;  2QCU A;  1L5P A;  1TDZ A;  1FJG M;  5EP4 A;  2VII A;  2BU3 A;  3TQS A;  1ZXH A;  4LFC M;  4IBD A;  1SXJ B;  4GLS C;  1QAM A;  2ZBK B;  1FRD A;  3AE1 B;  4B7H A;  1YSY A;  3PNV A;  3VR9 B;  1JWS D;  4B3S M;  3SYL A;  1QQW A;  2LHD A;  4II7 A;  2AQ2 B;  1N78 A;  1HXY D;  3DZD A;  4KGR A;  4DQO C;  4JE3 B;  3TPZ A;  2ONQ A;  3HUI A;  1PJI A;  1G8P A;  1I7H A;  4FCW A;  4IBJ A;  4MGZ E;  1YQ3 B;  1SEB D;  5EP1 A;  4N59 A;  2K5P A;  4G4R A;  3HJ8 A;  3TEY A;  4IJE A;  3I4Y A;  2OQ4 A;  3U2S C;  1L2C A;  1Z6T A;  3FC4 A;  4N6E B;  1D6E C;  2KW0 A;  4CGY B;  2WXR A;  2V1C A;  2BS3 B;  1V1O A;  1DYQ A;  4EIW A;  4TMA B;  3U5Z B;  3GLG A;  3U7Z A;  1IN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...