4RF0A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p6522)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
318
Chain Sequence
b'TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF1ab protein
publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Protein binding
total genus 78
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf0A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf0A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf0A03
4OVZB 4PT5A 4M0WA 2FE8A 5E6JA 4WURA 4REZA 4OW0A 4P16A 3MJ5A 5KO3A 4MM3B 4R3DA 4RF1A 4RF0A 3MP2A 4RNAA 3E9SA 4OVZA
chains in the Genus database with same CATH superfamily
4DV1M 3VH4B 2DXIA 4DHZB 3LQRA 4WJQA 3VXWA 4BBNF 1JR3A 1NSFA 3E4RA 2IBIB 1YMHE 1XC8A 1NB3A 2KFKB 4YWGG 1QXPA 1TYGB 3AEFB 1YJJA 4EOYA 4CDDB 3ETRA 2WSFF 1G41A 3R66C 3A1QB 3WALA 1FPYA 2MROB 2PKOA 1MVKA 3Q8GA 4XYCA 3L17A 5EE3A 4UDUC 3VHTC 3RGSA 2NQDB 2DC8A 5IOIA 4US9A 2WXOA 2R65A 1GC6A 3LDZE 3W67A 4AKIA 1E8XA 1VCBA 4W9KA 4NJCA 2AVWA 2YJBA 1V2YA 2AL6A 3W5VB 1L2BA 2BKRB 4G11A 1GVNA 1Z5AA 3MHSD 2INCC 2M17A 4XWWA 1CUKA 3OG5A 3P63A 4B7HA 1LQBA 1YOVB 3HHMA 3RMKC 3ZCBB 2GRIA 4R7GA 2WXPA 2FCSA 3GLGA 3RD2A 4B3SM 1LV7A 2RDHA 3TEYA 1VD2A 4ICUA 4F1SA 4DV6M 1SEBD 2RMMA 1Y8RC 4MDKE 1PM5A 3ZNHA 2NQAA 4DR6M 1N5WA 3SFZA 3HD3A 3DVNV 3VRBB 4KLBA 4BKGA 4DK5A 2YQZA 1DGHB 1N75A 4N9F4 3DBLB 4X66M 2JZ1A 1E7UA 5D6JB 1K51A 4DDGD 3U6MA 2AGAA 4IJEA 3QAQA 3CH2X 4ITQA 1QQWA 3TEWA 3DOWA 2G8EA 3QC8B 2DAKA 3PO0A 4Q2JA 3F5VA 1TF0B 3GPXA 2F5NA 2CU3A 4I5SA 2NPTA 1L6VA 3R7RA 4ZRJA 4ZHOA 3GO8A 1RRBA 5H8YE 4M8NA 4K0KM 3JVZX 1STFE 2PADA 1WGRA 2JRIB 2ASQA 1RFAA 4USAA 3BPFA 2WXHA 3W30A 3MHHA 4P6VF 2PPHA 3ZKJC 2P5TA 5F3WA 3BVGA 2VQEM 1QUTA 3R8FA 2Y3AA 2OJRA 2O01F 2K6DB 3BC3A 4WAFA 1XB2B 4DV7M 3AECB 4A5UA 4S12A 5BMHA 4MGIE 5EP4A 4HL4A 2OJWA 5DPTA 1IN4A 3I4VA 4RF0A 3E1ZB 1P1AA 3C8YA 2OZ2A 1SSNA 3EA6A 1ESFA 1PPDA 2O6XA 4HVBA 4N59A 1JRUA 2AQ1B 4RGNA 2P0RA 1AECA 3PV1A 4ANWA 1W5SA 2L83A 1THEA 2KHHA 3AOGA 3WHLA 3U6DA 3A98B 1F2RC 3KQ4A 1D0MA 5IT9S 1AU4A 3KSXA 5EXSA 2K6QA 2WXFA 2ZZPB 2DJFB 1WR1A 4OZAA 1FM0D 4BBAA 1E9SA 3V6EA 2UYZB 3FE3A 4ANXA 1YN5A 2HJ8A 3VK7A 2BS3B 2FCMA 2E3TA 1OIPA 4QAYA 4YTMB 1AYVA 3WXEA 2AHMA 4IWOA 4WQMA 2BW2A 2N9KA 2KDIA 2HJ1A 4G50A 4DWFA 4JXJA 2N4FA 4OVZB 1GMYA 3UGJA 2AX5A 1SXJA 2E5LM 2QBYB 1MFWA 2KO3A 4IBIA 2KYWA 3AE9B 3QIJA 3QJZA 1SE3A 3QCAA 2K0BX 1TZOA 5DPWA 3N1YC 1IN7A 4LF4M 3HU2A 4KX6B 2DZNB 2M0AA 2WBFX 2KT7A 3PTFC 4XDDA 1YX6B 4GDKA 4ZYNA 2LRUA 4FK5A 1E9MA 2LH0A 4DXFA 4XBOA 1QDQA 1ET6A 4K3BA 1IFYA 1L0XB 3CSFA 3U60A 3H7SA 3FKEA 2ATOA 2FE8A 3CF6E 4LK0M 3T3NA 4QOSA 4YL8A 2BQQA 3CF0A 2MP2B 4PS3A 4F7ZA 2KZRA 5E26A 1AYFA 4KO8A 2BKFA 4P6GA 3DHIC 3O0UA 2BB6A 3AMZA 1CS8A 1VRAB 5D3IB 3TL4X 3NBXX 3W9CB 3MMPA 2Y5BB 1WF9A 4TMAB 3ZJVA 3ZJTA 1AYWA 2FIDA 1HTQA 2RGOA 1TTNA 2L1AA 5IO9A 4HEOA 4BKSD 1C76A 2ZAOA 3RCZA 1N77A 2KQSA 4MJSB 2CV0A 1PE6A 1G71A 3DBSA 4LTUA 2BGFA 3U6QA 2ACZB 3NOBA 2YJCA 4C7ZA 5L83A 4IDIA 1SE2A 3DZDA 2GBMA 1ME3A 3VUYA 2N9XA 1OFFA 3ALBA 3HHXA 4BBNC 4MM3B 2RKOA 2X49A 3OLMD 4HDOA 1Q3CA 2R9CA 3H8BA 2D3CA 2FUHB 1ACCA 5KPTA 2QNJA 2GMIC 3W1SC 1XF5L 1EM7A 2UUBM 5IWAM 2W9NA 3EC8A 2D3GA 1KFXL 3PW3A 4A9AA 1PVJA 4D80A 4X6HA 3D32A 4I07A 5EXPA 3B89A 1XMQM 3H7PA 1IUEA 2KDBA 1MG8A 2O6VA 4LDTB 2C9OA 3A9JB 2ZM6M 5KHOA 5C23A 3VTVA 3J80S 3TL5A 1DOIA 4IP3A 5JH3A 3QWLA 1EF1A 2BF8B 1YVBA 2AUZA 1B1ZA 1WX9A 1YJ1A 2CHGA 3Q14C 3KKUA 4BSQA 3AULA 4FJZA 2K9XA 1L7YA 3APDA 2QSFX 1WR6E 1ITOA 3KDSE 1CQDA 2HH5A 3S3QA 4CJ6A 4D2KA 1VJVA 1IBKM 2KZSA 3ML9A 1NV8A 2Z4SA 3GRUA 4PS7A 4L4UA 5LXHA 1ZMWA 1UFZA 1MIRA 3RFWA 5LMNM 4YSYB 3RN9C 3KW6A 3Q3OC 3ZXVA 2NS5A 2YEPF 4P16A 4W9CA 1E94E 2DHRA 2L7IA 3DVGX 3HHIA 3FD9A 2KJ6A 3B08A 1IY0A 2HHHM 3RVWA 2MW5A 4HPLB 5DNYA 3MP2A 1DGBA 3EECA 1VDDA 2CFOA 3UI3A 2WXQA 3MHSA 4CIZA 1PADA 3KFQA 3I4YA 1IN8A 1HNWM 1PGAA 3AL0C 3C19A 1YJIA 5EP2A 4NQKE 3RVVA 1K3WA 3URYA 3GE3C 4HJGE 4ASWC 4FCTA 1UM8A 3TMPB 4DMXA 2BYTA 2R4JA 3GLIB 2UU9M 2QSDA 3SFEB 4W9FA 1PYWD 1WGKA 4FVMA 1XXHB 1XNQM 2JP7A 1CK1A 2R61A 5IKCM 1K53A 1IY1A 3DCGA 3P1MA 4L15A 4RMAA 1G4AE 1IWDA 3H4JA 2Q5WD 2NCNA 5DPRA 3ZVVA 1KHPA 1T3TA 3UK6A 3UMMA 5D7GA 4IBCA 2F7DA 1GAQB 2INNE 3KFUG 2L3ZA 1QDRA 2GNOA 1C1YB 1DGFA 4TV3A 1ZQ9A 2WX1A 3N3KB 4QRGA 2HE7A 7PCKA 4FD2A 3I5JC 2CHZA 3PRPA 1EWPA 5ITXE 3SAVA 4Q7JA 1DOYA 2WU2B 4FN2A 1PCIA 1FMAD 1HZ5A 3MC8A 1N34M 1KM7A 2MBEA 1JWSD 1FEHA 2HWJA 1YK8A 4JL9A 1F4IA 1HA5A 1ROEA 3PHXA 1R6BX 3CIRB 2DNAA 1IBXB 4KZ0A 3EFCA 4MSQB 2L7HA 2IY1B 2LXAA 2PIAA 4DXGA 4JYAM 3RI7C 4DV2M 1PPOA 2PBHA 2KMCA 3AU5A 2PE9A 2CJOA 3CWIA 3PRMB 2FYEA 4NAWA 3OF8A 5EE0A 2DBYA 2DC9A 2LXEA 1VZ6A 1SE9A 1T0YA 5EZQA 2MHJA 3BXWA 1JR3D 3AI5A 1WGHA 2BT6A 1VG5A 2JX5A 4KKJA 3B2GA 1ENFA 4ZHPA 2APLA 1C1KA 3P4SB 1ISNA 1EU3A 2KQ7A 5ITYA 3MORA 4I05A 4P6EA 4KVGB 4WH4A 3R7QA 1V81A 3I63C 5JZEA 1F2CA 3BY4B 4I4LA 2HHNA 2KLCA 3N3GA 2VH1A 2WHIA 1M4VA 4MZSA 5H37D 3ZRFA 3PDFA 4B0MA 3ZUNA 4LJ9A 1PPNA 1BMLC 2DHZA 2DCCA 2IGHA 2DZIA 1D5ZC 2J53A 1E8YA 1NENB 2WS3B 2KN5A 4TQ1A 4ARCA 2VF7A 2OO9A 2ONQA 3B1LX 3KW5B 3C58A 2WDVB 3KUZA 3FRHA 4IBGA 1FD6A 1XCQL 3SAWA 3U8EA 1GABA 2DZMA 4IBJA 3U4EG 1SP4B 1ZCMA 3EFUA 3X0WA 2R62A 2JF5A 2JTCA 1KFVA 3ZJUA 4GXBA 5AUKA 4ZTBA 4G3OA 2KXJA 3N9YC 2GQFA 4LNIA 5DCNA 1NHWC 4LJ6A 3HM3A 3PGEA 4ANRA 4KHPM 3PZDA 1NHGC 2BWFA 4II3B 1K3XA 3WIMA 4YYVA 1MEMA 2L2DA 3R3MA 2JQFR 4WP2A 1UBQA 1X1MA 1NY5A 1P3QQ 1HQYE 2JRHA 3JSVB 3K9PB 4JQWC 5J18A 2G1EA 5AZHA 4YY3M 2HD5A 2KTRB 4I6PA 4G54A 4A90A 1WXAA 1E8ZA 3HWSA 3ZXRA 2JWUA 2KNVA 3SR6A 1J8CA 4YXDB 2FNAA 4JX1C 2XU1A 2IJ0A 1P9DU 4W9HA 5CHFA 5KQ8A 2FUDA 2DZKA 3IV2A 4BOUA 2DCBA 3IHPA 2ZVNA 3ENEA 2OOBB 1EWCA 2WXRA 2LHEA 3ECIA 2PTLA 3FTDA 4C56C 2AIMA 1TH4A 1OGWA 3H89A 1PFDA 2LGSA 5JH5C 3HHAA 4DR2M 2NBUA 5L95C 3U2SC 3U7ZA 1S3SG 3HY5A 4RNAA 4II2B 3KP1E 2DWZB 3T8MA 2N1WA 3FUWA 2G4DB 4QBBA 1SG9A 5CHWA 1WWTA 5FKAC 3VH3B 1IXRC 3RNFC 4LG2A 2KOXA 2LASA 1TKGA 2Y5CA 3JR5A 1A5RA 1WGGA 3I9V1 2BWEA 2Y20A 3FKYA 2D7EA 4JI0M 2Y5PA 3HK0A 1T6BX 3Q3JA 1T43A 4QRXA 4MSXA 1PQSA 1QDTA 1KOTA 3SYKA 1TR8A 2QCZA 4X57B 1C3TA 1P98A 4L23A 2DX5B 1XHBA 1U4AA 2JT4B 1AU3A 4EEWA 4PDGA 1OEYJ 1NYQA 4DR7M 3M63B 2DWMA 4D8EA 3IG5A 1EWMA 2JU6X 4I6LB 3DBRB 4CISA 2IO3B 1SXJD 5HKHA 2XGNA 2X38A 2N7JA 2J7NA 3FC4A 4ZUXU 5DYIA 2XLJA 2N9EB 4GGQA 3HIZA 1JB0F 2JY7A 4JE3B 4FHKA 5GMVA 2KD0A 3V05A 1EWOA 2ZW1A 2VIIA 5BYQA 2KA6B 2KQ4X 5ITQA 4KLNA 8PCHA 2JVCA 5E6JA 3BVZA 4FXCA 4KZCA 1L8QA 2BWBA 2DCAA 4NQLB 1BXTA 3Q8XA 2M19A 2OHFA 4AP4C 3GZNB 1R2YA 1TIFA 4EFOA 1NNJA 1KFYB 1GJZA 1PBHA 4MI7A 4GEWA 1RU3A 2WZJA 2DENA 1N5XA 1AU0A 3N4CA 3OJ3A 4IWPA 3SEBA 5E6PA 4RGOS 5E6NA 5IREB 3DVGY 3ZNHB 5HHDG 4AUQC 2INDC 4WWNA 5TR5A 3L54A 3NVWA 2BYEA 3MK6A 2QMTA 2JPHA 4QRVA 5ITRA 1V6EA 4WURA 3T6PA 3GQ5A 2Y0TA 2KNZA 3RT3B 5EDSA 4TUUA 1QOGA 8CATA 2J7QA 3L28A 2O5RA 1N32M 4GUAA 4M01A 4X65M 3W68A 1WJNA 2GHUA 1SJHD 3PVLA 3ZW3A 2PVGC 4NOOB 2AUXA 2NPTB 2LTUA 4KODA 4RKXA 2CU1A 4JI6M 2MBOA 3NJTA 4W9GA 3NY5A 3QAUA 2CHVA 5A24A 1HZ6A 1AU2A 2L32A 4RCOA 2KNAA 1GOZA 4YTNB 3PSEA 4DBGA 4JIOU 4GC5A 2BDZA 4CHKA 1HXYD 2CKHB 1J09A 3MC0B 2QZ4A 3GS2A 4YYUA 2O6VD 2CB5A 3BOSA 4GLSC 3IAS1 4W5WA 4OU7A 4PK1A 4NZLB 3GCBA 1R4GA 4WQOB 4YYSA 4W5CA 4LFBM 4ZOHC 4JWUC 3CH3X 1WFYA 1Z2MA 2L0FA 1TDHA 2IPKD 4XUIA 4GC9A 5CVOB 4JI4M 2RPVA 1MHWA 2I1JA 4LFAM 3JR4A 3PZ7A 3KOXE 2JUJA 1N36M 2W3SA 2AU1A 2JY6B 2CV2A 3BOWA 1FJGM 4NXNM 3DBHB 3V6EB 3GPYA 1R7SA 1K50A 1WHCA 3L2AA 1NPZA 3I3TB 4FWGA 3FYDA 2PREA 4NNJB 4M9SA 4XX5A 4MB7A 1V34A 1VDLA 4II7A 4G4NA 1E32A 1J0GA 1TJEA 2LJIA 3GLHB 1D2NA 4L6V6 1Q5WB 2WXIA 4XWTA 3HGIA 4FJYA 4DR5M 1R4NB 1XQQA 2V4IB 1NI2A 2EA0A 2KWCA 4D81A 4RGMA 2VZKD 2C0YA 3BPMA 1C4CA 2O25A 2N7EA 2D5GA 3QARA 4PP2E 4PS8A 3J9CA 1POPA 3V6CA 1EE8A 4IBDA 3K1JA 2KNBA 1MHHE 2K8HA 4FA6A 1N63A 3RPFC 4F1IA 3FILA 1GO5A 3UF8A 4G4QA 2WXNA 4HDQA 3M95A 3Q3MC 1E5WA 4MACA 3RZWC 2Z8LA 3VQIA 3B7QA 3H7DA 5EE1A 3TSSA 3ZNZB 2DAJA 4CDCB 3T3OA 3U60B 5FK9C 2GB1A 1GL6A 3H1UA 4OVVA 2RPQA 3IMAA 1BVSA 1C4PA 5BPVA 1SIJA 1TS2A 4HCNB 4FWHA 2YJ9A 1HTOA 2MLBA 2M1MA 3HRDD 3ZLZA 4UN2B 1FXIA 2LHCA 3AN1A 1FCCC 3KOZE 1BGOA 4LGYA 1V97A 1GNUA 2DLBA 3KX1A 4MGKE 1TTEA 2KWUB 2R46A 1XNRM 2DZYA 2QHOA 5G5HA 2G6DA 3UIOB 2W82A 1R7RA 4RY2A 2XNAC 2K39A 2WNMA 3V3XA 4ZPXA 3OAWA 3GP1A 3D8BA 1L2NA 1EF5A 3JAMS 1ZXHA 1Z6TA 2NBVB 3P5VA 3GLIE 2CHWA 4NJ7A 1V5TA 3DBLI 3SAUA 2SEBD 4DV0M 1RLFA 2V6ZM 2LUMA 5EF4A 3FUUA 1E10A 2UXBM 2RD0A 1YN4A 4W9EA 1TL9A 1WIAA 1ZGUB 1D4BA 4XR7A 1IXSB 2AYOA 4WWOA 1DO0A 2TSSA 4G3XB 3I01M 2WX0A 3QWZB 2L05A 2V3PA 4N4ZA 3A4SC 4HLEA 3O65A 3EIEA 3VLFB 5IA7A 5CHVA 1UBIA 2GBKA 1ZIVA 2DCDA 3H7PB 3Q3FA 4HRSA 2R18A 4FBJB 5AZGA 4OZBA 5ITTA 3P4QB 3ZIMA 2R2QA 1WGNA 2KC1A 3RVXA 1AYUA 3GLFE 1VEGA 1Q3BA 2R9OA 4I04A 1P3QU 3Q8CA 3BYTB 2KRKA 2FFJA 4LRTA 4PDIA 1JQJC 2WDQB 4GH9A 1BP4A 2MBHA 3K24A 4DXAB 4K7CA 2CP8A 2H89B 4DV5M 1WJ7A 5IAAC 2F1GA 2YR0A 2Z0EB 2BS2B 2KFJA 1QVRA 2LVOA 1BQIA 2J0MA 3IECA 2IBIA 2LBCA 2FCQA 2KFKA 3KWBX 4CGYB 4GKKM 4QHSA 3HX3A 1PGXA 2QILA 2JQRB 1EWLA 2L4EA 2E6XA 3FTCA 4HJKA 3PXGA 4GITA 2GI9A 2MJDA 5CHVC 3MTVA 4I81A 2WWZA 2BU3A 2JA2A 2I2YA 2Y6EA 2MH8A 1YSYA 1E0ZA 2C60A 2JZ3B 1HNXM 2KACA 3W2DA 3A9KA 1G8PA 4IOIE 4L8RC 3P42A 2C7NB 1KLUD 4G4RA 4KSKC 2XK5A 2R45A 4K7WA 2IGGA 3U6PA 2WSEF 3H6NA 3TNXA 3Q2AC 2Z8YM 3HU1A 2FQ9A 5FTKA 4DMYA 5D3DA 2K0PA 2L8JA 3KVFB 1AN8A 1MJDA 4GDLA 4IWQA 4B9KA 3NRZA 1SXJC 4P1BC 4GB9A 3SARA 1LFDA 2YLMA 2ZCCA 3IXSA 4WWPA 3V60A 3UQBA 1RAXA 2D2QA 1OAOC 2K9DA 5CX3A 2RRUA 4K81A 1CQVA 4CO7A 4BOSA 1VJKA 3LVWA 3ZQ4A 1N61A 2BBCA 1QT9A 1HJPA 1F9JA 3UJNA 2MH7A 4HEA1 2CEAA 3NVVA 1DGGA 4OHJA 2DJGB 2V1UA 3KXEC 4LCDE 2G3QA 3GQ3A 1NI3A 1I4GA 2PVOD 1TKEA 2UWQA 4R71A 3APCA 3PRPB 3KH0A 2V1CA 1Y4HA 3LFYA 3KS4A 3I04M 2BJWA 1R2ZA 2XU5A 5FPWA 2X4AA 2JWSA 4LJ4A 1TY2A 2L4FA 1TH3A 5G2NA 3QYBA 5EGWA 2RSUA 1X9YA 1GPXA 3PHXB 1LXDA 1ZMUA 4WIPA 4YYWA 2RDGA 1FO4A 1JQ4A 1YQ3B 3LJ3A 4HWYA 2LVAA 4A3OA 1E9RA 1L4ZB 3PHWA 3VKGA 1ZOYB 4NAWB 3IEJA 4GSWA 3IFWB 3C3DA 1YX5B 5IN7A 3VDPA 2AWTA 3EGRA 4LJOB 4RM9A 4MEMA 4A6QA 3WAPA 3A46A 4NRWA 1VLBA 3THGA 5BO4B 3F92A 3VTUA 2XZFA 4LF5M 1K3BB 1QOLA 3H4MA 1IBLM 1CZPA 2F5OA 4IBFA 3SMSA 3U6CA 2MQJA 1WXSA 4GMVA 1MPEA 3CBKA 2ARYA 1TS5A 4CDFB 4L2YA 5G5GA 3W0FA 1L0YB 1MS6A 2N7DA 1QUSA 1NV9A 4C4VA 2V4LA 2LVPA 2G4SA 3H9DA 4MELA 2DC6A 1T0SC 1WZ0A 3KOYE 3S2AA 5F02A 1J19A 1OJLA 1D6EC 2Q2EB 3AKZA 2JWZA 4LCBA 3KWZA 4R3DA 1TLOA 4OELA 1GCBA 1SBBB 2DAFA 3QHTA 2JQGR 4HROA 3SMPA 2K6BA 2L0TA 1JR3E 4TQ0A 2HTME 4M0WA 1ZPSA 5LLIA 2MA9B 5KHQA 2LGYA 4DV3M 1TU6A 3K8UA 2R9FA 2KKCA 1V49A 3L26A 2ZPNA 3M3JA 3AOEA 1N78A 2NQ8C 1HR0M 2Y0QA 3C3EA 5HG2A 3H6SA 5JHBA 2P86A 1WGLA 3AXCA 1N6ZA 2FNJB 2N9LA 1Z5BA 3SHQA 1FFUA 1OQYA 1TGUA 4EUTA 1BT0A 2M60A 4QNMA 3UINB 2HD5B 4PT5A 3QA8A 4WWMA 1KFUL 1PXVA 2UZJA 1J5EM 1C79A 3OTOM 3GRVA 1MDWA 2D7HA 1F1HA 3WXGA 1MJGM 4S17A 1F2BA 4J3OD 4E74A 4WJPA 2Z7JA 5DPSA 4HKZE 4GMQA 2FBWB 4Q8HA 4B95A 2QJLA 4N79A 1GC7A 4FIPA 4I6NB 2PW9A 3P5XA 1WXQA 2YEPB 2L6OA 3E46A 3AOEC 1NEKB 1DYQA 4AI6A 3VUWA 1SJED 5HFYA 2XU3A 1ORYB 2LD9A 3MHZA 1D5XC 3EIHA 3T38A 4BFRA 1OEYA 1F0ZA 1OAIA 1JW9D 1BUIC 2H88B 2D7GA 3E21A 5C18A 4KGTA 3FUXA 1DF0A 3NHEB 3B9PA 4AW4A 2Z4RA 3CSTA 4TUWA 2K25A 2A4ZA 1E6EB 3I57A 2FCNA 1OKSA 3ONSA 4A3PA 4W9IA 4MM3A 3TIXA 4JI8M 4AJWA 2G7YA 2EKFA 3NWLA 2WDRB 4I8OA 3SATA 2JSVX 1K52A 3NBIA 2M56B 1HQRD 4NL4H 3FUTA 2JYEA 2ZPYA 3A9JA 2CJNA 4M9ZA 2INPE 1OFHA 3L13A 3ZRCA 3R9XB 2V9HA 2WGSA 1TY0A 2PEAA 3ABVB 2XBBC 3ZYYX 4AZFA 1Q0WB 5BYSA 4B3MM 3IT6B 3TWKA 1YZBA 4WAAA 2K5PA 2E03A 3D6SA 2KK8A 1V5OA 2PE6B 2DHYA 3N1ZC 1PJQA 1FH0A 3GRRA 3VDUA 2EJSA 1WI0A 1VZ8A 1N60A 2V3SA 4ZYSA 2LEKA 5CTRC 3E9SA 1NQCA 2XN9C 1ZMVA 3L27A 4IBBA 4DHZE 3K9OA 4LF7M 1QANA 3IVFA 2ZVOA 2WXJA 2JZZA 3BWUD 3VDZA 2IDYA 1AW7A 1T3QA 5FR3A 1SNKA 4KV2A 4OVUA 4DDID 2NQGA 3U61A 1Q39A 1GKIA 2VQFM 2IY0B 1YQ4B 2KX0A 2HL7A 3GLHE 2AL3A 2DENB 1NJGA 1K8RB 4EZJA 1Z5SB 3RGPA 3UQAA 2ERCA 2C98A 3LXSA 5EXXA 2L52A 1B9RA 3K8ZA 1NBFC 3HHZA 1CB5A 4CHTB 1ZDXA 4ANVA 1R4MB 3B9JA 3KLSX 3HJSA 2CIOA 4YV8A 2N1VA 3GLIA 1SB3C 1WE7A 3BIID 2Z59B 4G4OA 1AWDA 3LYYA 2J7QB 2YFQA 3GPPA 1WX8A 1V1PA 4K7SA 4LNNA 1PIPA 2R4EA 4BKTA 1I7HA 4NSOB 1I4PA 1UH6A 4JI3M 2PLPA 4X6IA 2M8SA 2G8JA 3PT2A 3GQ4A 2CRUA 1E7PB 3AEDB 1AIPC 2DWLA 1FFVA 2B1NA 2BTWA 3DA1A 1YUBA 3ZDMC 1C78A 2D10A 2L7RA 4XE0A 3MFGA 3KP0E 4QH6A 1ZW7A 4ZRQA 4BOZA 3A42A 2B1MA 3DVNU 3HU3A 4GKJM 1KTKA 5LNK1 1I4HA 3FUVA 3GLFA 5GXGB 4DBGB 3Q3NC 4YHHM 4P7IA 2FUG1 2Z84A 4M9XA 2C96A 2R9MA 5FTMA 2DYBA 1GLNA 1TGZB 4AKHA 5CVMA 2LNHC 1HQCA 4BOQA 3IHPC 3WAOA 3VFDA 2MRPA 3WA0A 4AJYB 3QK0A 1JWUD 1PGBA 4JI2M 1UNSA 2D3BA 3B0AA 1NY6A 2JZPA 1T5XD 1ICFA 5JI2E 4DV4M 3P2BA 2WU5B 3WXFA 2WXLA 2WXMA 3PFIA 1GB1A 2CE7A 1F52A 2E01A 4F8CB 2KRUA 4RKUF 2J0JA 4KIKA 1DEUA 5FTJA 3N1XC 4LRSA 2KMAA 4BVUC 2ZBKB 2N35A 2K3UA 4B08A 2AYNA 1KLGD 4YYRA 1I94M 1LO5D 1WYWB 1I4XA 1WMHA 1QYRA 3TQSA 1L2CA 3KYDD 1FNWA 2K8BA 4D8BA 4ITKA 3KW9A 3ILKA 2UUAM 2DKLA 3ZTCA 2DZOB 2N0SB 2JZ0A 2HKJA 2ZNVC 3P4PB 3RYTA 4PCZA 5AEKB 3B79A 1WX7A 4B3TM 1WM3A 1WSPA 4B7FA 2C5RA 1XXGA 4ICVA 1QMYA 2WP9B 4M02A 2XH9A 4FJCA 3RNGC 2ZEQA 5J94A 4YYQA 3AE6B 3V6CB 1PJSA 1E90A 2L00B 4MGHA 4FHJA 2WDTB 3DBRI 4BS5A 4B3RM 4EIWA 3VR8B 4JI5M 4PP1A 1SF0A 3GLGB 2MJ5B 1Q1OA 4WW0A 1IXZA 4G6ZA 1I35A 1GLOA 4C80A 2LJ5A 4G0NB 2KDEB 3T1HM 4JI7M 1UZXB 2QIEB 2K8CA 1O0EA 3CBJA 2VH2A 4NC6A 2F5SA 3SDLC 2X8AA 3AEGB 1LM8B 5J17A 1PJIA 2XFTA 4KDLB 3P5WA 2EELA 3W5UB 3P4RB 2L76A 3J2PB 2LGXA 2LXCA 5G55A 1ZE3D 2QPAA 1VDVA 4YSZB 2EMTA 2HWKA 2KJRA 3GE8C 3N32A 4LF8M 1MX0A 2H5XA 3GZNI 1WGYA 3O1GA 2ICIA 3FAHA 4IUMA 1FCLA 4LZJA 2AS8A 1NB5A 3LB8C 1HNZM 3HUIA 3PNRA 3DDCB 2HTHA 2QHOB 3LXFA 2R6NA 3AE4B 1D0KA 1IYFA 3RNBC 2J7OA 4QHTA 1KRHA 1KJTA 2KW0A 4K7UA 3LCVB 3B7NA 2OOBA 2JY8A 3USVA 7CATA 1MN3A 3RFZB 3LW5F 2C7MB 4GRIA 1GJSA 2EMSA 2BPSA 2AYOB 2VRRB 1C7YA 5AZFA 1XKGA 2LGDA 2HXZA 3IUTA 1G59A 4BPVA 2I7PA 1XWIA 2J7QC 3X23A 5JI3E 2XZUA 3O65B 4GN1A 2XSZA 3ZO5B 4DR3M 2IPPB 2VF8A 1F2RI 3K92A 5ITUA 3GB1A 4WJOA 1MU5A 3TJPA 2L09A 5JHAA 1VR9A 5EP3A 2P7UA 3M99A 1L2DA 1WR1B 1BY8A 1GJTA 2I38A 1M94A 3RNAC 1VEJA 2BWES 3RULA 3U8ZA 2O2VA 5E6OA 1EWYC 1Q6KA 3Q8AA 2J4XA 1GL7A 3BVMA 2BDLA 2FOIC 3UIPB 1WRIA 3RNVA 4PYUA 4FCWA 3NVZA 1SXJB 5A2QS 1XMOM 1RM6C 3DHHC 4EE2A 1ATKA 2C7HA 3BWKA 5FTNA 1P7FA 2J42A 2RGFA 4URKA 1NL6A 2YVCA 4C7YA 2H1RA 1J7KA 3PVSA 5K16A 3U5ZA 2DWQA 1NLJA 2CS4A 2W3RA 4A55A 1XLOA 2LVQA 1FXTB 4GDKB 4IBEA 2OOAA 3MJWA 4HCPB 3DBHI 4LLGM 3A9KB 3IAM1 4LJPB 5BR8M 3AH7A 1L1ZA 2XK5B 1OTRA 1JWAD 2C5LC 1E7VA 3W1YA 4REZA 3AE2B 1R4NI 2V3NA 3NZUA 2DAIA 3AE8B 2KLGA 4GDLB 1S1QB 4Q8GA 3L08A 2CWBA 3CF2A 4YSXB 3AJIB 5ITXA 2ZJDA 3KUCB 3DF0A 3PPAA 5JXVA 5EE9A 1IN5A 2YJ2A 3KSJA 2IYDB 1QOFA 1MEGA 3CGWA 1CVZA 2QDFA 4JWSC 1DOXA 2G3QB 4GHAA 1OQRA 3DWGC 4D8IA 3IFUA 2AEHA 1Y08A 3BK1A 1CPJA 1RWSA 2OEDA 4HXDA 1XXHE 4FCVA 2IO1B 2JYTA 3TBLD 2C99A 1V1OA 1E8WA 1G3IA 2CHXA 4DR1M 5TSSA 2LHGA 4BAXA 5T8IA 2KZUA 1FXAA 3LQQA 3L10B 1JWMD 2D11A 1UD7A 2KWDA 3RE8A 4NXMM 2DZLA 2NTTA 3AE3B 2RGHA 3C0RA 3Q8EA 2UUCM 4NSRA 3VK8A 1QILA 2IO2B 2N9PC 2WQYB 3TWLA 4J6IA 2NR2A 3M62B 3LVVA 1JRPA 1WRDB 3CMMB 2G5GX 3HHYA 1WM2A 2BYVE 1QAMA 2K22A 5MPOA 2LHDA 2O6VB 1IP9A 4JV5M 3PHWB 4QNRA 4ANUA 4A8XC 2GBNA 2C9CA 4L78A 3GRYA 2AQ3B 4KDIC 4LDTD 1PRBA 5EJCA 1YNTE 1UKFA 4B6WA 2ZW0A 4LF9M 3MTNA 4N58A 3HM6X 4PYZA 1YD8U 3PZ8A 1QQRA 3AEAB 2LVNC 4CZWA 4W4UA 3AU4A 1KYIA 4AG6A 3M6AA 1T0QC 1QF6A 1YQBA 1DV0A 3PLVA 1V92A 2V1YA 4GOCA 4IKGA 2GLSA 4IM0A 1PPPA 3PBHA 4AKGA 3TCAA 2KHWB 1ET9A 4C4VB 3QSDA 2JY6A 1KSFX 2DYOA 4AXLA 2IO0B 4BB9A 4OW0A 3K2LA 1R5LA 2JNHA 1NJFA 1J7BA 3A1QA 3NUHB 4X6JA 1CV8A 1FNNA 3I3TA 4ZRPA 1MG4A 1JCKB 2DOSA 1ZKHA 1SE4A 2EKEC 1QAOA 2UXDM 2W54A 2ZANA 3GLHA 1UGMA 2VZKB 5KPZA 1WXMA 1OFIA 2XU4A 2AQ2B 3NS1A 4US8A 3UGBB 3VFKA 3TE6A 2OQ4A 3KUDB 1XEEA 2YJ8A 4M0WB 3AE1B 3U6LA 2DZJA 3V76A 2DZZA 2BJVA 2LVOC 2WXKA 3V62A 1TKYA 4IG7B 3RZFA 3UZUA 2LI5A 3R8BA 3HHWA 1YT7A 1F77A 1U9WA 5I4DA 1F2AA 3OVZA 3ZGZA 1QLBB 2BTEA 3OISA 3NG0A 3SHGB 1ZAEA 2R6FA 3SBJA 2DNFA 2X8XX 3AB5A 3APFA 4FJVB 2R0IA 4IC7B 3ZC7B 1DGHA 2KX3A 4HPPA 1YK7A 4IM2A 1M6DA 2NTSA 3BZDB 3IBEA 4XK8F 3FRIA 4BQVA 3ERVA 2M0XA 4MSMB 1V33A 3W1SA 1D0LA 3ZH9B 4RFBA 4WJNA 4YTPB 2FTDA 1PGYA 4AQYM 4MGYE 4X64M 4RF1A 1YIWA 4KGSA 1OIZA 3PRZA 3VRAB 3U7DA 2JXTA 3D8LA 1T6OA 5D94A 1GECE 1HE8A 2JRIA 3ML8A 3WCQA 3H8CA 3KYCD 4BOSC 2G8LA 3BK2A 3QQ8B 2MGWA 3U52E 3N20C 1VZ7A 4PD2A 2K47A 1I4QA 3MP9A 1IXSA 3MJ5A 4XC2A 4KSLC 2MR9A 3VR9B 1VEKA 3K9MA 4TSSA 2EKIA 2RDBC 2ZTCA 2FAZA 3KWLA 5EP1A 3BCNA 1NYRA 1WJ6A 2MBQA 3GP7A 4IW0A 2Z3XA 2NVUI 1SIFA 3OWEB 3KOWE 3VAWA 1U9QX 2I1KA 2RR9A 2KTFA 4BLCA 4MGZE 3O13A 4TKNA 4ZRKA 5JZEB 3CTWB 3HVZA 3U30A 1J7CA 4LFCM 1V9JA 2A5YB 4MZOA 5FSWA 4PADA 2EUCA 1WXVA 5DFLA 4NAMA 2REXA 3HZJA 2YNMD 1V86A 2PJHA 4Z8XA 2KMMA 1XCTL 5JA7A 3V61A 2K1FA 4AXMA 3HVDA 3Q69A 3EHVA 1XD3B 4IM3A 3FTFA 2ZAMA 1AARA 1D3ZA 3ZQJA 1MHXA 3BBZA 5KQDA 4OVZA 4DR4M 2DAEA 2LRWA 3QT4A 2QBYA 1H6UA 5DYGA 4F2LA 4DHJD 3K9OB 5PADA 2G9HD 4BOPA 2MJEA 1ZXIA 1GG3A 5BMIA 1P7EA 1UWXA 3L29A 3TPZA 3P5UA 4LJ8A 1VSNA 4W9DA 1FRDA 1PUTA 1L5PA 2CHQA 2GFOA 4HLQA 3TEXA 3U61B 2WLBA 3TWMA 3F75A 4L1BA 1T0RC 3WAMA 3H8HA 3NZ3A 2J52A 2FT2A 5EQTA 2DAGA 2LVPC 1EFUB 2F5PA 2D3AA 3KS8A 4M8MA 4XZ4A 3AEBB 1NNUC 4FWDA 3U6SA 3U6OA 4KKIA 2BB5A 4C00A 1EF7A 1TS3A 2DC7A 3SASA 3J81S 1KF6B 4A3VB 4GU2A 2MP2A 2C9WB 1FNUA 4MH0E 2JXNA 1JMLA 4E3CA 3TUOA 2FH0A 1QOBA 1IPGA 1C77A 1VQ1A 2MJ3A 3E56A 3R2TA 1HUCB 4AQ7A 1XT9B 3WHKA 5IP4D 1GUAB 3FYCA 3GLGE 1V1PB 4B7GA 1FNVA 2Y21A 4BZAA 4W5BA 2NMQA 2BNKA 4MT5A 2Y5BA 3BBAA 4YT0B 5LMUM 3PT2B 4LJ7A 4WA6A 2XEWA 4CYEA 2XEPA 3B74A 2BTWB 5EZSA 1HT2E 2HDEA 2DVWB 1QZMA 4MJSA 4XDCA 2VHFA 4BOZB 1H8CA 2M4NA 2E02A 4AG5A 4JN6A 4K1RB 2JY5A 1SGHA 4FADA 2XSZD 3QJ3A 1UUPA 3GLFB 4GHLA 2VDBB 1TS4A 4OZCA 3S3RA 1XLPA 5EXTA 2HCBA 4A20A 1LTMA 1P0RA 1Q10A 4IJFA 2MCNB 1IBMM 4FW9A 2GBRA 2ZNVB 4X62M 2J5YA 2KDLA 4D82A 3RNCC 1DKIA 2BS4B 1XLQA 4QOZC 1LGRA 2IZVB 3A33B 2KC2A 3DPDA 1CTEA 1NDDA 2IGDA 4HK2A 3RNEC 1FIQA 3IG3A 3BINA 2DYMA 1EIJA 4KIKB 4PI3A 1RYJA 4JLCA 2BYFA 3I06A 3RUIB 4K3CA 1I4RA 2LGIA 1A5TA 3U6EA 3ZDTA 1V80A 3DQVA 1WMHB 4MH8A 1DO2A 1S3SA 2G45B 1PJJA 4M00A 3KWVA 2LZ6A 2LVQD 4GIPA 1CSBB 2ZCBA 1DGJA 1TZ1A 3IOQA 1X37A 1D5MC 2KVRA 5J2RA 2NBWB 4CQNA 1KLVA 1AIMA 3FTEA 4DUZM 1U9VA 1ZP0B 4Y28F 5C2TB 1CJEA 2LWXA 4DHJB 5KO3A 2E00A 2QQ8A 2QEJC 4IIWA 3ZNID 2DWNA 1IGDA 2GOWA 3SC3A 5AUIA 1WY8A 1SXJE 4LJ5A 2FS1A 4N6EB 5C1ZA 3OJ4B 5FR6A 3OQCA 2ON8A 3HKPA 3T1YM 1TH2A 2KXEA 2V0GA 4EZLA 3KVWA 2OULA 3TMPA 1TT5B 4ZDVA 2MBBB 1WH3A 4AWJA 2BVCA 3J27B 2KDMA 1KHQA 3PLUA 3R2IA 1XXHA 2KAJA 3ZTDA 1YE9A 2LMCA 2KEBA 1KH0A 4EZKA 4IUMB 4RM8A 2EO2A 3T15A 2PNSA 3C9EA 1G6JA 5LXIB 1MI0A 3HJ8A 2VHSA 1C4AA 5IZ7D 2LUEA 4NY0A 1ZV1A 4NPNA 4XZXA 2JXXA 2OP3A 9PAPA 5FLXS 3N3KA 1S4VA 4S0RA 3HWNA 1L4DB 2FRAA 5FTLA 1CMXB 1HEZE 2W55A 1EUVB 2LFIA 2SAKA 5H92C 5BYRA 3BB7A 2Z0DB 1U9XA 2NQIA 3AFHA 4XGIA 4BKSA 1ZUD2 2KJHB 1R4MI 3PSEB 5D2MB 3WANA 4ARIA 2MEKA 1EO6A 1SXTA 4ZRIA 3QX1A 1PJTA 1WJUA 3NVYA 1IBXA 2FRQA 4EKUA 2CV1A 3L16A 3Q6BA 2MX2A 2DAMA 1ZDVA 1PDXA 4OX9M 3NHEA 1U5IA 3NZSA 1JALA 3HJQA 2QP9X 1QAQA 1EU4A 4AOFA 2J0KA 3PRMA 2R44A 4P17A 3N30A 3VTWA 1F29A 2FIFA 1XLNA 2F4VM 3ZNGC 1Y8GA 3SD5A 3MC9A 3NS8A 2D07B 4OEMA 1OQQA 2O2VB 1L0VB 1W5TA 5C1BA 5C3JB 4HKQA 1STEA 3QYEA 4E71A 3W31A 3DWMA 3L4PA 3SYLA 1WIVA 3A4RA 3I51A 1I42A 4LF6M 5CVNB 4H2AA 3B7ZA 1YALA 1A70A 3M0EA 3TEZA 1XO3A 3BY4A 4HWIB 3L25A 2KWVB 3JW0X 1WGDA 1UF0A 3PNVA 4JPSA 1C9FA 4NRVA 4LGMA 2WXGA 2H7JA 4NJ6A 3U5ZB 1J7AA 3AEEB 5KPRA 2R2OA 1V8CA 4AS1A 2HAKA 3C9PA 3VVWB 3AV0A 5CHTA 3FILB 3LCUA 3IG8A 1QZEA 3LMMA 1Z59A 2OPFA 2KN4A 1YLAA 2B76B 2LWPA 3TRKA 1IQPA 1RFKA 2FO5A 1JROA 1IY2A 2XFSA 3L0WB 1OTRB 3DOAA 4HPMB 1Q02A 4DUYM 1A6RA 1WYGA 1UELA 4KGRA 2M5ZA 1AUAA 1JWBD 3SU8X 1NO1A 4L16A 1FRRA 1TBEA 3B2FA 4LNKA 3GPUA 2KVZA 4P1CC 2CR5A 4LY6A 3VKHA 5BMGA 2KANA 3K9PA 3JSVA 1KXRA 2ACTA 4BS6A 1Z5CA 4CDEB 2WSCF 4FLHA 5GKNA 2KTRA 3Q8BA 3PHUA 3JYUA 2JUOA 2MSED 3J7BA 1JQPA 1CJLA 4Z6YA 3KSEA 3DHGC 4LJAA 1L6UA 3MHVC 3DFZA 3A45A 4LNFA 4O1NA 4YVAA 3PNYA 3AI8A 4RH6A 3GOEA 1K82A 3M7GA 4B0EA 1N33M 1IN6A 4GIVA 1H4RA 4M0DA 2A5UA 6PADA 1I4WA 5L8RF 1ME4A 4JI1M 4HXDB 1Y56A 3B21A 2ZTDA 4RGTA 4LZZA 3Q8FA 4FULA 2EKKA 2UXCM 2KDFB 2WYQA 2XF3A 1NVID 2QENA 1IGCA 2B3TA 1N62A 3BYYB 4LNOA 4W9LA 4DQOC 3PS6A 3AE5B 2I7NA 1HT1E 2UU7A 3C0RB 3VUXA 1IM2A 1UWMA 4XGAB 2CUZA 1TDZA 3T9LA 2MWSB 1WZ3A 2DI0A 1L1TA 2PMVA 2QC8A 1UGJA 1QOAA 2GBJA 1GB4A 2B3AA 3SFDB 5HI1A 3AV8A 3AE7B 3ZUAA 3AM9A 3SHFA 1WJ4A 2F5QA 4W9JA 4JGHB 3EUB2 3W0LB 3IT4B 4N8WA 1QKZA 4IBKA 4KT0F 2R9NA 1YN3A 3PREA 1WE6A 3OF9A 3OVXA 2QCUA 3J7AS 3MTNB 1NVMA 4ACFA
chains in the Genus database with same CATH topology
4DV1M 2DXIA 3LQRA 1JR3A 1NSFA 3E4RA 1YMHE 1XC8A 4YWGG 1TYGB 3AEFB 1YJJA 3ETRA 1G41A 2PKOA 1MVKA 5EE3A 4UDUC 3RGSA 4US9A 2WXOA 2R65A 4AKIA 4NJCA 3W5VB 1L2BA 1GVNA 1Z5AA 4XWWA 3P63A 4B7HA 3ZCBB 2GRIA 4R7GA 2WXPA 3GLGA 4B3SM 1LV7A 2RDHA 3TEYA 4DV6M 1SEBD 2RMMA 1PM5A 3ZNHA 4DR6M 1N5WA 3SFZA 3VRBB 2YQZA 1DGHB 1N75A 4X66M 1K51A 3U6MA 2AGAA 4IJEA 4ITQA 1QQWA 3TEWA 3PO0A 4Q2JA 3GPXA 2CU3A 2F5NA 4I5SA 1L6VA 4ZHOA 3GO8A 5H8YE 4K0KM 4USAA 3W30A 2WXHA 4P6VF 2P5TA 5F3WA 3BVGA 2VQEM 3R8FA 2Y3AA 4WAFA 4DV7M 3AECB 4A5UA 4S12A 5BMHA 4MGIE 5EP4A 4HL4A 1IN4A 3I4VA 4RF0A 3C8YA 1SSNA 3EA6A 1ESFA 4N59A 2AQ1B 4RGNA 1W5SA 2L83A 3AOGA 3WHLA 3U6DA 3A98B 1F2RC 3KQ4A 5IT9S 3KSXA 5EXSA 2WXFA 4OZAA 1FM0D 4BBAA 1E9SA 1YN5A 3VK7A 2BS3B 2E3TA 4YTMB 2AHMA 4WQMA 2BW2A 2N9KA 4JXJA 4OVZB 3UGJA 2AX5A 1SXJA 2E5LM 2QBYB 3AE9B 4IBIA 1SE3A 1TZOA 1IN7A 4LF4M 3HU2A 4KX6B 2DZNB 2M0AA 4XDDA 1E9MA 2LH0A 4DXFA 4XBOA 1ET6A 1L0XB 3U60A 3FKEA 2FE8A 3CF6E 4LK0M 3T3NA 4QOSA 3CF0A 5E26A 1AYFA 4KO8A 2BB6A 3AMZA 1VRAB 5D3IB 3TL4X 3W9CB 3ZJVA 4TMAB 3ZJTA 2RGOA 2L1AA 1C76A 2ZAOA 1N77A 2CV0A 4LTUA 3U6QA 2ACZB 4C7ZA 4IDIA 1SE2A 3DZDA 1OFFA 3HHXA 4MM3B 2RKOA 2X49A 1Q3CA 1ACCA 5KPTA 1XF5L 1EM7A 2UUBM 5IWAM 4A9AA 1PVJA 4D80A 5EXPA 1XMQM 1IUEA 2C9OA 2ZM6M 3J80S 1DOIA 4IP3A 3QWLA 1B1ZA 2CHGA 2K9XA 3KDSE 4D2KA 1IBKM 2KZSA 2Z4SA 3GRUA 4L4UA 3RFWA 5LMNM 4YSYB 3KW6A 2YEPF 4P16A 1E94E 2DHRA 2L7IA 3FD9A 1IY0A 2HHHM 5DNYA 3MP2A 1DGBA 1VDDA 2CFOA 3UI3A 2WXQA 3I4YA 1IN8A 1HNWM 1PGAA 3AL0C 1YJIA 5EP2A 1K3WA 3URYA 4HJGE 4FCTA 1UM8A 2BYTA 2R4JA 3GLIB 2UU9M 2QSDA 3SFEB 1PYWD 1WGKA 4FVMA 1XXHB 1XNQM 1CK1A 2R61A 1K53A 1IY1A 3P1MA 4L15A 1G4AE 2Q5WD 1T3TA 3UK6A 3UMMA 5D7GA 4IBCA 1GAQB 2INNE 3KFUG 1DGFA 1ZQ9A 4FD2A 3PRPA 5ITXE 3SAVA 1DOYA 2WU2B 1FMAD 1HZ5A 1N34M 1JWSD 1FEHA 1HA5A 1ROEA 3PHXA 1R6BX 3CIRB 1IBXB 2L7HA 2PIAA 4DXGA 4JYAM 4DV2M 2CJOA 3CWIA 5EE0A 2DBYA 2LXEA 1VZ6A 5EZQA 1JR3D 2BT6A 2JX5A 4KKJA 3B2GA 1ENFA 4ZHPA 1C1KA 3P4SB 1EU3A 5ITYA 4WH4A 5JZEA 4I4LA 1M4VA 5H37D 4B0MA 4LJ9A 1BMLC 2IGHA 1D5ZC 2J53A 1NENB 2WS3B 4TQ1A 4ARCA 2ONQA 3C58A 2WDVB 4IBGA 1FD6A 1XCQL 3SAWA 4IBJA 3U4EG 2R62A 2JTCA 1KFVA 3ZJUA 5AUKA 4ZTBA 3N9YC 1NHWC 4LJ6A 4KHPM 1NHGC 1K3XA 1NY5A 1HQYE 2G1EA 4YY3M 4A90A 3HWSA 2JWUA 3SR6A 4YXDB 2FNAA 4JX1C 2IJ0A 5KQ8A 4BOUA 1EWCA 2WXRA 2LHEA 2PTLA 3FTDA 4C56C 1TH4A 1PFDA 4DR2M 3U2SC 3U7ZA 4RNAA 3KP1E 2DWZB 3FUWA 1WWTA 5FKAC 1IXRC 4LG2A 1TKGA 2Y5CA 3JR5A 3I9V1 2Y20A 2D7EA 4JI0M 2Y5PA 1T6BX 3SYKA 4L23A 1XHBA 4PDGA 1NYQA 4DR7M 2DWMA 4D8EA 3IG5A 2JU6X 4CISA 1SXJD 2XGNA 2X38A 2N7JA 2J7NA 3FC4A 5DYIA 2XLJA 4JE3B 3V05A 2ZW1A 2VIIA 5BYQA 2KA6B 2KQ4X 5ITQA 4KLNA 4FXCA 5E6JA 3BVZA 1L8QA 1BXTA 3Q8XA 2M19A 2OHFA 1R2YA 1NNJA 1KFYB 4MI7A 1N5XA 3SEBA 4RGOS 5IREB 5HHDG 3NVWA 3MK6A 2QMTA 5ITRA 4WURA 3GQ5A 2Y0TA 1QOGA 8CATA 2J7QA 3L28A 2O5RA 1N32M 4GUAA 4X65M 1SJHD 2PVGC 4NOOB 4KODA 4RKXA 4JI6M 3QAUA 2CHVA 1HZ6A 2L32A 4RCOA 1GOZA 4YTNB 3PSEA 4GC5A 1HXYD 1J09A 3MC0B 2QZ4A 3GS2A 3BOSA 4GLSC 3IAS1 4W5WA 4OU7A 4NZLB 4LFBM 4ZOHC 4JWUC 1TDHA 2IPKD 4GC9A 4JI4M 2RPVA 4LFAM 3JR4A 3PZ7A 3KOXE 2W3SA 1N36M 2CV2A 1FJGM 4NXNM 3GPYA 1R7SA 1K50A 3L2AA 4FWGA 3FYDA 4M9SA 4MB7A 4II7A 4G4NA 1E32A 1TJEA 2LJIA 3GLHB 1D2NA 2WXIA 4XWTA 3HGIA 4DR5M 2V4IB 2EA0A 4RGMA 4D81A 2VZKD 1C4CA 2D5GA 3J9CA 1EE8A 4IBDA 3K1JA 1MHHE 1N63A 3RPFC 3FILA 4G4QA 2WXNA 4MACA 2Z8LA 3VQIA 5EE1A 3TSSA 3T3OA 3U60B 5FK9C 2GB1A 1GL6A 1C4PA 5BPVA 1SIJA 1TS2A 4FWHA 3HRDD 1FXIA 3AN1A 1FCCC 3KOZE 4LGYA 1V97A 2DLBA 4MGKE 2R46A 1XNRM 5G5HA 2W82A 1R7RA 2XNAC 2WNMA 3V3XA 4ZPXA 3GP1A 3D8BA 3JAMS 1ZXHA 1Z6TA 3SAUA 2SEBD 4DV0M 2V6ZM 2LUMA 3FUUA 1E10A 2UXBM 1YN4A 1D4BA 1IXSB 1DO0A 2TSSA 2V3PA 3O65A 3EIEA 3VLFB 4HRSA 2R18A 4OZBA 5ITTA 3P4QB 1Q3BA 3Q8CA 3BYTB 2KRKA 2FFJA 4LRTA 4PDIA 1JQJC 2WDQB 4GH9A 2H89B 4DV5M 2YR0A 2BS2B 1QVRA 4CGYB 4GKKM 4QHSA 1PGXA 2QILA 2JQRB 2E6XA 3FTCA 3PXGA 4GITA 2GI9A 2MJDA 3MTVA 4I81A 2BU3A 2JA2A 2I2YA 1YSYA 1E0ZA 1HNXM 2KACA 3W2DA 1G8PA 4IOIE 4L8RC 3P42A 1KLUD 4G4RA 2R45A 2IGGA 3U6PA 3HU1A 5FTKA 5D3DA 2K0PA 1AN8A 3NRZA 1SXJC 3SARA 3IXSA 1CQVA 4BOSA 1VJKA 3LVWA 3ZQ4A 1N61A 2BBCA 1QT9A 3UJNA 2MH7A 4HEA1 2CEAA 3NVVA 1DGGA 4OHJA 2V1UA 3KXEC 3GQ3A 1NI3A 1I4GA 2PVOD 1TKEA 2V1CA 3KS4A 2BJWA 1R2ZA 2X4AA 1TY2A 4LJ4A 1TH3A 1GPXA 4WIPA 2RDGA 1FO4A 1JQ4A 1YQ3B 1E9RA 1L4ZB 3PHWA 3VKGA 1ZOYB 4NAWB 3EGRA 3VDPA 4A6QA 3A46A 4NRWA 1VLBA 3THGA 2XZFA 4LF5M 3H4MA 1IBLM 1CZPA 2F5OA 4IBFA 3SMSA 3U6CA 1MPEA 1TS5A 4L2YA 5G5GA 3W0FA 1L0YB 3KOYE 1OJLA 1D6EC 2Q2EB 3AKZA 4LCBA 4R3DA 1SBBB 4HROA 3SMPA 4TQ0A 2HTME 4M0WA 1ZPSA 4DV3M 3L26A 3AOEA 1N78A 2NQ8C 1HR0M 2Y0QA 5HG2A 2N9LA 1Z5BA 1FFUA 1TGUA 2M60A 4QNMA 4PT5A 4WWMA 2UZJA 1J5EM 1C79A 3OTOM 3GRVA 2D7HA 4J3OD 2Z7JA 4HKZE 4GMQA 2FBWB 2QJLA 2PW9A 1WXQA 2YEPB 2L6OA 3AOEC 1NEKB 1DYQA 4AI6A 5HFYA 1SJED 1ORYB 3MHZA 1D5XC 3EIHA 3T38A 1F0ZA 1JW9D 1BUIC 2H88B 2D7GA 5C18A 4KGTA 3FUXA 3B9PA 4AW4A 2Z4RA 4TUWA 3I57A 1E6EB 4JI8M 3NWLA 2WDRB 4I8OA 3SATA 2JSVX 1K52A 3NBIA 2M56B 1HQRD 4NL4H 3FUTA 2JYEA 2CJNA 4M9ZA 2INPE 1OFHA 3R9XB 1TY0A 3ABVB 3ZYYX 4AZFA 5BYSA 4B3MM 3IT6B 3TWKA 1YZBA 2K5PA 3GRRA 3VDUA 4ZYSA 1VZ8A 1N60A 2LEKA 3E9SA 2XN9C 3L27A 4IBBA 4LF7M 1QANA 2WXJA 3BWUD 2IDYA 1AW7A 1T3QA 5FR3A 3U61A 1Q39A 1GKIA 2VQFM 1YQ4B 2HL7A 1NJGA 3RGPA 2ERCA 2C98A 5EXXA 2L52A 1B9RA 3K8ZA 3HHZA 4CHTB 1ZDXA 3B9JA 3KLSX 3HJSA 3GLIA 1SB3C 3BIID 4G4OA 1AWDA 3LYYA 2YFQA 3GPPA 1V1PA 2R4EA 1I7HA 4NSOB 1I4PA 4JI3M 2PLPA 3PT2A 3GQ4A 1E7PB 3AEDB 2DWLA 1FFVA 2BTWA 3DA1A 1YUBA 1C78A 4XE0A 3MFGA 3KP0E 4BOZA 4ZRQA 3A42A 3HU3A 4GKJM 1KTKA 5LNK1 1I4HA 3FUVA 3GLFA 5GXGB 4YHHM 2FUG1 2Z84A 4M9XA 2C96A 5FTMA 1GLNA 4AKHA 2LNHC 1HQCA 4BOQA 3VFDA 1JWUD 1PGBA 4JI2M 1UNSA 1NY6A 2JZPA 1T5XD 5JI2E 4DV4M 2WU5B 2WXLA 2WXMA 3PFIA 1GB1A 2CE7A 2KRUA 5FTJA 4LRSA 2ZBKB 2K3UA 4B08A 1KLGD 1I94M 1LO5D 1I4XA 1QYRA 3TQSA 1L2CA 1FNWA 4D8BA 4ITKA 3ILKA 2UUAM 2DZOB 2N0SB 2HKJA 3P4PB 4PCZA 4B3TM 1XXGA 1WSPA 4B7FA 2C5RA 2WP9B 2XH9A 3AE6B 4MGHA 4B3RM 4EIWA 3VR8B 4JI5M 3GLGB 1SF0A 4WW0A 1IXZA 4G6ZA 4C80A 3T1HM 4JI7M 2QIEB 2F5SA 2X8AA 3AEGB 1PJIA 2XFTA 2EELA 3W5UB 3P4RB 3J2PB 1ZE3D 2QPAA 1VDVA 4YSZB 2HWKA 4LF8M 1MX0A 2ICIA 3FAHA 4IUMA 1FCLA 4LZJA 3LB8C 1HNZM 3HUIA 3LXFA 3AE4B 2J7OA 4QHTA 1KRHA 2KW0A 7CATA 3RFZB 4GRIA 1G59A 2I7PA 1XWIA 2J7QC 5JI3E 2XZUA 2XSZA 4DR3M 1F2RI 3K92A 5ITUA 3GB1A 1MU5A 2L09A 1VR9A 5EP3A 1L2DA 2I38A 1EWYC 3Q8AA 2J4XA 1GL7A 3BVMA 2FOIC 1WRIA 3RNVA 4FCWA 3NVZA 1SXJB 5A2QS 1XMOM 1RM6C 4EE2A 5FTNA 1P7FA 2J42A 4C7YA 2H1RA 1J7KA 3PVSA 3U5ZA 2DWQA 4A55A 2W3RA 1XLOA 4GDKB 4IBEA 4LLGM 3IAM1 5BR8M 3AH7A 1L1ZA 1JWAD 4REZA 3AE2B 2V3NA 3AE8B 4GDLB 3CF2A 4YSXB 3AJIB 5ITXA 5JXVA 5EE9A 1IN5A 3KSJA 1QOFA 4JWSC 1DOXA 4GHAA 1OQRA 3DWGC 4D8IA 3IFUA 3BK1A 1RWSA 2OEDA 4FCVA 2JYTA 2C99A 1V1OA 1G3IA 5TSSA 4DR1M 5T8IA 2KZUA 1FXAA 3LQQA 1JWMD 2KWDA 3RE8A 4NXMM 2NTTA 3AE3B 2RGHA 3C0RA 3Q8EA 2UUCM 4NSRA 3VK8A 1QILA 2WQYB 3TWLA 3LVVA 1JRPA 2G5GX 3HHYA 1QAMA 2K22A 5MPOA 2LHDA 4JV5M 4QNRA 4A8XC 2C9CA 4L78A 3GRYA 2AQ3B 5EJCA 1YNTE 1UKFA 2ZW0A 4LF9M 4N58A 3PZ8A 1QQRA 3AEAB 1KYIA 4AG6A 3M6AA 1QF6A 4IKGA 4AKGA 1ET9A 1KSFX 2DYOA 4BB9A 4OW0A 3K2LA 1J7BA 1NJFA 3NUHB 1FNNA 4ZRPA 1JCKB 2DOSA 1SE4A 2W54A 1QAOA 2UXDM 2ZANA 3GLHA 2VZKB 5KPZA 1OFIA 2AQ2B 3NS1A 4US8A 3TE6A 2OQ4A 1XEEA 3AE1B 3U6LA 2BJVA 2WXKA 1TKYA 3UZUA 3R8BA 3HHWA 1F77A 5I4DA 3ZGZA 1QLBB 2BTEA 3SHGB 1ZAEA 3SBJA 3AB5A 3ZC7B 1DGHA 2NTSA 3BZDB 3W1SA 3ZH9B 4RFBA 4YTPB 4AQYM 4MGYE 4X64M 4RF1A 4KGSA 3VRAB 2JXTA 3D8LA 2JRIA 3WCQA 2G8LA 3BK2A 3U52E 1VZ7A 4PD2A 2K47A 1I4QA 3MP9A 3MJ5A 3VR9B 4TSSA 2EKIA 3KWLA 5EP1A 1NYRA 3GP7A 2Z3XA 3OWEB 3KOWE 4BLCA 4MGZE 3O13A 3CTWB 3HVZA 1J7CA 4LFCM 2A5YB 5FSWA 2EUCA 4NAMA 2YNMD 4Z8XA 2KMMA 1XCTL 3HVDA 3Q69A 3FTFA 2ZAMA 1MHXA 5KQDA 4OVZA 4DR4M 2QBYA 1H6UA 5DYGA 4BOPA 2G9HD 2MJEA 1ZXIA 5BMIA 1P7EA 1UWXA 3L29A 3TPZA 4LJ8A 1FRDA 1PUTA 1L5PA 2CHQA 4HLQA 3TEXA 3U61B 2WLBA 3TWMA 4L1BA 3H8HA 3NZ3A 2J52A 5EQTA 2F5PA 3KS8A 3AEBB 1NNUC 4FWDA 3U6SA 3U6OA 4KKIA 2BB5A 1TS3A 3SASA 3J81S 1KF6B 4A3VB 1FNUA 4MH0E 1JMLA 3TUOA 1QOBA 1C77A 2MJ3A 3E56A 3R2TA 4AQ7A 3WHKA 3FYCA 1V1PB 4B7GA 1FNVA 2Y21A 2NMQA 2BNKA 4MT5A 3BBAA 4YT0B 5LMUM 4LJ7A 2XEPA 2BTWB 5EZSA 1HT2E 2HDEA 2DVWB 1QZMA 4XDCA 4AG5A 4JN6A 2XSZD 1UUPA 3GLFB 4GHLA 1TS4A 4OZCA 1XLPA 5EXTA 2HCBA 1Q10A 4IJFA 1IBMM 4FW9A 4X62M 4D82A 1DKIA 2BS4B 1XLQA 4QOZC 2IGDA 1FIQA 2DYMA 1RYJA 1I4RA 2LGIA 3U6EA 4MH8A 1DO2A 1S3SA 1PJJA 3KWVA 4GIPA 1DGJA 1X37A 1D5MC 4CQNA 3FTEA 4DUZM 1ZP0B 5C2TB 1CJEA 2LWXA 5KO3A 2QEJC 4IIWA 2DWNA 1IGDA 3SC3A 5AUIA 1SXJE 4LJ5A 4N6EB 3OQCA 2ON8A 3HKPA 3T1YM 1TH2A 2KXEA 2V0GA 3KVWA 3TMPA 3J27B 2KDMA 3R2IA 1XXHA 2KAJA 1YE9A 2LMCA 2KEBA 1KH0A 2EO2A 3T15A 1MI0A 3HJ8A 1C4AA 5IZ7D 4XZXA 5FLXS 1L4DB 5FTLA 1HEZE 2W55A 5BYRA 2LFIA 3BB7A 2SAKA 5H92C 3AFHA 4XGIA 1ZUD2 4ARIA 2MEKA 1SXTA 3NVYA 1IBXA 2CV1A 1ZDVA 1PDXA 4OX9M 1JALA 3HJQA 2QP9X 1QAQA 1EU4A 3PRMA 1XLNA 2F4VM 1OQQA 1L0VB 1W5TA 5C1BA 5C3JB 4HKQA 1STEA 3W31A 3DWMA 3L4PA 3SYLA 3I51A 4LF6M 4H2AA 1A70A 3M0EA 3TEZA 1XO3A 3BY4A 3L25A 3PNVA 4JPSA 1C9FA 4NRVA 4LGMA 2WXGA 3U5ZB 1J7AA 3AEEB 5KPRA 1V8CA 4AS1A 3AV0A 3FILB 3IG8A 3LMMA 1Z59A 2OPFA 2KN4A 2B76B 3TRKA 1IQPA 1RFKA 1JROA 1IY2A 2XFSA 3DOAA 4DUYM 1WYGA 4KGRA 2M5ZA 1JWBD 4L16A 1FRRA 3B2FA 3GPUA 4LY6A 3VKHA 5BMGA 1Z5CA 5GKNA 3Q8BA 3PHUA 3J7BA 4Z6YA 4LJAA 1L6UA 3MHVC 3DFZA 3A45A 4O1NA 3PNYA 4RH6A 1K82A 3M7GA 4B0EA 1N33M 1IN6A 4M0DA 1I4WA 4JI1M 4HXDB 1Y56A 3B21A 4RGTA 4LZZA 3Q8FA 2UXCM 2XF3A 1NVID 2QENA 1IGCA 1N62A 3BYYB 4DQOC 3AE5B 2I7NA 1HT1E 1IM2A 1UWMA 2CUZA 1TDZA 1L1TA 2PMVA 1UGJA 1QOAA 1GB4A 3SFDB 5HI1A 3AV8A 3AE7B 3AM9A 3SHFA 2F5QA 3EUB2 3W0LB 3IT4B 1QKZA 4IBKA 1YN3A 2QCUA 3J7AS 1NVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVZ B;  4PT5 A;  4M0W A;  2FE8 A;  5E6J A;  4WUR A;  4REZ A;  4OW0 A;  4P16 A;  3MJ5 A;  5KO3 A;  4MM3 B;  4R3D A;  4RF1 A;  4RF0 A;  3MP2 A;  4RNA A;  3E9S A;  4OVZ A; 
#chains in the Genus database with same CATH topology
 4DV1 M;  3VH4 B;  2DXI A;  4DHZ B;  3LQR A;  4WJQ A;  3VXW A;  4BBN F;  1JR3 A;  1NSF A;  3E4R A;  2IBI B;  1YMH E;  1XC8 A;  1NB3 A;  2KFK B;  4YWG G;  1QXP A;  1TYG B;  3AEF B;  1YJJ A;  4EOY A;  4CDD B;  3ETR A;  2WSF F;  1G41 A;  3R66 C;  3A1Q B;  3WAL A;  1FPY A;  2MRO B;  2PKO A;  1MVK A;  3Q8G A;  4XYC A;  3L17 A;  5EE3 A;  4UDU C;  3VHT C;  3RGS A;  2NQD B;  2DC8 A;  5IOI A;  4US9 A;  2WXO A;  2R65 A;  1GC6 A;  3LDZ E;  3W67 A;  4AKI A;  1E8X A;  1VCB A;  4W9K A;  4NJC A;  2AVW A;  2YJB A;  1V2Y A;  2AL6 A;  3W5V B;  1L2B A;  2BKR B;  4G11 A;  1GVN A;  1Z5A A;  3MHS D;  2INC C;  2M17 A;  4XWW A;  1CUK A;  3OG5 A;  3P63 A;  4B7H A;  1LQB A;  1YOV B;  3HHM A;  3RMK C;  3ZCB B;  2GRI A;  4R7G A;  2WXP A;  2FCS A;  3GLG A;  3RD2 A;  4B3S M;  1LV7 A;  2RDH A;  3TEY A;  1VD2 A;  4ICU A;  4F1S A;  4DV6 M;  1SEB D;  2RMM A;  1Y8R C;  4MDK E;  1PM5 A;  3ZNH A;  2NQA A;  4DR6 M;  1N5W A;  3SFZ A;  3HD3 A;  3DVN V;  3VRB B;  4KLB A;  4BKG A;  4DK5 A;  2YQZ A;  1DGH B;  1N75 A;  4N9F 4;  3DBL B;  4X66 M;  2JZ1 A;  1E7U A;  5D6J B;  1K51 A;  4DDG D;  3U6M A;  2AGA A;  4IJE A;  3QAQ A;  3CH2 X;  4ITQ A;  1QQW A;  3TEW A;  3DOW A;  2G8E A;  3QC8 B;  2DAK A;  3PO0 A;  4Q2J A;  3F5V A;  1TF0 B;  3GPX A;  2F5N A;  2CU3 A;  4I5S A;  2NPT A;  1L6V A;  3R7R A;  4ZRJ A;  4ZHO A;  3GO8 A;  1RRB A;  5H8Y E;  4M8N A;  4K0K M;  3JVZ X;  1STF E;  2PAD A;  1WGR A;  2JRI B;  2ASQ A;  1RFA A;  4USA A;  3BPF A;  2WXH A;  3W30 A;  3MHH A;  4P6V F;  2PPH A;  3ZKJ C;  2P5T A;  5F3W A;  3BVG A;  2VQE M;  1QUT A;  3R8F A;  2Y3A A;  2OJR A;  2O01 F;  2K6D B;  3BC3 A;  4WAF A;  1XB2 B;  4DV7 M;  3AEC B;  4A5U A;  4S12 A;  5BMH A;  4MGI E;  5EP4 A;  4HL4 A;  2OJW A;  5DPT A;  1IN4 A;  3I4V A;  4RF0 A;  3E1Z B;  1P1A A;  3C8Y A;  2OZ2 A;  1SSN A;  3EA6 A;  1ESF A;  1PPD A;  2O6X A;  4HVB A;  4N59 A;  1JRU A;  2AQ1 B;  4RGN A;  2P0R A;  1AEC A;  3PV1 A;  4ANW A;  1W5S A;  2L83 A;  1THE A;  2KHH A;  3AOG A;  3WHL A;  3U6D A;  3A98 B;  1F2R C;  3KQ4 A;  1D0M A;  5IT9 S;  1AU4 A;  3KSX A;  5EXS A;  2K6Q A;  2WXF A;  2ZZP B;  2DJF B;  1WR1 A;  4OZA A;  1FM0 D;  4BBA A;  1E9S A;  3V6E A;  2UYZ B;  3FE3 A;  4ANX A;  1YN5 A;  2HJ8 A;  3VK7 A;  2BS3 B;  2FCM A;  2E3T A;  1OIP A;  4QAY A;  4YTM B;  1AYV A;  3WXE A;  2AHM A;  4IWO A;  4WQM A;  2BW2 A;  2N9K A;  2KDI A;  2HJ1 A;  4G50 A;  4DWF A;  4JXJ A;  2N4F A;  4OVZ B;  1GMY A;  3UGJ A;  2AX5 A;  1SXJ A;  2E5L M;  2QBY B;  1MFW A;  2KO3 A;  4IBI A;  2KYW A;  3AE9 B;  3QIJ A;  3QJZ A;  1SE3 A;  3QCA A;  2K0B X;  1TZO A;  5DPW A;  3N1Y C;  1IN7 A;  4LF4 M;  3HU2 A;  4KX6 B;  2DZN B;  2M0A A;  2WBF X;  2KT7 A;  3PTF C;  4XDD A;  1YX6 B;  4GDK A;  4ZYN A;  2LRU A;  4FK5 A;  1E9M A;  2LH0 A;  4DXF A;  4XBO A;  1QDQ A;  1ET6 A;  4K3B A;  1IFY A;  1L0X B;  3CSF A;  3U60 A;  3H7S A;  3FKE A;  2ATO A;  2FE8 A;  3CF6 E;  4LK0 M;  3T3N A;  4QOS A;  4YL8 A;  2BQQ A;  3CF0 A;  2MP2 B;  4PS3 A;  4F7Z A;  2KZR A;  5E26 A;  1AYF A;  4KO8 A;  2BKF A;  4P6G A;  3DHI C;  3O0U A;  2BB6 A;  3AMZ A;  1CS8 A;  1VRA B;  5D3I B;  3TL4 X;  3NBX X;  3W9C B;  3MMP A;  2Y5B B;  1WF9 A;  4TMA B;  3ZJV A;  3ZJT A;  1AYW A;  2FID A;  1HTQ A;  2RGO A;  1TTN A;  2L1A A;  5IO9 A;  4HEO A;  4BKS D;  1C76 A;  2ZAO A;  3RCZ A;  1N77 A;  2KQS A;  4MJS B;  2CV0 A;  1PE6 A;  1G71 A;  3DBS A;  4LTU A;  2BGF A;  3U6Q A;  2ACZ B;  3NOB A;  2YJC A;  4C7Z A;  5L83 A;  4IDI A;  1SE2 A;  3DZD A;  2GBM A;  1ME3 A;  3VUY A;  2N9X A;  1OFF A;  3ALB A;  3HHX A;  4BBN C;  4MM3 B;  2RKO A;  2X49 A;  3OLM D;  4HDO A;  1Q3C A;  2R9C A;  3H8B A;  2D3C A;  2FUH B;  1ACC A;  5KPT A;  2QNJ A;  2GMI C;  3W1S C;  1XF5 L;  1EM7 A;  2UUB M;  5IWA M;  2W9N A;  3EC8 A;  2D3G A;  1KFX L;  3PW3 A;  4A9A A;  1PVJ A;  4D80 A;  4X6H A;  3D32 A;  4I07 A;  5EXP A;  3B89 A;  1XMQ M;  3H7P A;  1IUE A;  2KDB A;  1MG8 A;  2O6V A;  4LDT B;  2C9O A;  3A9J B;  2ZM6 M;  5KHO A;  5C23 A;  3VTV A;  3J80 S;  3TL5 A;  1DOI A;  4IP3 A;  5JH3 A;  3QWL A;  1EF1 A;  2BF8 B;  1YVB A;  2AUZ A;  1B1Z A;  1WX9 A;  1YJ1 A;  2CHG A;  3Q14 C;  3KKU A;  4BSQ A;  3AUL A;  4FJZ A;  2K9X A;  1L7Y A;  3APD A;  2QSF X;  1WR6 E;  1ITO A;  3KDS E;  1CQD A;  2HH5 A;  3S3Q A;  4CJ6 A;  4D2K A;  1VJV A;  1IBK M;  2KZS A;  3ML9 A;  1NV8 A;  2Z4S A;  3GRU A;  4PS7 A;  4L4U A;  5LXH A;  1ZMW A;  1UFZ A;  1MIR A;  3RFW A;  5LMN M;  4YSY B;  3RN9 C;  3KW6 A;  3Q3O C;  3ZXV A;  2NS5 A;  2YEP F;  4P16 A;  4W9C A;  1E94 E;  2DHR A;  2L7I A;  3DVG X;  3HHI A;  3FD9 A;  2KJ6 A;  3B08 A;  1IY0 A;  2HHH M;  3RVW A;  2MW5 A;  4HPL B;  5DNY A;  3MP2 A;  1DGB A;  3EEC A;  1VDD A;  2CFO A;  3UI3 A;  2WXQ A;  3MHS A;  4CIZ A;  1PAD A;  3KFQ A;  3I4Y A;  1IN8 A;  1HNW M;  1PGA A;  3AL0 C;  3C19 A;  1YJI A;  5EP2 A;  4NQK E;  3RVV A;  1K3W A;  3URY A;  3GE3 C;  4HJG E;  4ASW C;  4FCT A;  1UM8 A;  3TMP B;  4DMX A;  2BYT A;  2R4J A;  3GLI B;  2UU9 M;  2QSD A;  3SFE B;  4W9F A;  1PYW D;  1WGK A;  4FVM A;  1XXH B;  1XNQ M;  2JP7 A;  1CK1 A;  2R61 A;  5IKC M;  1K53 A;  1IY1 A;  3DCG A;  3P1M A;  4L15 A;  4RMA A;  1G4A E;  1IWD A;  3H4J A;  2Q5W D;  2NCN A;  5DPR A;  3ZVV A;  1KHP A;  1T3T A;  3UK6 A;  3UMM A;  5D7G A;  4IBC A;  2F7D A;  1GAQ B;  2INN E;  3KFU G;  2L3Z A;  1QDR A;  2GNO A;  1C1Y B;  1DGF A;  4TV3 A;  1ZQ9 A;  2WX1 A;  3N3K B;  4QRG A;  2HE7 A;  7PCK A;  4FD2 A;  3I5J C;  2CHZ A;  3PRP A;  1EWP A;  5ITX E;  3SAV A;  4Q7J A;  1DOY A;  2WU2 B;  4FN2 A;  1PCI A;  1FMA D;  1HZ5 A;  3MC8 A;  1N34 M;  1KM7 A;  2MBE A;  1JWS D;  1FEH A;  2HWJ A;  1YK8 A;  4JL9 A;  1F4I A;  1HA5 A;  1ROE A;  3PHX A;  1R6B X;  3CIR B;  2DNA A;  1IBX B;  4KZ0 A;  3EFC A;  4MSQ B;  2L7H A;  2IY1 B;  2LXA A;  2PIA A;  4DXG A;  4JYA M;  3RI7 C;  4DV2 M;  1PPO A;  2PBH A;  2KMC A;  3AU5 A;  2PE9 A;  2CJO A;  3CWI A;  3PRM B;  2FYE A;  4NAW A;  3OF8 A;  5EE0 A;  2DBY A;  2DC9 A;  2LXE A;  1VZ6 A;  1SE9 A;  1T0Y A;  5EZQ A;  2MHJ A;  3BXW A;  1JR3 D;  3AI5 A;  1WGH A;  2BT6 A;  1VG5 A;  2JX5 A;  4KKJ A;  3B2G A;  1ENF A;  4ZHP A;  2APL A;  1C1K A;  3P4S B;  1ISN A;  1EU3 A;  2KQ7 A;  5ITY A;  3MOR A;  4I05 A;  4P6E A;  4KVG B;  4WH4 A;  3R7Q A;  1V81 A;  3I63 C;  5JZE A;  1F2C A;  3BY4 B;  4I4L A;  2HHN A;  2KLC A;  3N3G A;  2VH1 A;  2WHI A;  1M4V A;  4MZS A;  5H37 D;  3ZRF A;  3PDF A;  4B0M A;  3ZUN A;  4LJ9 A;  1PPN A;  1BML C;  2DHZ A;  2DCC A;  2IGH A;  2DZI A;  1D5Z C;  2J53 A;  1E8Y A;  1NEN B;  2WS3 B;  2KN5 A;  4TQ1 A;  4ARC A;  2VF7 A;  2OO9 A;  2ONQ A;  3B1L X;  3KW5 B;  3C58 A;  2WDV B;  3KUZ A;  3FRH A;  4IBG A;  1FD6 A;  1XCQ L;  3SAW A;  3U8E A;  1GAB A;  2DZM A;  4IBJ A;  3U4E G;  1SP4 B;  1ZCM A;  3EFU A;  3X0W A;  2R62 A;  2JF5 A;  2JTC A;  1KFV A;  3ZJU A;  4GXB A;  5AUK A;  4ZTB A;  4G3O A;  2KXJ A;  3N9Y C;  2GQF A;  4LNI A;  5DCN A;  1NHW C;  4LJ6 A;  3HM3 A;  3PGE A;  4ANR A;  4KHP M;  3PZD A;  1NHG C;  2BWF A;  4II3 B;  1K3X A;  3WIM A;  4YYV A;  1MEM A;  2L2D A;  3R3M A;  2JQF R;  4WP2 A;  1UBQ A;  1X1M A;  1NY5 A;  1P3Q Q;  1HQY E;  2JRH A;  3JSV B;  3K9P B;  4JQW C;  5J18 A;  2G1E A;  5AZH A;  4YY3 M;  2HD5 A;  2KTR B;  4I6P A;  4G54 A;  4A90 A;  1WXA A;  1E8Z A;  3HWS A;  3ZXR A;  2JWU A;  2KNV A;  3SR6 A;  1J8C A;  4YXD B;  2FNA A;  4JX1 C;  2XU1 A;  2IJ0 A;  1P9D U;  4W9H A;  5CHF A;  5KQ8 A;  2FUD A;  2DZK A;  3IV2 A;  4BOU A;  2DCB A;  3IHP A;  2ZVN A;  3ENE A;  2OOB B;  1EWC A;  2WXR A;  2LHE A;  3ECI A;  2PTL A;  3FTD A;  4C56 C;  2AIM A;  1TH4 A;  1OGW A;  3H89 A;  1PFD A;  2LGS A;  5JH5 C;  3HHA A;  4DR2 M;  2NBU A;  5L95 C;  3U2S C;  3U7Z A;  1S3S G;  3HY5 A;  4RNA A;  4II2 B;  3KP1 E;  2DWZ B;  3T8M A;  2N1W A;  3FUW A;  2G4D B;  4QBB A;  1SG9 A;  5CHW A;  1WWT A;  5FKA C;  3VH3 B;  1IXR C;  3RNF C;  4LG2 A;  2KOX A;  2LAS A;  1TKG A;  2Y5C A;  3JR5 A;  1A5R A;  1WGG A;  3I9V 1;  2BWE A;  2Y20 A;  3FKY A;  2D7E A;  4JI0 M;  2Y5P A;  3HK0 A;  1T6B X;  3Q3J A;  1T43 A;  4QRX A;  4MSX A;  1PQS A;  1QDT A;  1KOT A;  3SYK A;  1TR8 A;  2QCZ A;  4X57 B;  1C3T A;  1P98 A;  4L23 A;  2DX5 B;  1XHB A;  1U4A A;  2JT4 B;  1AU3 A;  4EEW A;  4PDG A;  1OEY J;  1NYQ A;  4DR7 M;  3M63 B;  2DWM A;  4D8E A;  3IG5 A;  1EWM A;  2JU6 X;  4I6L B;  3DBR B;  4CIS A;  2IO3 B;  1SXJ D;  5HKH A;  2XGN A;  2X38 A;  2N7J A;  2J7N A;  3FC4 A;  4ZUX U;  5DYI A;  2XLJ A;  2N9E B;  4GGQ A;  3HIZ A;  1JB0 F;  2JY7 A;  4JE3 B;  4FHK A;  5GMV A;  2KD0 A;  3V05 A;  1EWO A;  2ZW1 A;  2VII A;  5BYQ A;  2KA6 B;  2KQ4 X;  5ITQ A;  4KLN A;  8PCH A;  2JVC A;  5E6J A;  3BVZ A;  4FXC A;  4KZC A;  1L8Q A;  2BWB A;  2DCA A;  4NQL B;  1BXT A;  3Q8X A;  2M19 A;  2OHF A;  4AP4 C;  3GZN B;  1R2Y A;  1TIF A;  4EFO A;  1NNJ A;  1KFY B;  1GJZ A;  1PBH A;  4MI7 A;  4GEW A;  1RU3 A;  2WZJ A;  2DEN A;  1N5X A;  1AU0 A;  3N4C A;  3OJ3 A;  4IWP A;  3SEB A;  5E6P A;  4RGO S;  5E6N A;  5IRE B;  3DVG Y;  3ZNH B;  5HHD G;  4AUQ C;  2IND C;  4WWN A;  5TR5 A;  3L54 A;  3NVW A;  2BYE A;  3MK6 A;  2QMT A;  2JPH A;  4QRV A;  5ITR A;  1V6E A;  4WUR A;  3T6P A;  3GQ5 A;  2Y0T A;  2KNZ A;  3RT3 B;  5EDS A;  4TUU A;  1QOG A;  8CAT A;  2J7Q A;  3L28 A;  2O5R A;  1N32 M;  4GUA A;  4M01 A;  4X65 M;  3W68 A;  1WJN A;  2GHU A;  1SJH D;  3PVL A;  3ZW3 A;  2PVG C;  4NOO B;  2AUX A;  2NPT B;  2LTU A;  4KOD A;  4RKX A;  2CU1 A;  4JI6 M;  2MBO A;  3NJT A;  4W9G A;  3NY5 A;  3QAU A;  2CHV A;  5A24 A;  1HZ6 A;  1AU2 A;  2L32 A;  4RCO A;  2KNA A;  1GOZ A;  4YTN B;  3PSE A;  4DBG A;  4JIO U;  4GC5 A;  2BDZ A;  4CHK A;  1HXY D;  2CKH B;  1J09 A;  3MC0 B;  2QZ4 A;  3GS2 A;  4YYU A;  2O6V D;  2CB5 A;  3BOS A;  4GLS C;  3IAS 1;  4W5W A;  4OU7 A;  4PK1 A;  4NZL B;  3GCB A;  1R4G A;  4WQO B;  4YYS A;  4W5C A;  4LFB M;  4ZOH C;  4JWU C;  3CH3 X;  1WFY A;  1Z2M A;  2L0F A;  1TDH A;  2IPK D;  4XUI A;  4GC9 A;  5CVO B;  4JI4 M;  2RPV A;  1MHW A;  2I1J A;  4LFA M;  3JR4 A;  3PZ7 A;  3KOX E;  2JUJ A;  1N36 M;  2W3S A;  2AU1 A;  2JY6 B;  2CV2 A;  3BOW A;  1FJG M;  4NXN M;  3DBH B;  3V6E B;  3GPY A;  1R7S A;  1K50 A;  1WHC A;  3L2A A;  1NPZ A;  3I3T B;  4FWG A;  3FYD A;  2PRE A;  4NNJ B;  4M9S A;  4XX5 A;  4MB7 A;  1V34 A;  1VDL A;  4II7 A;  4G4N A;  1E32 A;  1J0G A;  1TJE A;  2LJI A;  3GLH B;  1D2N A;  4L6V 6;  1Q5W B;  2WXI A;  4XWT A;  3HGI A;  4FJY A;  4DR5 M;  1R4N B;  1XQQ A;  2V4I B;  1NI2 A;  2EA0 A;  2KWC A;  4D81 A;  4RGM A;  2VZK D;  2C0Y A;  3BPM A;  1C4C A;  2O25 A;  2N7E A;  2D5G A;  3QAR A;  4PP2 E;  4PS8 A;  3J9C A;  1POP A;  3V6C A;  1EE8 A;  4IBD A;  3K1J A;  2KNB A;  1MHH E;  2K8H A;  4FA6 A;  1N63 A;  3RPF C;  4F1I A;  3FIL A;  1GO5 A;  3UF8 A;  4G4Q A;  2WXN A;  4HDQ A;  3M95 A;  3Q3M C;  1E5W A;  4MAC A;  3RZW C;  2Z8L A;  3VQI A;  3B7Q A;  3H7D A;  5EE1 A;  3TSS A;  3ZNZ B;  2DAJ A;  4CDC B;  3T3O A;  3U60 B;  5FK9 C;  2GB1 A;  1GL6 A;  3H1U A;  4OVV A;  2RPQ A;  3IMA A;  1BVS A;  1C4P A;  5BPV A;  1SIJ A;  1TS2 A;  4HCN B;  4FWH A;  2YJ9 A;  1HTO A;  2MLB A;  2M1M A;  3HRD D;  3ZLZ A;  4UN2 B;  1FXI A;  2LHC A;  3AN1 A;  1FCC C;  3KOZ E;  1BGO A;  4LGY A;  1V97 A;  1GNU A;  2DLB A;  3KX1 A;  4MGK E;  1TTE A;  2KWU B;  2R46 A;  1XNR M;  2DZY A;  2QHO A;  5G5H A;  2G6D A;  3UIO B;  2W82 A;  1R7R A;  4RY2 A;  2XNA C;  2K39 A;  2WNM A;  3V3X A;  4ZPX A;  3OAW A;  3GP1 A;  3D8B A;  1L2N A;  1EF5 A;  3JAM S;  1ZXH A;  1Z6T A;  2NBV B;  3P5V A;  3GLI E;  2CHW A;  4NJ7 A;  1V5T A;  3DBL I;  3SAU A;  2SEB D;  4DV0 M;  1RLF A;  2V6Z M;  2LUM A;  5EF4 A;  3FUU A;  1E10 A;  2UXB M;  2RD0 A;  1YN4 A;  4W9E A;  1TL9 A;  1WIA A;  1ZGU B;  1D4B A;  4XR7 A;  1IXS B;  2AYO A;  4WWO A;  1DO0 A;  2TSS A;  4G3X B;  3I01 M;  2WX0 A;  3QWZ B;  2L05 A;  2V3P A;  4N4Z A;  3A4S C;  4HLE A;  3O65 A;  3EIE A;  3VLF B;  5IA7 A;  5CHV A;  1UBI A;  2GBK A;  1ZIV A;  2DCD A;  3H7P B;  3Q3F A;  4HRS A;  2R18 A;  4FBJ B;  5AZG A;  4OZB A;  5ITT A;  3P4Q B;  3ZIM A;  2R2Q A;  1WGN A;  2KC1 A;  3RVX A;  1AYU A;  3GLF E;  1VEG A;  1Q3B A;  2R9O A;  4I04 A;  1P3Q U;  3Q8C A;  3BYT B;  2KRK A;  2FFJ A;  4LRT A;  4PDI A;  1JQJ C;  2WDQ B;  4GH9 A;  1BP4 A;  2MBH A;  3K24 A;  4DXA B;  4K7C A;  2CP8 A;  2H89 B;  4DV5 M;  1WJ7 A;  5IAA C;  2F1G A;  2YR0 A;  2Z0E B;  2BS2 B;  2KFJ A;  1QVR A;  2LVO A;  1BQI A;  2J0M A;  3IEC A;  2IBI A;  2LBC A;  2FCQ A;  2KFK A;  3KWB X;  4CGY B;  4GKK M;  4QHS A;  3HX3 A;  1PGX A;  2QIL A;  2JQR B;  1EWL A;  2L4E A;  2E6X A;  3FTC A;  4HJK A;  3PXG A;  4GIT A;  2GI9 A;  2MJD A;  5CHV C;  3MTV A;  4I81 A;  2WWZ A;  2BU3 A;  2JA2 A;  2I2Y A;  2Y6E A;  2MH8 A;  1YSY A;  1E0Z A;  2C60 A;  2JZ3 B;  1HNX M;  2KAC A;  3W2D A;  3A9K A;  1G8P A;  4IOI E;  4L8R C;  3P42 A;  2C7N B;  1KLU D;  4G4R A;  4KSK C;  2XK5 A;  2R45 A;  4K7W A;  2IGG A;  3U6P A;  2WSE F;  3H6N A;  3TNX A;  3Q2A C;  2Z8Y M;  3HU1 A;  2FQ9 A;  5FTK A;  4DMY A;  5D3D A;  2K0P A;  2L8J A;  3KVF B;  1AN8 A;  1MJD A;  4GDL A;  4IWQ A;  4B9K A;  3NRZ A;  1SXJ C;  4P1B C;  4GB9 A;  3SAR A;  1LFD A;  2YLM A;  2ZCC A;  3IXS A;  4WWP A;  3V60 A;  3UQB A;  1RAX A;  2D2Q A;  1OAO C;  2K9D A;  5CX3 A;  2RRU A;  4K81 A;  1CQV A;  4CO7 A;  4BOS A;  1VJK A;  3LVW A;  3ZQ4 A;  1N61 A;  2BBC A;  1QT9 A;  1HJP A;  1F9J A;  3UJN A;  2MH7 A;  4HEA 1;  2CEA A;  3NVV A;  1DGG A;  4OHJ A;  2DJG B;  2V1U A;  3KXE C;  4LCD E;  2G3Q A;  3GQ3 A;  1NI3 A;  1I4G A;  2PVO D;  1TKE A;  2UWQ A;  4R71 A;  3APC A;  3PRP B;  3KH0 A;  2V1C A;  1Y4H A;  3LFY A;  3KS4 A;  3I04 M;  2BJW A;  1R2Z A;  2XU5 A;  5FPW A;  2X4A A;  2JWS A;  4LJ4 A;  1TY2 A;  2L4F A;  1TH3 A;  5G2N A;  3QYB A;  5EGW A;  2RSU A;  1X9Y A;  1GPX A;  3PHX B;  1LXD A;  1ZMU A;  4WIP A;  4YYW A;  2RDG A;  1FO4 A;  1JQ4 A;  1YQ3 B;  3LJ3 A;  4HWY A;  2LVA A;  4A3O A;  1E9R A;  1L4Z B;  3PHW A;  3VKG A;  1ZOY B;  4NAW B;  3IEJ A;  4GSW A;  3IFW B;  3C3D A;  1YX5 B;  5IN7 A;  3VDP A;  2AWT A;  3EGR A;  4LJO B;  4RM9 A;  4MEM A;  4A6Q A;  3WAP A;  3A46 A;  4NRW A;  1VLB A;  3THG A;  5BO4 B;  3F92 A;  3VTU A;  2XZF A;  4LF5 M;  1K3B B;  1QOL A;  3H4M A;  1IBL M;  1CZP A;  2F5O A;  4IBF A;  3SMS A;  3U6C A;  2MQJ A;  1WXS A;  4GMV A;  1MPE A;  3CBK A;  2ARY A;  1TS5 A;  4CDF B;  4L2Y A;  5G5G A;  3W0F A;  1L0Y B;  1MS6 A;  2N7D A;  1QUS A;  1NV9 A;  4C4V A;  2V4L A;  2LVP A;  2G4S A;  3H9D A;  4MEL A;  2DC6 A;  1T0S C;  1WZ0 A;  3KOY E;  3S2A A;  5F02 A;  1J19 A;  1OJL A;  1D6E C;  2Q2E B;  3AKZ A;  2JWZ A;  4LCB A;  3KWZ A;  4R3D A;  1TLO A;  4OEL A;  1GCB A;  1SBB B;  2DAF A;  3QHT A;  2JQG R;  4HRO A;  3SMP A;  2K6B A;  2L0T A;  1JR3 E;  4TQ0 A;  2HTM E;  4M0W A;  1ZPS A;  5LLI A;  2MA9 B;  5KHQ A;  2LGY A;  4DV3 M;  1TU6 A;  3K8U A;  2R9F A;  2KKC A;  1V49 A;  3L26 A;  2ZPN A;  3M3J A;  3AOE A;  1N78 A;  2NQ8 C;  1HR0 M;  2Y0Q A;  3C3E A;  5HG2 A;  3H6S A;  5JHB A;  2P86 A;  1WGL A;  3AXC A;  1N6Z A;  2FNJ B;  2N9L A;  1Z5B A;  3SHQ A;  1FFU A;  1OQY A;  1TGU A;  4EUT A;  1BT0 A;  2M60 A;  4QNM A;  3UIN B;  2HD5 B;  4PT5 A;  3QA8 A;  4WWM A;  1KFU L;  1PXV A;  2UZJ A;  1J5E M;  1C79 A;  3OTO M;  3GRV A;  1MDW A;  2D7H A;  1F1H A;  3WXG A;  1MJG M;  4S17 A;  1F2B A;  4J3O D;  4E74 A;  4WJP A;  2Z7J A;  5DPS A;  4HKZ E;  4GMQ A;  2FBW B;  4Q8H A;  4B95 A;  2QJL A;  4N79 A;  1GC7 A;  4FIP A;  4I6N B;  2PW9 A;  3P5X A;  1WXQ A;  2YEP B;  2L6O A;  3E46 A;  3AOE C;  1NEK B;  1DYQ A;  4AI6 A;  3VUW A;  1SJE D;  5HFY A;  2XU3 A;  1ORY B;  2LD9 A;  3MHZ A;  1D5X C;  3EIH A;  3T38 A;  4BFR A;  1OEY A;  1F0Z A;  1OAI A;  1JW9 D;  1BUI C;  2H88 B;  2D7G A;  3E21 A;  5C18 A;  4KGT A;  3FUX A;  1DF0 A;  3NHE B;  3B9P A;  4AW4 A;  2Z4R A;  3CST A;  4TUW A;  2K25 A;  2A4Z A;  1E6E B;  3I57 A;  2FCN A;  1OKS A;  3ONS A;  4A3P A;  4W9I A;  4MM3 A;  3TIX A;  4JI8 M;  4AJW A;  2G7Y A;  2EKF A;  3NWL A;  2WDR B;  4I8O A;  3SAT A;  2JSV X;  1K52 A;  3NBI A;  2M56 B;  1HQR D;  4NL4 H;  3FUT A;  2JYE A;  2ZPY A;  3A9J A;  2CJN A;  4M9Z A;  2INP E;  1OFH A;  3L13 A;  3ZRC A;  3R9X B;  2V9H A;  2WGS A;  1TY0 A;  2PEA A;  3ABV B;  2XBB C;  3ZYY X;  4AZF A;  1Q0W B;  5BYS A;  4B3M M;  3IT6 B;  3TWK A;  1YZB A;  4WAA A;  2K5P A;  2E03 A;  3D6S A;  2KK8 A;  1V5O A;  2PE6 B;  2DHY A;  3N1Z C;  1PJQ A;  1FH0 A;  3GRR A;  3VDU A;  2EJS A;  1WI0 A;  1VZ8 A;  1N60 A;  2V3S A;  4ZYS A;  2LEK A;  5CTR C;  3E9S A;  1NQC A;  2XN9 C;  1ZMV A;  3L27 A;  4IBB A;  4DHZ E;  3K9O A;  4LF7 M;  1QAN A;  3IVF A;  2ZVO A;  2WXJ A;  2JZZ A;  3BWU D;  3VDZ A;  2IDY A;  1AW7 A;  1T3Q A;  5FR3 A;  1SNK A;  4KV2 A;  4OVU A;  4DDI D;  2NQG A;  3U61 A;  1Q39 A;  1GKI A;  2VQF M;  2IY0 B;  1YQ4 B;  2KX0 A;  2HL7 A;  3GLH E;  2AL3 A;  2DEN B;  1NJG A;  1K8R B;  4EZJ A;  1Z5S B;  3RGP A;  3UQA A;  2ERC A;  2C98 A;  3LXS A;  5EXX A;  2L52 A;  1B9R A;  3K8Z A;  1NBF C;  3HHZ A;  1CB5 A;  4CHT B;  1ZDX A;  4ANV A;  1R4M B;  3B9J A;  3KLS X;  3HJS A;  2CIO A;  4YV8 A;  2N1V A;  3GLI A;  1SB3 C;  1WE7 A;  3BII D;  2Z59 B;  4G4O A;  1AWD A;  3LYY A;  2J7Q B;  2YFQ A;  3GPP A;  1WX8 A;  1V1P A;  4K7S A;  4LNN A;  1PIP A;  2R4E A;  4BKT A;  1I7H A;  4NSO B;  1I4P A;  1UH6 A;  4JI3 M;  2PLP A;  4X6I A;  2M8S A;  2G8J A;  3PT2 A;  3GQ4 A;  2CRU A;  1E7P B;  3AED B;  1AIP C;  2DWL A;  1FFV A;  2B1N A;  2BTW A;  3DA1 A;  1YUB A;  3ZDM C;  1C78 A;  2D10 A;  2L7R A;  4XE0 A;  3MFG A;  3KP0 E;  4QH6 A;  1ZW7 A;  4ZRQ A;  4BOZ A;  3A42 A;  2B1M A;  3DVN U;  3HU3 A;  4GKJ M;  1KTK A;  5LNK 1;  1I4H A;  3FUV A;  3GLF A;  5GXG B;  4DBG B;  3Q3N C;  4YHH M;  4P7I A;  2FUG 1;  2Z84 A;  4M9X A;  2C96 A;  2R9M A;  5FTM A;  2DYB A;  1GLN A;  1TGZ B;  4AKH A;  5CVM A;  2LNH C;  1HQC A;  4BOQ A;  3IHP C;  3WAO A;  3VFD A;  2MRP A;  3WA0 A;  4AJY B;  3QK0 A;  1JWU D;  1PGB A;  4JI2 M;  1UNS A;  2D3B A;  3B0A A;  1NY6 A;  2JZP A;  1T5X D;  1ICF A;  5JI2 E;  4DV4 M;  3P2B A;  2WU5 B;  3WXF A;  2WXL A;  2WXM A;  3PFI A;  1GB1 A;  2CE7 A;  1F52 A;  2E01 A;  4F8C B;  2KRU A;  4RKU F;  2J0J A;  4KIK A;  1DEU A;  5FTJ A;  3N1X C;  4LRS A;  2KMA A;  4BVU C;  2ZBK B;  2N35 A;  2K3U A;  4B08 A;  2AYN A;  1KLG D;  4YYR A;  1I94 M;  1LO5 D;  1WYW B;  1I4X A;  1WMH A;  1QYR A;  3TQS A;  1L2C A;  3KYD D;  1FNW A;  2K8B A;  4D8B A;  4ITK A;  3KW9 A;  3ILK A;  2UUA M;  2DKL A;  3ZTC A;  2DZO B;  2N0S B;  2JZ0 A;  2HKJ A;  2ZNV C;  3P4P B;  3RYT A;  4PCZ A;  5AEK B;  3B79 A;  1WX7 A;  4B3T M;  1WM3 A;  1WSP A;  4B7F A;  2C5R A;  1XXG A;  4ICV A;  1QMY A;  2WP9 B;  4M02 A;  2XH9 A;  4FJC A;  3RNG C;  2ZEQ A;  5J94 A;  4YYQ A;  3AE6 B;  3V6C B;  1PJS A;  1E90 A;  2L00 B;  4MGH A;  4FHJ A;  2WDT B;  3DBR I;  4BS5 A;  4B3R M;  4EIW A;  3VR8 B;  4JI5 M;  4PP1 A;  1SF0 A;  3GLG B;  2MJ5 B;  1Q1O A;  4WW0 A;  1IXZ A;  4G6Z A;  1I35 A;  1GLO A;  4C80 A;  2LJ5 A;  4G0N B;  2KDE B;  3T1H M;  4JI7 M;  1UZX B;  2QIE B;  2K8C A;  1O0E A;  3CBJ A;  2VH2 A;  4NC6 A;  2F5S A;  3SDL C;  2X8A A;  3AEG B;  1LM8 B;  5J17 A;  1PJI A;  2XFT A;  4KDL B;  3P5W A;  2EEL A;  3W5U B;  3P4R B;  2L76 A;  3J2P B;  2LGX A;  2LXC A;  5G55 A;  1ZE3 D;  2QPA A;  1VDV A;  4YSZ B;  2EMT A;  2HWK A;  2KJR A;  3GE8 C;  3N32 A;  4LF8 M;  1MX0 A;  2H5X A;  3GZN I;  1WGY A;  3O1G A;  2ICI A;  3FAH A;  4IUM A;  1FCL A;  4LZJ A;  2AS8 A;  1NB5 A;  3LB8 C;  1HNZ M;  3HUI A;  3PNR A;  3DDC B;  2HTH A;  2QHO B;  3LXF A;  2R6N A;  3AE4 B;  1D0K A;  1IYF A;  3RNB C;  2J7O A;  4QHT A;  1KRH A;  1KJT A;  2KW0 A;  4K7U A;  3LCV B;  3B7N A;  2OOB A;  2JY8 A;  3USV A;  7CAT A;  1MN3 A;  3RFZ B;  3LW5 F;  2C7M B;  4GRI A;  1GJS A;  2EMS A;  2BPS A;  2AYO B;  2VRR B;  1C7Y A;  5AZF A;  1XKG A;  2LGD A;  2HXZ A;  3IUT A;  1G59 A;  4BPV A;  2I7P A;  1XWI A;  2J7Q C;  3X23 A;  5JI3 E;  2XZU A;  3O65 B;  4GN1 A;  2XSZ A;  3ZO5 B;  4DR3 M;  2IPP B;  2VF8 A;  1F2R I;  3K92 A;  5ITU A;  3GB1 A;  4WJO A;  1MU5 A;  3TJP A;  2L09 A;  5JHA A;  1VR9 A;  5EP3 A;  2P7U A;  3M99 A;  1L2D A;  1WR1 B;  1BY8 A;  1GJT A;  2I38 A;  1M94 A;  3RNA C;  1VEJ A;  2BWE S;  3RUL A;  3U8Z A;  2O2V A;  5E6O A;  1EWY C;  1Q6K A;  3Q8A A;  2J4X A;  1GL7 A;  3BVM A;  2BDL A;  2FOI C;  3UIP B;  1WRI A;  3RNV A;  4PYU A;  4FCW A;  3NVZ A;  1SXJ B;  5A2Q S;  1XMO M;  1RM6 C;  3DHH C;  4EE2 A;  1ATK A;  2C7H A;  3BWK A;  5FTN A;  1P7F A;  2J42 A;  2RGF A;  4URK A;  1NL6 A;  2YVC A;  4C7Y A;  2H1R A;  1J7K A;  3PVS A;  5K16 A;  3U5Z A;  2DWQ A;  1NLJ A;  2CS4 A;  2W3R A;  4A55 A;  1XLO A;  2LVQ A;  1FXT B;  4GDK B;  4IBE A;  2OOA A;  3MJW A;  4HCP B;  3DBH I;  4LLG M;  3A9K B;  3IAM 1;  4LJP B;  5BR8 M;  3AH7 A;  1L1Z A;  2XK5 B;  1OTR A;  1JWA D;  2C5L C;  1E7V A;  3W1Y A;  4REZ A;  3AE2 B;  1R4N I;  2V3N A;  3NZU A;  2DAI A;  3AE8 B;  2KLG A;  4GDL B;  1S1Q B;  4Q8G A;  3L08 A;  2CWB A;  3CF2 A;  4YSX B;  3AJI B;  5ITX A;  2ZJD A;  3KUC B;  3DF0 A;  3PPA A;  5JXV A;  5EE9 A;  1IN5 A;  2YJ2 A;  3KSJ A;  2IYD B;  1QOF A;  1MEG A;  3CGW A;  1CVZ A;  2QDF A;  4JWS C;  1DOX A;  2G3Q B;  4GHA A;  1OQR A;  3DWG C;  4D8I A;  3IFU A;  2AEH A;  1Y08 A;  3BK1 A;  1CPJ A;  1RWS A;  2OED A;  4HXD A;  1XXH E;  4FCV A;  2IO1 B;  2JYT A;  3TBL D;  2C99 A;  1V1O A;  1E8W A;  1G3I A;  2CHX A;  4DR1 M;  5TSS A;  2LHG A;  4BAX A;  5T8I A;  2KZU A;  1FXA A;  3LQQ A;  3L10 B;  1JWM D;  2D11 A;  1UD7 A;  2KWD A;  3RE8 A;  4NXM M;  2DZL A;  2NTT A;  3AE3 B;  2RGH A;  3C0R A;  3Q8E A;  2UUC M;  4NSR A;  3VK8 A;  1QIL A;  2IO2 B;  2N9P C;  2WQY B;  3TWL A;  4J6I A;  2NR2 A;  3M62 B;  3LVV A;  1JRP A;  1WRD B;  3CMM B;  2G5G X;  3HHY A;  1WM2 A;  2BYV E;  1QAM A;  2K22 A;  5MPO A;  2LHD A;  2O6V B;  1IP9 A;  4JV5 M;  3PHW B;  4QNR A;  4ANU A;  4A8X C;  2GBN A;  2C9C A;  4L78 A;  3GRY A;  2AQ3 B;  4KDI C;  4LDT D;  1PRB A;  5EJC A;  1YNT E;  1UKF A;  4B6W A;  2ZW0 A;  4LF9 M;  3MTN A;  4N58 A;  3HM6 X;  4PYZ A;  1YD8 U;  3PZ8 A;  1QQR A;  3AEA B;  2LVN C;  4CZW A;  4W4U A;  3AU4 A;  1KYI A;  4AG6 A;  3M6A A;  1T0Q C;  1QF6 A;  1YQB A;  1DV0 A;  3PLV A;  1V92 A;  2V1Y A;  4GOC A;  4IKG A;  2GLS A;  4IM0 A;  1PPP A;  3PBH A;  4AKG A;  3TCA A;  2KHW B;  1ET9 A;  4C4V B;  3QSD A;  2JY6 A;  1KSF X;  2DYO A;  4AXL A;  2IO0 B;  4BB9 A;  4OW0 A;  3K2L A;  1R5L A;  2JNH A;  1NJF A;  1J7B A;  3A1Q A;  3NUH B;  4X6J A;  1CV8 A;  1FNN A;  3I3T A;  4ZRP A;  1MG4 A;  1JCK B;  2DOS A;  1ZKH A;  1SE4 A;  2EKE C;  1QAO A;  2UXD M;  2W54 A;  2ZAN A;  3GLH A;  1UGM A;  2VZK B;  5KPZ A;  1WXM A;  1OFI A;  2XU4 A;  2AQ2 B;  3NS1 A;  4US8 A;  3UGB B;  3VFK A;  3TE6 A;  2OQ4 A;  3KUD B;  1XEE A;  2YJ8 A;  4M0W B;  3AE1 B;  3U6L A;  2DZJ A;  3V76 A;  2DZZ A;  2BJV A;  2LVO C;  2WXK A;  3V62 A;  1TKY A;  4IG7 B;  3RZF A;  3UZU A;  2LI5 A;  3R8B A;  3HHW A;  1YT7 A;  1F77 A;  1U9W A;  5I4D A;  1F2A A;  3OVZ A;  3ZGZ A;  1QLB B;  2BTE A;  3OIS A;  3NG0 A;  3SHG B;  1ZAE A;  2R6F A;  3SBJ A;  2DNF A;  2X8X X;  3AB5 A;  3APF A;  4FJV B;  2R0I A;  4IC7 B;  3ZC7 B;  1DGH A;  2KX3 A;  4HPP A;  1YK7 A;  4IM2 A;  1M6D A;  2NTS A;  3BZD B;  3IBE A;  4XK8 F;  3FRI A;  4BQV A;  3ERV A;  2M0X A;  4MSM B;  1V33 A;  3W1S A;  1D0L A;  3ZH9 B;  4RFB A;  4WJN A;  4YTP B;  2FTD A;  1PGY A;  4AQY M;  4MGY E;  4X64 M;  4RF1 A;  1YIW A;  4KGS A;  1OIZ A;  3PRZ A;  3VRA B;  3U7D A;  2JXT A;  3D8L A;  1T6O A;  5D94 A;  1GEC E;  1HE8 A;  2JRI A;  3ML8 A;  3WCQ A;  3H8C A;  3KYC D;  4BOS C;  2G8L A;  3BK2 A;  3QQ8 B;  2MGW A;  3U52 E;  3N20 C;  1VZ7 A;  4PD2 A;  2K47 A;  1I4Q A;  3MP9 A;  1IXS A;  3MJ5 A;  4XC2 A;  4KSL C;  2MR9 A;  3VR9 B;  1VEK A;  3K9M A;  4TSS A;  2EKI A;  2RDB C;  2ZTC A;  2FAZ A;  3KWL A;  5EP1 A;  3BCN A;  1NYR A;  1WJ6 A;  2MBQ A;  3GP7 A;  4IW0 A;  2Z3X A;  2NVU I;  1SIF A;  3OWE B;  3KOW E;  3VAW A;  1U9Q X;  2I1K A;  2RR9 A;  2KTF A;  4BLC A;  4MGZ E;  3O13 A;  4TKN A;  4ZRK A;  5JZE B;  3CTW B;  3HVZ A;  3U30 A;  1J7C A;  4LFC M;  1V9J A;  2A5Y B;  4MZO A;  5FSW A;  4PAD A;  2EUC A;  1WXV A;  5DFL A;  4NAM A;  2REX A;  3HZJ A;  2YNM D;  1V86 A;  2PJH A;  4Z8X A;  2KMM A;  1XCT L;  5JA7 A;  3V61 A;  2K1F A;  4AXM A;  3HVD A;  3Q69 A;  3EHV A;  1XD3 B;  4IM3 A;  3FTF A;  2ZAM A;  1AAR A;  1D3Z A;  3ZQJ A;  1MHX A;  3BBZ A;  5KQD A;  4OVZ A;  4DR4 M;  2DAE A;  2LRW A;  3QT4 A;  2QBY A;  1H6U A;  5DYG A;  4F2L A;  4DHJ D;  3K9O B;  5PAD A;  2G9H D;  4BOP A;  2MJE A;  1ZXI A;  1GG3 A;  5BMI A;  1P7E A;  1UWX A;  3L29 A;  3TPZ A;  3P5U A;  4LJ8 A;  1VSN A;  4W9D A;  1FRD A;  1PUT A;  1L5P A;  2CHQ A;  2GFO A;  4HLQ A;  3TEX A;  3U61 B;  2WLB A;  3TWM A;  3F75 A;  4L1B A;  1T0R C;  3WAM A;  3H8H A;  3NZ3 A;  2J52 A;  2FT2 A;  5EQT A;  2DAG A;  2LVP C;  1EFU B;  2F5P A;  2D3A A;  3KS8 A;  4M8M A;  4XZ4 A;  3AEB B;  1NNU C;  4FWD A;  3U6S A;  3U6O A;  4KKI A;  2BB5 A;  4C00 A;  1EF7 A;  1TS3 A;  2DC7 A;  3SAS A;  3J81 S;  1KF6 B;  4A3V B;  4GU2 A;  2MP2 A;  2C9W B;  1FNU A;  4MH0 E;  2JXN A;  1JML A;  4E3C A;  3TUO A;  2FH0 A;  1QOB A;  1IPG A;  1C77 A;  1VQ1 A;  2MJ3 A;  3E56 A;  3R2T A;  1HUC B;  4AQ7 A;  1XT9 B;  3WHK A;  5IP4 D;  1GUA B;  3FYC A;  3GLG E;  1V1P B;  4B7G A;  1FNV A;  2Y21 A;  4BZA A;  4W5B A;  2NMQ A;  2BNK A;  4MT5 A;  2Y5B A;  3BBA A;  4YT0 B;  5LMU M;  3PT2 B;  4LJ7 A;  4WA6 A;  2XEW A;  4CYE A;  2XEP A;  3B74 A;  2BTW B;  5EZS A;  1HT2 E;  2HDE A;  2DVW B;  1QZM A;  4MJS A;  4XDC A;  2VHF A;  4BOZ B;  1H8C A;  2M4N A;  2E02 A;  4AG5 A;  4JN6 A;  4K1R B;  2JY5 A;  1SGH A;  4FAD A;  2XSZ D;  3QJ3 A;  1UUP A;  3GLF B;  4GHL A;  2VDB B;  1TS4 A;  4OZC A;  3S3R A;  1XLP A;  5EXT A;  2HCB A;  4A20 A;  1LTM A;  1P0R A;  1Q10 A;  4IJF A;  2MCN B;  1IBM M;  4FW9 A;  2GBR A;  2ZNV B;  4X62 M;  2J5Y A;  2KDL A;  4D82 A;  3RNC C;  1DKI A;  2BS4 B;  1XLQ A;  4QOZ C;  1LGR A;  2IZV B;  3A33 B;  2KC2 A;  3DPD A;  1CTE A;  1NDD A;  2IGD A;  4HK2 A;  3RNE C;  1FIQ A;  3IG3 A;  3BIN A;  2DYM A;  1EIJ A;  4KIK B;  4PI3 A;  1RYJ A;  4JLC A;  2BYF A;  3I06 A;  3RUI B;  4K3C A;  1I4R A;  2LGI A;  1A5T A;  3U6E A;  3ZDT A;  1V80 A;  3DQV A;  1WMH B;  4MH8 A;  1DO2 A;  1S3S A;  2G45 B;  1PJJ A;  4M00 A;  3KWV A;  2LZ6 A;  2LVQ D;  4GIP A;  1CSB B;  2ZCB A;  1DGJ A;  1TZ1 A;  3IOQ A;  1X37 A;  1D5M C;  2KVR A;  5J2R A;  2NBW B;  4CQN A;  1KLV A;  1AIM A;  3FTE A;  4DUZ M;  1U9V A;  1ZP0 B;  4Y28 F;  5C2T B;  1CJE A;  2LWX A;  4DHJ B;  5KO3 A;  2E00 A;  2QQ8 A;  2QEJ C;  4IIW A;  3ZNI D;  2DWN A;  1IGD A;  2GOW A;  3SC3 A;  5AUI A;  1WY8 A;  1SXJ E;  4LJ5 A;  2FS1 A;  4N6E B;  5C1Z A;  3OJ4 B;  5FR6 A;  3OQC A;  2ON8 A;  3HKP A;  3T1Y M;  1TH2 A;  2KXE A;  2V0G A;  4EZL A;  3KVW A;  2OUL A;  3TMP A;  1TT5 B;  4ZDV A;  2MBB B;  1WH3 A;  4AWJ A;  2BVC A;  3J27 B;  2KDM A;  1KHQ A;  3PLU A;  3R2I A;  1XXH A;  2KAJ A;  3ZTD A;  1YE9 A;  2LMC A;  2KEB A;  1KH0 A;  4EZK A;  4IUM B;  4RM8 A;  2EO2 A;  3T15 A;  2PNS A;  3C9E A;  1G6J A;  5LXI B;  1MI0 A;  3HJ8 A;  2VHS A;  1C4A A;  5IZ7 D;  2LUE A;  4NY0 A;  1ZV1 A;  4NPN A;  4XZX A;  2JXX A;  2OP3 A;  9PAP A;  5FLX S;  3N3K A;  1S4V A;  4S0R A;  3HWN A;  1L4D B;  2FRA A;  5FTL A;  1CMX B;  1HEZ E;  2W55 A;  1EUV B;  2LFI A;  2SAK A;  5H92 C;  5BYR A;  3BB7 A;  2Z0D B;  1U9X A;  2NQI A;  3AFH A;  4XGI A;  4BKS A;  1ZUD 2;  2KJH B;  1R4M I;  3PSE B;  5D2M B;  3WAN A;  4ARI A;  2MEK A;  1EO6 A;  1SXT A;  4ZRI A;  3QX1 A;  1PJT A;  1WJU A;  3NVY A;  1IBX A;  2FRQ A;  4EKU A;  2CV1 A;  3L16 A;  3Q6B A;  2MX2 A;  2DAM A;  1ZDV A;  1PDX A;  4OX9 M;  3NHE A;  1U5I A;  3NZS A;  1JAL A;  3HJQ A;  2QP9 X;  1QAQ A;  1EU4 A;  4AOF A;  2J0K A;  3PRM A;  2R44 A;  4P17 A;  3N30 A;  3VTW A;  1F29 A;  2FIF A;  1XLN A;  2F4V M;  3ZNG C;  1Y8G A;  3SD5 A;  3MC9 A;  3NS8 A;  2D07 B;  4OEM A;  1OQQ A;  2O2V B;  1L0V B;  1W5T A;  5C1B A;  5C3J B;  4HKQ A;  1STE A;  3QYE A;  4E71 A;  3W31 A;  3DWM A;  3L4P A;  3SYL A;  1WIV A;  3A4R A;  3I51 A;  1I42 A;  4LF6 M;  5CVN B;  4H2A A;  3B7Z A;  1YAL A;  1A70 A;  3M0E A;  3TEZ A;  1XO3 A;  3BY4 A;  4HWI B;  3L25 A;  2KWV B;  3JW0 X;  1WGD A;  1UF0 A;  3PNV A;  4JPS A;  1C9F A;  4NRV A;  4LGM A;  2WXG A;  2H7J A;  4NJ6 A;  3U5Z B;  1J7A A;  3AEE B;  5KPR A;  2R2O A;  1V8C A;  4AS1 A;  2HAK A;  3C9P A;  3VVW B;  3AV0 A;  5CHT A;  3FIL B;  3LCU A;  3IG8 A;  1QZE A;  3LMM A;  1Z59 A;  2OPF A;  2KN4 A;  1YLA A;  2B76 B;  2LWP A;  3TRK A;  1IQP A;  1RFK A;  2FO5 A;  1JRO A;  1IY2 A;  2XFS A;  3L0W B;  1OTR B;  3DOA A;  4HPM B;  1Q02 A;  4DUY M;  1A6R A;  1WYG A;  1UEL A;  4KGR A;  2M5Z A;  1AUA A;  1JWB D;  3SU8 X;  1NO1 A;  4L16 A;  1FRR A;  1TBE A;  3B2F A;  4LNK A;  3GPU A;  2KVZ A;  4P1C C;  2CR5 A;  4LY6 A;  3VKH A;  5BMG A;  2KAN A;  3K9P A;  3JSV A;  1KXR A;  2ACT A;  4BS6 A;  1Z5C A;  4CDE B;  2WSC F;  4FLH A;  5GKN A;  2KTR A;  3Q8B A;  3PHU A;  3JYU A;  2JUO A;  2MSE D;  3J7B A;  1JQP A;  1CJL A;  4Z6Y A;  3KSE A;  3DHG C;  4LJA A;  1L6U A;  3MHV C;  3DFZ A;  3A45 A;  4LNF A;  4O1N A;  4YVA A;  3PNY A;  3AI8 A;  4RH6 A;  3GOE A;  1K82 A;  3M7G A;  4B0E A;  1N33 M;  1IN6 A;  4GIV A;  1H4R A;  4M0D A;  2A5U A;  6PAD A;  1I4W A;  5L8R F;  1ME4 A;  4JI1 M;  4HXD B;  1Y56 A;  3B21 A;  2ZTD A;  4RGT A;  4LZZ A;  3Q8F A;  4FUL A;  2EKK A;  2UXC M;  2KDF B;  2WYQ A;  2XF3 A;  1NVI D;  2QEN A;  1IGC A;  2B3T A;  1N62 A;  3BYY B;  4LNO A;  4W9L A;  4DQO C;  3PS6 A;  3AE5 B;  2I7N A;  1HT1 E;  2UU7 A;  3C0R B;  3VUX A;  1IM2 A;  1UWM A;  4XGA B;  2CUZ A;  1TDZ A;  3T9L A;  2MWS B;  1WZ3 A;  2DI0 A;  1L1T A;  2PMV A;  2QC8 A;  1UGJ A;  1QOA A;  2GBJ A;  1GB4 A;  2B3A A;  3SFD B;  5HI1 A;  3AV8 A;  3AE7 B;  3ZUA A;  3AM9 A;  3SHF A;  1WJ4 A;  2F5Q A;  4W9J A;  4JGH B;  3EUB 2;  3W0L B;  3IT4 B;  4N8W A;  1QKZ A;  4IBK A;  4KT0 F;  2R9N A;  1YN3 A;  3PRE A;  1WE6 A;  3OF9 A;  3OVX A;  2QCU A;  3J7A S;  3MTN B;  1NVM A;  4ACF A; 
#chains in the Genus database with same CATH homology
 4DV1 M;  2DXI A;  3LQR A;  1JR3 A;  1NSF A;  3E4R A;  1YMH E;  1XC8 A;  4YWG G;  1TYG B;  3AEF B;  1YJJ A;  3ETR A;  1G41 A;  2PKO A;  1MVK A;  5EE3 A;  4UDU C;  3RGS A;  4US9 A;  2WXO A;  2R65 A;  4AKI A;  4NJC A;  3W5V B;  1L2B A;  1GVN A;  1Z5A A;  4XWW A;  3P63 A;  4B7H A;  3ZCB B;  2GRI A;  4R7G A;  2WXP A;  3GLG A;  4B3S M;  1LV7 A;  2RDH A;  3TEY A;  4DV6 M;  1SEB D;  2RMM A;  1PM5 A;  3ZNH A;  4DR6 M;  1N5W A;  3SFZ A;  3VRB B;  2YQZ A;  1DGH B;  1N75 A;  4X66 M;  1K51 A;  3U6M A;  2AGA A;  4IJE A;  4ITQ A;  1QQW A;  3TEW A;  3PO0 A;  4Q2J A;  3GPX A;  2CU3 A;  2F5N A;  4I5S A;  1L6V A;  4ZHO A;  3GO8 A;  5H8Y E;  4K0K M;  4USA A;  3W30 A;  2WXH A;  4P6V F;  2P5T A;  5F3W A;  3BVG A;  2VQE M;  3R8F A;  2Y3A A;  4WAF A;  4DV7 M;  3AEC B;  4A5U A;  4S12 A;  5BMH A;  4MGI E;  5EP4 A;  4HL4 A;  1IN4 A;  3I4V A;  4RF0 A;  3C8Y A;  1SSN A;  3EA6 A;  1ESF A;  4N59 A;  2AQ1 B;  4RGN A;  1W5S A;  2L83 A;  3AOG A;  3WHL A;  3U6D A;  3A98 B;  1F2R C;  3KQ4 A;  5IT9 S;  3KSX A;  5EXS A;  2WXF A;  4OZA A;  1FM0 D;  4BBA A;  1E9S A;  1YN5 A;  3VK7 A;  2BS3 B;  2E3T A;  4YTM B;  2AHM A;  4WQM A;  2BW2 A;  2N9K A;  4JXJ A;  4OVZ B;  3UGJ A;  2AX5 A;  1SXJ A;  2E5L M;  2QBY B;  3AE9 B;  4IBI A;  1SE3 A;  1TZO A;  1IN7 A;  4LF4 M;  3HU2 A;  4KX6 B;  2DZN B;  2M0A A;  4XDD A;  1E9M A;  2LH0 A;  4DXF A;  4XBO A;  1ET6 A;  1L0X B;  3U60 A;  3FKE A;  2FE8 A;  3CF6 E;  4LK0 M;  3T3N A;  4QOS A;  3CF0 A;  5E26 A;  1AYF A;  4KO8 A;  2BB6 A;  3AMZ A;  1VRA B;  5D3I B;  3TL4 X;  3W9C B;  3ZJV A;  4TMA B;  3ZJT A;  2RGO A;  2L1A A;  1C76 A;  2ZAO A;  1N77 A;  2CV0 A;  4LTU A;  3U6Q A;  2ACZ B;  4C7Z A;  4IDI A;  1SE2 A;  3DZD A;  1OFF A;  3HHX A;  4MM3 B;  2RKO A;  2X49 A;  1Q3C A;  1ACC A;  5KPT A;  1XF5 L;  1EM7 A;  2UUB M;  5IWA M;  4A9A A;  1PVJ A;  4D80 A;  5EXP A;  1XMQ M;  1IUE A;  2C9O A;  2ZM6 M;  3J80 S;  1DOI A;  4IP3 A;  3QWL A;  1B1Z A;  2CHG A;  2K9X A;  3KDS E;  4D2K A;  1IBK M;  2KZS A;  2Z4S A;  3GRU A;  4L4U A;  3RFW A;  5LMN M;  4YSY B;  3KW6 A;  2YEP F;  4P16 A;  1E94 E;  2DHR A;  2L7I A;  3FD9 A;  1IY0 A;  2HHH M;  5DNY A;  3MP2 A;  1DGB A;  1VDD A;  2CFO A;  3UI3 A;  2WXQ A;  3I4Y A;  1IN8 A;  1HNW M;  1PGA A;  3AL0 C;  1YJI A;  5EP2 A;  1K3W A;  3URY A;  4HJG E;  4FCT A;  1UM8 A;  2BYT A;  2R4J A;  3GLI B;  2UU9 M;  2QSD A;  3SFE B;  1PYW D;  1WGK A;  4FVM A;  1XXH B;  1XNQ M;  1CK1 A;  2R61 A;  1K53 A;  1IY1 A;  3P1M A;  4L15 A;  1G4A E;  2Q5W D;  1T3T A;  3UK6 A;  3UMM A;  5D7G A;  4IBC A;  1GAQ B;  2INN E;  3KFU G;  1DGF A;  1ZQ9 A;  4FD2 A;  3PRP A;  5ITX E;  3SAV A;  1DOY A;  2WU2 B;  1FMA D;  1HZ5 A;  1N34 M;  1JWS D;  1FEH A;  1HA5 A;  1ROE A;  3PHX A;  1R6B X;  3CIR B;  1IBX B;  2L7H A;  2PIA A;  4DXG A;  4JYA M;  4DV2 M;  2CJO A;  3CWI A;  5EE0 A;  2DBY A;  2LXE A;  1VZ6 A;  5EZQ A;  1JR3 D;  2BT6 A;  2JX5 A;  4KKJ A;  3B2G A;  1ENF A;  4ZHP A;  1C1K A;  3P4S B;  1EU3 A;  5ITY A;  4WH4 A;  5JZE A;  4I4L A;  1M4V A;  5H37 D;  4B0M A;  4LJ9 A;  1BML C;  2IGH A;  1D5Z C;  2J53 A;  1NEN B;  2WS3 B;  4TQ1 A;  4ARC A;  2ONQ A;  3C58 A;  2WDV B;  4IBG A;  1FD6 A;  1XCQ L;  3SAW A;  4IBJ A;  3U4E G;  2R62 A;  2JTC A;  1KFV A;  3ZJU A;  5AUK A;  4ZTB A;  3N9Y C;  1NHW C;  4LJ6 A;  4KHP M;  1NHG C;  1K3X A;  1NY5 A;  1HQY E;  2G1E A;  4YY3 M;  4A90 A;  3HWS A;  2JWU A;  3SR6 A;  4YXD B;  2FNA A;  4JX1 C;  2IJ0 A;  5KQ8 A;  4BOU A;  1EWC A;  2WXR A;  2LHE A;  2PTL A;  3FTD A;  4C56 C;  1TH4 A;  1PFD A;  4DR2 M;  3U2S C;  3U7Z A;  4RNA A;  3KP1 E;  2DWZ B;  3FUW A;  1WWT A;  5FKA C;  1IXR C;  4LG2 A;  1TKG A;  2Y5C A;  3JR5 A;  3I9V 1;  2Y20 A;  2D7E A;  4JI0 M;  2Y5P A;  1T6B X;  3SYK A;  4L23 A;  1XHB A;  4PDG A;  1NYQ A;  4DR7 M;  2DWM A;  4D8E A;  3IG5 A;  2JU6 X;  4CIS A;  1SXJ D;  2XGN A;  2X38 A;  2N7J A;  2J7N A;  3FC4 A;  5DYI A;  2XLJ A;  4JE3 B;  3V05 A;  2ZW1 A;  2VII A;  5BYQ A;  2KA6 B;  2KQ4 X;  5ITQ A;  4KLN A;  4FXC A;  5E6J A;  3BVZ A;  1L8Q A;  1BXT A;  3Q8X A;  2M19 A;  2OHF A;  1R2Y A;  1NNJ A;  1KFY B;  4MI7 A;  1N5X A;  3SEB A;  4RGO S;  5IRE B;  5HHD G;  3NVW A;  3MK6 A;  2QMT A;  5ITR A;  4WUR A;  3GQ5 A;  2Y0T A;  1QOG A;  8CAT A;  2J7Q A;  3L28 A;  2O5R A;  1N32 M;  4GUA A;  4X65 M;  1SJH D;  2PVG C;  4NOO B;  4KOD A;  4RKX A;  4JI6 M;  3QAU A;  2CHV A;  1HZ6 A;  2L32 A;  4RCO A;  1GOZ A;  4YTN B;  3PSE A;  4GC5 A;  1HXY D;  1J09 A;  3MC0 B;  2QZ4 A;  3GS2 A;  3BOS A;  4GLS C;  3IAS 1;  4W5W A;  4OU7 A;  4NZL B;  4LFB M;  4ZOH C;  4JWU C;  1TDH A;  2IPK D;  4GC9 A;  4JI4 M;  2RPV A;  4LFA M;  3JR4 A;  3PZ7 A;  3KOX E;  2W3S A;  1N36 M;  2CV2 A;  1FJG M;  4NXN M;  3GPY A;  1R7S A;  1K50 A;  3L2A A;  4FWG A;  3FYD A;  4M9S A;  4MB7 A;  4II7 A;  4G4N A;  1E32 A;  1TJE A;  2LJI A;  3GLH B;  1D2N A;  2WXI A;  4XWT A;  3HGI A;  4DR5 M;  2V4I B;  2EA0 A;  4RGM A;  4D81 A;  2VZK D;  1C4C A;  2D5G A;  3J9C A;  1EE8 A;  4IBD A;  3K1J A;  1MHH E;  1N63 A;  3RPF C;  3FIL A;  4G4Q A;  2WXN A;  4MAC A;  2Z8L A;  3VQI A;  5EE1 A;  3TSS A;  3T3O A;  3U60 B;  5FK9 C;  2GB1 A;  1GL6 A;  1C4P A;  5BPV A;  1SIJ A;  1TS2 A;  4FWH A;  3HRD D;  1FXI A;  3AN1 A;  1FCC C;  3KOZ E;  4LGY A;  1V97 A;  2DLB A;  4MGK E;  2R46 A;  1XNR M;  5G5H A;  2W82 A;  1R7R A;  2XNA C;  2WNM A;  3V3X A;  4ZPX A;  3GP1 A;  3D8B A;  3JAM S;  1ZXH A;  1Z6T A;  3SAU A;  2SEB D;  4DV0 M;  2V6Z M;  2LUM A;  3FUU A;  1E10 A;  2UXB M;  1YN4 A;  1D4B A;  1IXS B;  1DO0 A;  2TSS A;  2V3P A;  3O65 A;  3EIE A;  3VLF B;  4HRS A;  2R18 A;  4OZB A;  5ITT A;  3P4Q B;  1Q3B A;  3Q8C A;  3BYT B;  2KRK A;  2FFJ A;  4LRT A;  4PDI A;  1JQJ C;  2WDQ B;  4GH9 A;  2H89 B;  4DV5 M;  2YR0 A;  2BS2 B;  1QVR A;  4CGY B;  4GKK M;  4QHS A;  1PGX A;  2QIL A;  2JQR B;  2E6X A;  3FTC A;  3PXG A;  4GIT A;  2GI9 A;  2MJD A;  3MTV A;  4I81 A;  2BU3 A;  2JA2 A;  2I2Y A;  1YSY A;  1E0Z A;  1HNX M;  2KAC A;  3W2D A;  1G8P A;  4IOI E;  4L8R C;  3P42 A;  1KLU D;  4G4R A;  2R45 A;  2IGG A;  3U6P A;  3HU1 A;  5FTK A;  5D3D A;  2K0P A;  1AN8 A;  3NRZ A;  1SXJ C;  3SAR A;  3IXS A;  1CQV A;  4BOS A;  1VJK A;  3LVW A;  3ZQ4 A;  1N61 A;  2BBC A;  1QT9 A;  3UJN A;  2MH7 A;  4HEA 1;  2CEA A;  3NVV A;  1DGG A;  4OHJ A;  2V1U A;  3KXE C;  3GQ3 A;  1NI3 A;  1I4G A;  2PVO D;  1TKE A;  2V1C A;  3KS4 A;  2BJW A;  1R2Z A;  2X4A A;  1TY2 A;  4LJ4 A;  1TH3 A;  1GPX A;  4WIP A;  2RDG A;  1FO4 A;  1JQ4 A;  1YQ3 B;  1E9R A;  1L4Z B;  3PHW A;  3VKG A;  1ZOY B;  4NAW B;  3EGR A;  3VDP A;  4A6Q A;  3A46 A;  4NRW A;  1VLB A;  3THG A;  2XZF A;  4LF5 M;  3H4M A;  1IBL M;  1CZP A;  2F5O A;  4IBF A;  3SMS A;  3U6C A;  1MPE A;  1TS5 A;  4L2Y A;  5G5G A;  3W0F A;  1L0Y B;  3KOY E;  1OJL A;  1D6E C;  2Q2E B;  3AKZ A;  4LCB A;  4R3D A;  1SBB B;  4HRO A;  3SMP A;  4TQ0 A;  2HTM E;  4M0W A;  1ZPS A;  4DV3 M;  3L26 A;  3AOE A;  1N78 A;  2NQ8 C;  1HR0 M;  2Y0Q A;  5HG2 A;  2N9L A;  1Z5B A;  1FFU A;  1TGU A;  2M60 A;  4QNM A;  4PT5 A;  4WWM A;  2UZJ A;  1J5E M;  1C79 A;  3OTO M;  3GRV A;  2D7H A;  4J3O D;  2Z7J A;  4HKZ E;  4GMQ A;  2FBW B;  2QJL A;  2PW9 A;  1WXQ A;  2YEP B;  2L6O A;  3AOE C;  1NEK B;  1DYQ A;  4AI6 A;  5HFY A;  1SJE D;  1ORY B;  3MHZ A;  1D5X C;  3EIH A;  3T38 A;  1F0Z A;  1JW9 D;  1BUI C;  2H88 B;  2D7G A;  5C18 A;  4KGT A;  3FUX A;  3B9P A;  4AW4 A;  2Z4R A;  4TUW A;  3I57 A;  1E6E B;  4JI8 M;  3NWL A;  2WDR B;  4I8O A;  3SAT A;  2JSV X;  1K52 A;  3NBI A;  2M56 B;  1HQR D;  4NL4 H;  3FUT A;  2JYE A;  2CJN A;  4M9Z A;  2INP E;  1OFH A;  3R9X B;  1TY0 A;  3ABV B;  3ZYY X;  4AZF A;  5BYS A;  4B3M M;  3IT6 B;  3TWK A;  1YZB A;  2K5P A;  3GRR A;  3VDU A;  4ZYS A;  1VZ8 A;  1N60 A;  2LEK A;  3E9S A;  2XN9 C;  3L27 A;  4IBB A;  4LF7 M;  1QAN A;  2WXJ A;  3BWU D;  2IDY A;  1AW7 A;  1T3Q A;  5FR3 A;  3U61 A;  1Q39 A;  1GKI A;  2VQF M;  1YQ4 B;  2HL7 A;  1NJG A;  3RGP A;  2ERC A;  2C98 A;  5EXX A;  2L52 A;  1B9R A;  3K8Z A;  3HHZ A;  4CHT B;  1ZDX A;  3B9J A;  3KLS X;  3HJS A;  3GLI A;  1SB3 C;  3BII D;  4G4O A;  1AWD A;  3LYY A;  2YFQ A;  3GPP A;  1V1P A;  2R4E A;  1I7H A;  4NSO B;  1I4P A;  4JI3 M;  2PLP A;  3PT2 A;  3GQ4 A;  1E7P B;  3AED B;  2DWL A;  1FFV A;  2BTW A;  3DA1 A;  1YUB A;  1C78 A;  4XE0 A;  3MFG A;  3KP0 E;  4BOZ A;  4ZRQ A;  3A42 A;  3HU3 A;  4GKJ M;  1KTK A;  5LNK 1;  1I4H A;  3FUV A;  3GLF A;  5GXG B;  4YHH M;  2FUG 1;  2Z84 A;  4M9X A;  2C96 A;  5FTM A;  1GLN A;  4AKH A;  2LNH C;  1HQC A;  4BOQ A;  3VFD A;  1JWU D;  1PGB A;  4JI2 M;  1UNS A;  1NY6 A;  2JZP A;  1T5X D;  5JI2 E;  4DV4 M;  2WU5 B;  2WXL A;  2WXM A;  3PFI A;  1GB1 A;  2CE7 A;  2KRU A;  5FTJ A;  4LRS A;  2ZBK B;  2K3U A;  4B08 A;  1KLG D;  1I94 M;  1LO5 D;  1I4X A;  1QYR A;  3TQS A;  1L2C A;  1FNW A;  4D8B A;  4ITK A;  3ILK A;  2UUA M;  2DZO B;  2N0S B;  2HKJ A;  3P4P B;  4PCZ A;  4B3T M;  1XXG A;  1WSP A;  4B7F A;  2C5R A;  2WP9 B;  2XH9 A;  3AE6 B;  4MGH A;  4B3R M;  4EIW A;  3VR8 B;  4JI5 M;  3GLG B;  1SF0 A;  4WW0 A;  1IXZ A;  4G6Z A;  4C80 A;  3T1H M;  4JI7 M;  2QIE B;  2F5S A;  2X8A A;  3AEG B;  1PJI A;  2XFT A;  2EEL A;  3W5U B;  3P4R B;  3J2P B;  1ZE3 D;  2QPA A;  1VDV A;  4YSZ B;  2HWK A;  4LF8 M;  1MX0 A;  2ICI A;  3FAH A;  4IUM A;  1FCL A;  4LZJ A;  3LB8 C;  1HNZ M;  3HUI A;  3LXF A;  3AE4 B;  2J7O A;  4QHT A;  1KRH A;  2KW0 A;  7CAT A;  3RFZ B;  4GRI A;  1G59 A;  2I7P A;  1XWI A;  2J7Q C;  5JI3 E;  2XZU A;  2XSZ A;  4DR3 M;  1F2R I;  3K92 A;  5ITU A;  3GB1 A;  1MU5 A;  2L09 A;  1VR9 A;  5EP3 A;  1L2D A;  2I38 A;  1EWY C;  3Q8A A;  2J4X A;  1GL7 A;  3BVM A;  2FOI C;  1WRI A;  3RNV A;  4FCW A;  3NVZ A;  1SXJ B;  5A2Q S;  1XMO M;  1RM6 C;  4EE2 A;  5FTN A;  1P7F A;  2J42 A;  4C7Y A;  2H1R A;  1J7K A;  3PVS A;  3U5Z A;  2DWQ A;  4A55 A;  2W3R A;  1XLO A;  4GDK B;  4IBE A;  4LLG M;  3IAM 1;  5BR8 M;  3AH7 A;  1L1Z A;  1JWA D;  4REZ A;  3AE2 B;  2V3N A;  3AE8 B;  4GDL B;  3CF2 A;  4YSX B;  3AJI B;  5ITX A;  5JXV A;  5EE9 A;  1IN5 A;  3KSJ A;  1QOF A;  4JWS C;  1DOX A;  4GHA A;  1OQR A;  3DWG C;  4D8I A;  3IFU A;  3BK1 A;  1RWS A;  2OED A;  4FCV A;  2JYT A;  2C99 A;  1V1O A;  1G3I A;  5TSS A;  4DR1 M;  5T8I A;  2KZU A;  1FXA A;  3LQQ A;  1JWM D;  2KWD A;  3RE8 A;  4NXM M;  2NTT A;  3AE3 B;  2RGH A;  3C0R A;  3Q8E A;  2UUC M;  4NSR A;  3VK8 A;  1QIL A;  2WQY B;  3TWL A;  3LVV A;  1JRP A;  2G5G X;  3HHY A;  1QAM A;  2K22 A;  5MPO A;  2LHD A;  4JV5 M;  4QNR A;  4A8X C;  2C9C A;  4L78 A;  3GRY A;  2AQ3 B;  5EJC A;  1YNT E;  1UKF A;  2ZW0 A;  4LF9 M;  4N58 A;  3PZ8 A;  1QQR A;  3AEA B;  1KYI A;  4AG6 A;  3M6A A;  1QF6 A;  4IKG A;  4AKG A;  1ET9 A;  1KSF X;  2DYO A;  4BB9 A;  4OW0 A;  3K2L A;  1J7B A;  1NJF A;  3NUH B;  1FNN A;  4ZRP A;  1JCK B;  2DOS A;  1SE4 A;  2W54 A;  1QAO A;  2UXD M;  2ZAN A;  3GLH A;  2VZK B;  5KPZ A;  1OFI A;  2AQ2 B;  3NS1 A;  4US8 A;  3TE6 A;  2OQ4 A;  1XEE A;  3AE1 B;  3U6L A;  2BJV A;  2WXK A;  1TKY A;  3UZU A;  3R8B A;  3HHW A;  1F77 A;  5I4D A;  3ZGZ A;  1QLB B;  2BTE A;  3SHG B;  1ZAE A;  3SBJ A;  3AB5 A;  3ZC7 B;  1DGH A;  2NTS A;  3BZD B;  3W1S A;  3ZH9 B;  4RFB A;  4YTP B;  4AQY M;  4MGY E;  4X64 M;  4RF1 A;  4KGS A;  3VRA B;  2JXT A;  3D8L A;  2JRI A;  3WCQ A;  2G8L A;  3BK2 A;  3U52 E;  1VZ7 A;  4PD2 A;  2K47 A;  1I4Q A;  3MP9 A;  3MJ5 A;  3VR9 B;  4TSS A;  2EKI A;  3KWL A;  5EP1 A;  1NYR A;  3GP7 A;  2Z3X A;  3OWE B;  3KOW E;  4BLC A;  4MGZ E;  3O13 A;  3CTW B;  3HVZ A;  1J7C A;  4LFC M;  2A5Y B;  5FSW A;  2EUC A;  4NAM A;  2YNM D;  4Z8X A;  2KMM A;  1XCT L;  3HVD A;  3Q69 A;  3FTF A;  2ZAM A;  1MHX A;  5KQD A;  4OVZ A;  4DR4 M;  2QBY A;  1H6U A;  5DYG A;  4BOP A;  2G9H D;  2MJE A;  1ZXI A;  5BMI A;  1P7E A;  1UWX A;  3L29 A;  3TPZ A;  4LJ8 A;  1FRD A;  1PUT A;  1L5P A;  2CHQ A;  4HLQ A;  3TEX A;  3U61 B;  2WLB A;  3TWM A;  4L1B A;  3H8H A;  3NZ3 A;  2J52 A;  5EQT A;  2F5P A;  3KS8 A;  3AEB B;  1NNU C;  4FWD A;  3U6S A;  3U6O A;  4KKI A;  2BB5 A;  1TS3 A;  3SAS A;  3J81 S;  1KF6 B;  4A3V B;  1FNU A;  4MH0 E;  1JML A;  3TUO A;  1QOB A;  1C77 A;  2MJ3 A;  3E56 A;  3R2T A;  4AQ7 A;  3WHK A;  3FYC A;  1V1P B;  4B7G A;  1FNV A;  2Y21 A;  2NMQ A;  2BNK A;  4MT5 A;  3BBA A;  4YT0 B;  5LMU M;  4LJ7 A;  2XEP A;  2BTW B;  5EZS A;  1HT2 E;  2HDE A;  2DVW B;  1QZM A;  4XDC A;  4AG5 A;  4JN6 A;  2XSZ D;  1UUP A;  3GLF B;  4GHL A;  1TS4 A;  4OZC A;  1XLP A;  5EXT A;  2HCB A;  1Q10 A;  4IJF A;  1IBM M;  4FW9 A;  4X62 M;  4D82 A;  1DKI A;  2BS4 B;  1XLQ A;  4QOZ C;  2IGD A;  1FIQ A;  2DYM A;  1RYJ A;  1I4R A;  2LGI A;  3U6E A;  4MH8 A;  1DO2 A;  1S3S A;  1PJJ A;  3KWV A;  4GIP A;  1DGJ A;  1X37 A;  1D5M C;  4CQN A;  3FTE A;  4DUZ M;  1ZP0 B;  5C2T B;  1CJE A;  2LWX A;  5KO3 A;  2QEJ C;  4IIW A;  2DWN A;  1IGD A;  3SC3 A;  5AUI A;  1SXJ E;  4LJ5 A;  4N6E B;  3OQC A;  2ON8 A;  3HKP A;  3T1Y M;  1TH2 A;  2KXE A;  2V0G A;  3KVW A;  3TMP A;  3J27 B;  2KDM A;  3R2I A;  1XXH A;  2KAJ A;  1YE9 A;  2LMC A;  2KEB A;  1KH0 A;  2EO2 A;  3T15 A;  1MI0 A;  3HJ8 A;  1C4A A;  5IZ7 D;  4XZX A;  5FLX S;  1L4D B;  5FTL A;  1HEZ E;  2W55 A;  5BYR A;  2LFI A;  3BB7 A;  2SAK A;  5H92 C;  3AFH A;  4XGI A;  1ZUD 2;  4ARI A;  2MEK A;  1SXT A;  3NVY A;  1IBX A;  2CV1 A;  1ZDV A;  1PDX A;  4OX9 M;  1JAL A;  3HJQ A;  2QP9 X;  1QAQ A;  1EU4 A;  3PRM A;  1XLN A;  2F4V M;  1OQQ A;  1L0V B;  1W5T A;  5C1B A;  5C3J B;  4HKQ A;  1STE A;  3W31 A;  3DWM A;  3L4P A;  3SYL A;  3I51 A;  4LF6 M;  4H2A A;  1A70 A;  3M0E A;  3TEZ A;  1XO3 A;  3BY4 A;  3L25 A;  3PNV A;  4JPS A;  1C9F A;  4NRV A;  4LGM A;  2WXG A;  3U5Z B;  1J7A A;  3AEE B;  5KPR A;  1V8C A;  4AS1 A;  3AV0 A;  3FIL B;  3IG8 A;  3LMM A;  1Z59 A;  2OPF A;  2KN4 A;  2B76 B;  3TRK A;  1IQP A;  1RFK A;  1JRO A;  1IY2 A;  2XFS A;  3DOA A;  4DUY M;  1WYG A;  4KGR A;  2M5Z A;  1JWB D;  4L16 A;  1FRR A;  3B2F A;  3GPU A;  4LY6 A;  3VKH A;  5BMG A;  1Z5C A;  5GKN A;  3Q8B A;  3PHU A;  3J7B A;  4Z6Y A;  4LJA A;  1L6U A;  3MHV C;  3DFZ A;  3A45 A;  4O1N A;  3PNY A;  4RH6 A;  1K82 A;  3M7G A;  4B0E A;  1N33 M;  1IN6 A;  4M0D A;  1I4W A;  4JI1 M;  4HXD B;  1Y56 A;  3B21 A;  4RGT A;  4LZZ A;  3Q8F A;  2UXC M;  2XF3 A;  1NVI D;  2QEN A;  1IGC A;  1N62 A;  3BYY B;  4DQO C;  3AE5 B;  2I7N A;  1HT1 E;  1IM2 A;  1UWM A;  2CUZ A;  1TDZ A;  1L1T A;  2PMV A;  1UGJ A;  1QOA A;  1GB4 A;  3SFD B;  5HI1 A;  3AV8 A;  3AE7 B;  3AM9 A;  3SHF A;  2F5Q A;  3EUB 2;  3W0L B;  3IT4 B;  1QKZ A;  4IBK A;  1YN3 A;  2QCU A;  3J7A S;  1NVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...