4RF0A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p6522)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
318
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Protein binding
molecule keywords ORF1ab protein
total genus 78
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf0A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf0A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf0A03
4OVZB 4OW0A 4REZA 5KO3A 4PT5A 4MM3B 4P16A 3MJ5A 3MP2A 4RF1A 5E6JA 4WURA 3E9SA 4M0WA 4OVZA 4RNAA 2FE8A 4RF0A 4R3DA
chains in the Genus database with same CATH superfamily
2KDBA 2MJEA 2FNAA 2FS1A 1K8RB 3HM3A 4BBAA 3UF8A 1F29A 3B79A 3ERVA 3AECB 2HAKA 1F52A 2KK8A 1HQRD 4W9FA 3Q8CA 3C9PA 3O65B 4PYZA 3A98B 4WIPA 2XSZD 4CJ6A 4S12A 3SFDB 1DEUA 3HJQA 4GITA 4IDIA 2V9HA 1PPNA 2WSFF 3V60A 1GB1A 5KHOA 3FUWA 5FSWA 3MTNA 3VXWA 3TMPA 2ZTCA 4JL9A 3APFA 2K0BX 2QC8A 3BYTB 2ZBKB 4OVUA 3RGPA 2HXZA 1WXAA 3WALA 4LGYA 4QHSA 4D82A 1FXAA 1PPOA 2Y5BA 1UUPA 1YALA 4IJFA 3QYBA 3VKHA 3FYCA 3TL4X 4JLCA 4FWGA 2NR2A 4OX9M 1B1ZA 3ZH9B 7PCKA 3IFUA 1GL7A 2AU1A 4FJYA 4L16A 3H8BA 3QQ8B 4RGNA 2XH9A 1GVNA 4R7GA 1K82A 3H7PB 1J8CA 1I4WA 4E74A 3GRUA 3Q2AC 4KO8A 2NPTB 5IAAC 1CZPA 4GC9A 3CWIA 4DDGD 4PADA 2C98A 2JRIB 2W3SA 2INNE 1WXQA 3HHXA 2WX0A 3K9PB 3WA0A 5EXXA 4GDLA 2G8EA 1DGHB 1OTRA 2DWQA 1OAOC 3A1QB 3TEWA 1HT2E 3OJ3A 3R2TA 5HKHA 3UIPB 1J7CA 2KDLA 1QQRA 3KS8A 1VR9A 1NENB 5EXPA 1Q10A 2F5PA 1TS5A 2LJ5A 4AG6A 3U7DA 4AOFA 3P5VA 3U60A 3RFWA 1ME4A 3E56A 3NVZA 4RH6A 1XXGA 3BY4B 3FILA 4JE3B 3N4CA 1HE8A 2LFIA 3HHYA 3SYLA 3B89A 4AWJA 2M0AA 4NZLB 4KIKB 1VDVA 4LCDE 2HH5A 4JV5M 2R4JA 1N5WA 3LVVA 2EMSA 3KOYE 1N75A 2BT6A 2WX1A 4HKQA 2DAFA 1WF9A 4FWHA 1RYJA 2DYBA 2F1GA 4BSQA 4FA6A 3N1ZC 3GLFB 1WGRA 2K8BA 4PT5A 1U9XA 2XNAC 4IBEA 3H1UA 2RSUA 5EGWA 4IBIA 1NY6A 4GGQA 3SMSA 1L2DA 2JZ3B 2KWCA 1VZ7A 1VCBA 1FIQA 5IO9A 2R44A 2BQQA 1WGNA 1UNSA 2J0KA 4ACFA 5HI1A 3LCVB 2BBCA 4IM2A 2RRUA 1GOZA 3IBEA 4WH4A 4P1CC 4BOQA 4NRVA 1HR0M 4GHAA 4HJGE 3M6AA 1F77A 4KSLC 5DPWA 2E03A 2R2QA 2KO3A 4KDLB 5EF4A 3AV0A 3VTUA 1WJNA 2KTFA 3GLHE 4UDUC 1OIPA 1IQPA 4DV5M 5FK9C 3QC8B 3OLMD 3KH0A 3I3TA 2KHHA 3B7NA 3CIRB 4DR6M 2G8LA 4KGRA 2A4ZA 2BTWB 1UELA 3Q6BA 3CH2X 4L4UA 1NSFA 3BBAA 1H8CA 1MU5A 2DAIA 2JP7A 2MBEA 3H9DA 1L0VB 1ZXHA 2ICIA 4W9HA 2CRUA 2BS2B 2M4NA 4C7ZA 2RPQA 2KFKB 1EWYC 4G3OA 4I81A 1KFVA 2FCNA 5G2NA 3U7ZA 2KQ7A 1MPEA 4ICUA 3DWGC 3T3OA 3DBLB 4A5UA 3FRHA 4KHPM 5FTMA 1TGUA 5E6PA 3KWZA 2KZSA 5HG2A 4DDID 3GZNI 4RCOA 3ILKA 2AQ2B 3HHWA 4K3CA 3A9JA 1PJIA 3QSDA 4F8CB 1RRBA 4YWGG 1BUIC 2DZLA 4L1BA 5IOIA 3IT6B 3K8ZA 4CHKA 1PVJA 4BQVA 2X38A 2O6VA 2RDBC 4ZTBA 3A42A 2BF8B 3SASA 3EHVA 4G54A 2C99A 2BYTA 2E01A 4WJQA 1YUBA 4KLNA 1RAXA 4FHJA 3A46A 1PPPA 4G6ZA 1QDRA 3PW3A 1XXHE 3NHEA 3A9KB 4WQOB 1MG8A 5E26A 2INCC 1AARA 1XF5L 2G4SA 3AEBB 5ITXA 1SP4B 2MBHA 1YJIA 2DWZB 3DA1A 1TY0A 3PO0A 5ITUA 3BVGA 1QT9A 3RNCC 3WCQA 2IDYA 2FNJB 2F5QA 3GLFE 5IP4D 2KMMA 2DZMA 3AH7A 1NHWC 1W5TA 2RGFA 4WJOA 2M60A 2Z7JA 3QA8A 3HY5A 1V92A 1VQ1A 2KNAA 1V2YA 3PRMA 3GLIE 2KTRA 3NVWA 5EZQA 4B3RM 2CU3A 1IXRC 2GQFA 4E71A 3T15A 2FE8A 3FYDA 2CV1A 4HEA1 5BMHA 3NS1A 1KRHA 3KWLA 3KOWE 2J7NA 5A24A 1C79A 1NJGA 3U6EA 2HTHA 4ITKA 3H6SA 3HJ8A 1UKFA 4KT0F 2JPHA 1WZ0A 3R9XB 2I7NA 3FKYA 3M3JA 4NXNM 2BU3A 4S0RA 5JA7A 3KSEA 1P3QU 2WQYB 2DWMA 2VZKB 3U6LA 1CSBB 2WXMA 1TTNA 2M8SA 2KDEB 3HUIA 2BYEA 2QDFA 1UD7A 1MN3A 4DBGA 2REXA 3U6PA 1J5EM 1IGDA 3V61A 4YYRA 2YR0A 1V81A 3L27A 3W67A 1QZMA 1IBMM 3GQ3A 3WHLA 1RFKA 2CHWA 3V6EA 2X4AA 1QUSA 3KQ4A 2EUCA 4A20A 3ZKJC 2K0PA 1Z59A 1UBIA 3BPMA 1R2ZA 2IPKD 1IN4A 2OJRA 1NHGC 2YVCA 3APCA 4LZJA 2KJ6A 4J6IA 4X6IA 1NNJA 3PS6A 4AW4A 2MBOA 2YFQA 2QCUA 2H89B 1HQCA 3HIZA 3DOAA 3OF9A 4LJAA 1BY8A 2KRKA 3QHTA 4B0MA 4W5CA 3WXEA 1YOVB 4EFOA 2WXGA 3W0LB 4JGHB 2NBUA 3U2SC 3W1SC 1QAMA 3RNVA 2ATOA 1N34M 3WAPA 4HDOA 1TT5B 1U9WA 1RFAA 1MG4A 1FRDA 4D8IA 4YTPB 1SXJA 3L16A 5ITYA 3K2LA 3IVFA 3ABVB 2JF5A 3BK2A 3DVNV 1KOTA 2AHMA 2VF8A 2J7QC 5E6OA 2DJGB 1SIFA 2ZCBA 3W2DA 2AEHA 1KXRA 5EZSA 3N20C 1AYFA 3AL0C 1SE2A 1EFUB 3VAWA 4GU2A 3BB7A 4OW0A 4ICVA 3I01M 1CVZA 4IJEA 2O6VD 4JN6A 1ET6A 4EIWA 1FFVA 4AUQC 2FRAA 2A5UA 4KDIC 4PP2E 2HCBA 2V4LA 2OP3A 3AE9B 4RNAA 4ZYNA 4WA6A 4DK5A 1TF0B 3ZNGC 1Y56A 4W9LA 3WXFA 3A4RA 4BB9A 3J7AS 4CDFB 1IN7A 2K8CA 4M0WA 2Z3XA 1HEZE 2WDTB 3Q8EA 2AYOA 3I63C 2K8HA 2O2VA 2K6BA 5JH5C 4I4LA 2DZYA 1VJVA 3OVXA 3KDSE 2HD5B 2MBBB 3ZCBB 1I35A 3F5VA 4R71A 2WXJA 3ZUNA 2YJ9A 1T0RC 2AGAA 2ARYA 2X8AA 1STEA 4OZBA 1CK1A 4CISA 4XDDA 4HKZE 4LZZA 1WX8A 2YNMD 3ZQJA 1GLOA 1AUAA 1YQBA 1SEBD 4AKGA 4AKHA 2DZZA 3KX1A 1YLAA 1JWUD 1VZ6A 3T6PA 5C2TB 3SHQA 3RFZB 1QYRA 2JUOA 1VEKA 2BS4B 3NHEB 3HVZA 3A9KA 4ASWC 1R7SA 1UBQA 2FTDA 2KXJA 5DCNA 3P4PB 4IBCA 1MHHE 3QAQA 3X0WA 4HPMB 2IGHA 3DVGX 3DBLI 5D3IB 4QRGA 3DQVA 1P7EA 2PE6B 5G5GA 4B3TM 4B7GA 4JYAM 3SAWA 3DBRB 3BVZA 5EDSA 2IZVB 4WP2A 1XCQL 3E9SA 5IN7A 5D94A 4HVBA 1ZKHA 2KZUA 1AN8A 2F5SA 4GSWA 5EE3A 5BYSA 2KTRB 4TQ1A 3WHKA 2C0YA 1E10A 4GKKM 2L0FA 4OU7A 4RGMA 1ZAEA 2GBJA 2HTME 5CHWA 1JWAD 2KQ4X 5FR6A 3OWEB 5AZGA 2Y0QA 2CIOA 3OAWA 2MH8A 3PLVA 4Q8HA 5FKAC 1H4RA 3AE8B 2RPVA 3V76A 1MFWA 4XK8F 2IO0B 3EUB2 3NZ3A 3PHXA 4JI4M 3U6QA 3NS8A 2ZEQA 2PE9A 1YJJA 3WIMA 3AMZA 1IWDA 3F75A 3M7GA 1SGHA 3WANA 4IBBA 2WXHA 2BW2A 1GO5A 2KFJA 2KANA 2D3AA 5TSSA 3FE3A 1TIFA 2BPSA 2FH0A 4IBJA 2Y20A 1OEYA 4BBNC 4L23A 2F4VM 2M5ZA 1YIWA 4W9EA 2ZTDA 5LMNM 1D0MA 2NS5A 4M8MA 1BVSA 3PTFC 1PADA 4AQYM 2L8JA 3GP7A 4DV1M 3DDCB 2J53A 5G55A 4LDTD 1T0SC 2JX5A 4Q2JA 2DENB 2I2YA 3RNGC 4I6LB 2V6ZM 2CV0A 3P4RB 5EQTA 2LHGA 5DYGA 4GN1A 4O1NA 3R7RA 3BYYB 3TL5A 1ZIVA 2BDLA 2CB5A 4G4RA 2CKHB 4LNKA 1HXYD 5GXGB 4GIVA 8CATA 4M9SA 2ZM6M 2MJDA 1WGHA 3Q3NC 4XDCA 3AB5A 3AEAB 2Z4SA 2DC7A 5KO3A 2JZPA 3BVMA 4GLSC 1KHPA 1TS2A 5JI2E 2IGGA 1I4RA 2UUBM 1JRPA 5KQDA 2RDGA 3BWUD 3GS2A 2J0JA 1X1MA 3KS4A 2MEKA 1YQ3B 2JZ0A 3OJ4B 3ZC7B 1ITOA 1PJSA 5D3DA 3RZFA 2FT2A 1DGHA 3F92A 3SDLC 1AYVA 4JIOU 3GLHA 3EIEA 4KZCA 3PVSA 2IY1B 2C96A 3RD2A 1L4DB 2GBRA 3MHVC 1R4NB 3SAUA 2FCMA 2AIMA 2HE7A 2KLGA 2WDVB 4LJ6A 1N62A 3AE7B 1EO6A 4XGAB 1J7AA 5IA7A 1SNKA 4X62M 3R8FA 2R0IA 2WU5B 1NBFC 3U6OA 1GNUA 2ZVNA 3J27B 1N63A 2JA2A 3FILB 2KX3A 3NOBA 1MI0A 1OIZA 4GEWA 4FULA 1E8YA 4ZUXU 1XEEA 3IUTA 2R9NA 3VLFB 3TBLD 4WWMA 2FYEA 2JY6A 2YEPF 4LF7M 1C4AA 2MLBA 2WXIA 4FJVB 3SHFA 4TQ0A 5EE9A 1YN5A 1ATKA 1QKZA 4ZRPA 3VDUA 3L54A 3S3QA 2NMQA 1PGXA 4I04A 3VR8B 2R18A 3SYKA 3GLGB 2R46A 2DVWB 4KKJA 4RGOS 3PGEA 4FIPA 2M1MA 3H8CA 3EA6A 4ARIA 1HZ6A 1LFDA 4LJ7A 3CSTA 4B7FA 2WGSA 3FC4A 3W0FA 4MSQB 4NJCA 3R66C 3I5JC 4QOZC 4WJNA 4YXDB 1SXJC 2DXIA 4PDGA 1J7KA 3J80S 2DZOB 2ON8A 4KV2A 3CTWB 2GBNA 1FFUA 3I3TB 1GABA 3HKPA 4S17A 3LFYA 2CHGA 3LYYA 3QYEA 3DVGY 1IXZA 2ACTA 5K16A 1NVID 1V34A 4A55A 2FIDA 1P0RA 2JYEA 2L00B 3AE5B 5IWAM 3BPFA 2X49A 3CBJA 4FCWA 1WIAA 1I4PA 3C0RA 4FVMA 3U30A 4XWTA 4LNOA 5J18A 4JPSA 4XE0A 4D8EA 1J09A 2Z0EB 4G4QA 1LGRA 4L6V6 1CJEA 2CJNA 2FIFA 1CQVA 2QEJC 1Q02A 2XF3A 1ISNA 3JW0X 1IN6A 2XSZA 3H7PA 2KACA 2XLJA 3A9JB 3KSXA 4WWNA 4FK5A 4TUUA 2NPTA 2C7HA 3TEYA 3WAOA 3A4SC 2P5TA 2IO3B 3BOSA 2VQEM 2NVUI 3GE8C 2O25A 1TDZA 2WXFA 2CHVA 1RWSA 3B21A 1VD2A 1OFIA 4IG7B 4A9AA 2WDRB 4WAFA 1UGJA 2L4EA 2E5LM 3RMKC 1I4QA 1HNXM 2AX5A 2MSED 2WBFX 4MT5A 3RN9C 5IT9S 4CHTB 3QCAA 4XGIA 4LF4M 3K92A 4FWDA 2XZUA 2O5RA 3U60B 3PRPB 4LK0M 2DYOA 3ETRA 3HM6X 4EOYA 3PHWB 3KW5B 2N7JA 1DV0A 1HT1E 1EF1A 4AS1A 1YK7A 1XHBA 2BDZA 1PQSA 1QXPA 2ZW0A 4DXFA 4BVUC 4Q7JA 2LGSA 3R3MA 3TEXA 1GECE 3MTVA 5EP2A 1V49A 3HHZA 3VKGA 1VSNA 1TYGB 1N61A 1RLFA 5G5HA 3WAMA 2PVOD 3HHMA 2INDC 1YMHE 1V5OA 2B3AA 2NBWB 2L7IA 3MFGA 4BS6A 4GIPA 2LHCA 2W82A 2JZ1A 4DR7M 4I05A 1NI3A 2BWFA 2UWQA 3Q3FA 4N8WA 2LMCA 4HJKA 1FO4A 3NVYA 3L08A 2DCAA 3DHHC 2L0TA 2L83A 4HCNB 2FO5A 2LRUA 3DF0A 4PYUA 2M56B 2I1JA 2I1KA 2AS8A 4XR7A 3IT4B 1XB2B 4DMXA 1EWPA 2WYQA 4TUWA 3CF6E 4FJCA 4ZRKA 3VTVA 2H1RA 4P1BC 4XC2A 4KZ0A 1K3WA 5LXIB 3GPYA 1JW9D 4W9GA 1XMOM 3VFDA 3N1YC 1T3QA 1JCKB 2NQGA 3U6DA 2MBQA 2JWZA 2L05A 4LJPB 1A6RA 3ZJUA 4LLGM 4RY2A 1WXVA 1VDDA 3PNYA 2KNVA 1F9JA 3M63B 1EWMA 4P7IA 1WSPA 3BXWA 4NPNA 2DC8A 4L2YA 1QQWA 4L8RC 2KVRA 1NNUC 3K1JA 1N32M 4FJZA 1SXJB 2V4IB 1NYQA 1GL6A 4M0DA 1QAOA 4DV3M 3CSFA 3NJTA 4QBBA 3OF8A 4B3MM 3LDZE 3RI7C 3HGIA 4G50A 4W9JA 4LNIA 5J2RA 2LASA 2E3TA 2JT4B 1DYQA 1AIMA 1LXDA 2J42A 3KSJA 3SR6A 2MP2A 1AECA 2UUAM 3FUXA 1WX7A 3AN1A 4TMAB 3UMMA 3CH3X 2N7EA 3K24A 2QHOB 4ITQA 2DX5B 3P63A 1TDHA 1J0GA 4JWUC 1V33A 4ANRA 3RYTA 1Q6KA 3I57A 4X64M 2QIEB 1WGLA 4LF6M 2C60A 1VG5A 4KSKC 4MEMA 2OOAA 2L7HA 3FUUA 4NY0A 2J52A 3FRIA 4ZOHC 3AOEA 3ZIMA 1YE9A 2KWUB 4FHKA 3U52E 2KYWA 4G0NB 3I06A 4GUAA 5IKCM 2QBYB 2XU1A 4N59A 3I9V1 3KFUG 3LVWA 1E9RA 1IXSB 2JNHA 4HL4A 2O2VB 5J17A 1WJ4A 4E3CA 3EIHA 2W54A 4LNFA 1F2CA 4PS7A 1STFE 4DHJD 2N9EB 1WE6A 1IFYA 3MHZA 3R8BA 1PFDA 3AULA 4GRIA 3FTCA 4QRVA 1GKIA 3C8YA 2K22A 4KX6B 2D7EA 1CB5A 4N79A 4II7A 4B3SM 4YTNB 1WIVA 3Q8GA 1FPYA 2CV2A 2GI9A 3GRVA 2FBWB 3LJ3A 1G3IA 4W9DA 4BFRA 5E6NA 4IW0A 4FXCA 2WP9B 4BOSC 3SBJA 1QOBA 3DHIC 1YN3A 4Z8XA 4K7WA 1JR3A 1WXSA 5ITQA 4YYWA 4GH9A 3ZDTA 3TRKA 4LTUA 4TSSA 3THGA 1YT7A 3RVWA 1ZE3D 3UQBA 3AM9A 2LXAA 3KW9A 1PUTA 4BOUA 3MTNB 3VFKA 3GP1A 2NCNA 4I8OA 2N9LA 3NG0A 3IMAA 3SATA 5AZFA 1FCLA 4L78A 5DYIA 2H7JA 3UIOB 2CHXA 4W9KA 4RFBA 5FTJA 2DZNB 3NBIA 1GC6A 2QSDA 1V5TA 1JALA 3AEDB 3JSVA 1T6BX 4K0KM 5J94A 1D5XC 3IXSA 2KNZA 2DAMA 1GMYA 3IG3A 4LFAM 2QJLA 3KWBX 4EEWA 1GLNA 4P6GA 3RNAC 3RNBC 4ANUA 3TEZA 1XWIA 3W5VB 4LCBA 1FMAD 1MDWA 3HX3A 3PREA 3P4QB 5BO4B 2AUXA 4Y28F 2ZAOA 7CATA 2GBKA 5BYRA 2K3UA 5L8RF 5DFLA 2K39A 3R7QA 1TY2A 2WDQB 4DV6M 2D07B 4WQMA 4F2LA 2CUZA 3TPZA 3B9JA 4YHHM 2OO9A 4K7UA 1TLOA 2DLBA 1E7VA 3EC8A 3VTWA 1WJ7A 3BK1A 3UGJA 5IREB 3LXSA 2BNKA 2PTLA 3B0AA 1XNRM 2APLA 4MSMB 3DBHB 2YLMA 4CGYB 3C9EA 4MGYE 2AUZA 3IV2A 4QNRA 3W1SA 2FUDA 3Q14C 4LY6A 1KLGD 4D81A 5JZEB 1PIPA 3Q69A 2G45B 3J9CA 3ONSA 3NZUA 2LZ6A 1BMLC 2G7YA 2K6QA 3RUIB 3IHPA 2HJ8A 1O0EA 1HQYE 4KLBA 2PW9A 1L4ZB 1C4PA 2JQRB 4DR4M 5CVOB 3RNFC 4ARCA 1CUKA 3I4VA 2JXNA 4FCTA 4IBGA 1MHXA 2KJHB 4GMQA 3T1YM 2JSVX 1JQJC 3L17A 4C4VB 1UZXB 3BOWA 1NVMA 1FNUA 2BKRB 1TH3A 4HDQA 2LGXA 1AIPC 1JQ4A 3GQ5A 2EO2A 3GLFA 3LMMA 3C19A 2R61A 5D2MB 5HHDG 2C7NB 1F2AA 1SE4A 2Z4RA 2PBHA 5EP4A 3OG5A 1OEYJ 1A70A 3SFEB 1ACCA 1UGMA 2KOXA 4HEOA 1Z2MA 2UXCM 4OZCA 5EP3A 3B2GA 4NNJB 4PCZA 1WJUA 1YVBA 2LUMA 3AJIB 2AL3A 4ZRIA 3KUDB 3VRAB 1TS3A 1HNWM 4IC7B 3DPDA 3KUZA 3QX1A 4NAWA 4B08A 2PKOA 5C18A 4YY3M 2PEAA 1JQPA 4AQ7A 4M9XA 2JZZA 5AUKA 3T9LA 4DV2M 3CMMB 3AE6B 1DOXA 1GJTA 4LRSA 2KD0A 4IM3A 2MQJA 1NB3A 4M00A 2YJCA 1XMQM 2UXBM 3NBXX 1TL9A 1Y8GA 3P4SB 2N4FA 2EJSA 1E8ZA 2FAZA 5BMIA 4YSZB 3ML9A 3GZNB 2ZAMA 3VK7A 1KLVA 1KYIA 4YTMB 2H5XA 2PNSA 3E1ZB 3QIJA 3N3KB 1RU3A 4MH8A 1WMHA 4A3OA 1VEGA 3TWLA 2V3PA 3KYCD 3JAMS 4YSXB 1I4GA 4DHZB 4K7CA 5CVMA 2BJVA 1IM2A 1N5XA 1PCIA 3PDFA 1OKSA 1NV9A 4LFCM 1WRDB 3BBZA 3W68A 4GHLA 4ANVA 5JXVA 3KWVA 2H88B 2J0MA 3PHXB 2W9NA 3DHGC 2KC1A 1NL6A 1ZMWA 1C1KA 1YJ1A 1A5TA 2WXQA 2WSCF 1WM3A 1WYGA 4LJ9A 3VRBB 1TKYA 2X8XX 3IHPC 4ZRQA 3RT3B 4HCPB 4B0EA 2L09A 3QARA 3UINB 2VDBB 4RM8A 4NL4H 4XUIA 2KN4A 1EUVB 3R2IA 2GOWA 1AWDA 1CMXB 2N0SB 2R9CA 3MP2A 4C00A 3C0RB 4A6QA 2LH0A 3L13A 4Q8GA 1QMYA 2Y5PA 2LGIA 2WS3B 1X9YA 1TKGA 3NWLA 2IY0B 1L2NA 1PYWD 3EFCA 1F2RC 2AQ1B 2WWZA 4JQWC 4MGIE 2K5PA 1TS4A 1EE8A 1SE3A 1WM2A 1TJEA 2FQ9A 2KXEA 1NJFA 1XD3B 4QRXA 3H7SA 4AZFA 4A3PA 2NQ8C 1Z5BA 1EF5A 1WRIA 2K25A 1OGWA 4L15A 2NBVB 3VK8A 3BC3A 3Q3OC 3SD5A 1BGOA 3LQQA 2OOBB 2L32A 1YX5B 4MELA 2FFJA 2FUG1 4I07A 3AEFB 4AKIA 3ZJTA 2AQ3B 5BPVA 9PAPA 5CVNB 2J7QA 1NI2A 2LEKA 5LNK1 2D5GA 1XC8A 5H37D 1XLNA 1P98A 1ROEA 2FCQA 2L3ZA 1XXHA 1WFYA 4BKGA 2NQAA 4OELA 3GLHB 3U6SA 2K1FA 5D6JB 3VH3B 1OFFA 3DFZA 3PNVA 2FCSA 2WLBA 1QVRA 2NTSA 2DHZA 4BPVA 2PPHA 4GC5A 5JI3E 1R4MI 1PDXA 1OJLA 2Z0DB 2KLCA 2JXTA 4ZHPA 4D8BA 3PRPA 1NDDA 1MJGM 3BZDB 1DGGA 4JI8M 1V80A 4NQKE 2O01F 5IZ7D 3ZLZA 4MI7A 1PJQA 2C9OA 2QZ4A 1JWSD 3HJSA 2D2QA 4LGMA 1M6DA 4B7HA 3GQ4A 2JY6B 1TH4A 4C4VA 1IYFA 3PVLA 1R4GA 2KMAA 1VRAB 1DOIA 1KF6B 2LVQA 4B9KA 1N77A 1NEKB 2LVPA 5CHTA 1D4BA 3L4PA 3JVZX 1U9QX 4MM3A 2D7HA 2CE7A 4IUMB 1KSFX 4KGTA 4LF9M 1PBHA 4RM9A 3DCGA 3T3NA 4REZA 1TGZB 3QJZA 4YV8A 3UI3A 2SEBD 4F1IA 3H89A 3KFQA 1V86A 4A90A 2BGFA 3OISA 2OPFA 1GJZA 1FD6A 1XNQM 4F7ZA 2KKCA 2OULA 4H2AA 3Q3MC 1CS8A 1QOLA 4C7YA 1ZUD2 5C3JB 3ENEA 1E90A 4AJYB 2WXRA 5KHQA 4HK2A 4YVAA 4NAMA 1L0YB 3QWLA 1Z5CA 4N6EB 3HVDA 4YL8A 3D8LA 2DAJA 3P2BA 1V97A 2M17A 1FCCC 2F7DA 2N7DA 1WR1A 3B1LX 3MHSD 3PRZA 5FPWA 5AZHA 1KFYB 2EMTA 4DV4M 3KOZE 4BKTA 4MGHA 5CTRC 1IY0A 2G1EA 1LQBA 2ACZB 2BTEA 4GOCA 4X65M 3AV8A 3UGBB 1SJED 2DHRA 3S2AA 2LHDA 1J19A 1BT0A 4YYVA 1T0QC 4X66M 2XBBC 2WSEF 2R9OA 1WZ3A 4AP4C 3AFHA 3BWKA 2QHOA 1C76A 1LM8B 1AU4A 3GE3C 3E4RA 3TWMA 2J4XA 1BQIA 2GNOA 3DBRI 4NQLB 4RKXA 2WXOA 4IWPA 2EA0A 1AW7A 2LGYA 4K3BA 2K9DA 5CHVC 3FAHA 2KJRA 1M4VA 3NVVA 2Y5BB 1OQQA 3MC0B 1ZDVA 3D8BA 4II3B 1E94E 3PLUA 2PJHA 4P6EA 4WWPA 5BYQA 3KP1E 4ZHOA 4LG2A 4URKA 2JXXA 1V6EA 3HHIA 1P1AA 2JWUA 4P16A 2R9MA 1G4AE 2JQGR 2LWXA 3M0EA 2JRHA 2DCDA 1FM0D 3MJWA 1VLBA 3KXEC 5FR3A 3FUTA 4I5SA 3RVVA 2R2OA 3Q8XA 3EECA 4HLEA 4DR3M 5T8IA 4BBNF 5EXTA 1ZDXA 1EWCA 2RD0A 3J2PB 2MX2A 1JROA 4EZJA 3RE8A 1S4VA 2BJWA 2G5GX 3PT2B 4RKUF 1K53A 1L8QA 3TCAA 3JR4A 1XQQA 3NRZA 3O1GA 1TR8A 1XXHB 2LVAA 2MCNB 3KYDD 1ORYB 4BLCA 3SU8X 4X6HA 4LFBM 1TZ1A 2XU3A 3UJNA 3GB1A 2KVZA 2BKFA 4J3OD 2XK5B 3GRRA 4DV7M 2LUEA 3A45A 3Q8BA 2P0RA 3U61B 1ZV1A 4X57B 4TV3A 1R6BX 5E6JA 2LVQD 4A8XC 1GPXA 3BY4A 3MORA 2N35A 3GOEA 4WAAA 2XFTA 3ZNZB 1AYWA 2RMMA 1EM7A 6PADA 3P5XA 2HJ1A 2P86A 1QLBB 2Z8LA 3B08A 2R45A 2DENA 2UZJA 2UYZB 4BAXA 4QH6A 2Z8YM 2DAGA 1L2BA 4DMYA 4CQNA 4JWSC 1L6VA 1EU3A 2GFOA 4MSXA 3USVA 1WGGA 1UM8A 2DC6A 2R4EA 4XBOA 1I94M 5C1ZA 1TZOA 3L29A 2IO2B 3ZDMC 2KMCA 3VQIA 1E5WA 3OTOM 1Y8RC 1MEGA 4XYCA 1E7PB 2MJ5B 5A2QS 1WXMA 1HJPA 3I51A 2BB6A 4EKUA 1E8WA 3N32A 4CYEA 3SFZA 2MW5A 2LTUA 5JH3A 4F1SA 3B9PA 4QNMA 1QANA 3AU5A 3W9CB 4LJ5A 2DYMA 5HFYA 2CFOA 3IEJA 3MJ5A 1E6EB 1ZW7A 4W5BA 2RKOA 5JZEA 2OEDA 2NQIA 3IG5A 3MHSA 1Y08A 1SSNA 3ZNHA 3ZXVA 4WWOA 1DKIA 1GAQB 1NPZA 1EWLA 1P9DU 3OVZA 3UZUA 3PSEB 2CEAA 1PPDA 1PRBA 4TKNA 3AXCA 3P5UA 2B3TA 1S3SA 2Y3AA 3HU2A 3V62A 3J7BA 1Y4HA 2IBIA 1OQRA 1L7YA 5JHAA 1WR1B 1L0XB 2JVCA 4M02A 4EUTA 4X6JA 2FOIC 2TSSA 3URYA 3ZGZA 1IXSA 2QMTA 2AL6A 2BWBA 1V8CA 2XZFA 2RDHA 1AYUA 3QT4A 4R3DA 1EWOA 1CQDA 5LXHA 4AJWA 2KA6B 3B74A 4MDKE 4P6VF 2V0GA 2G6DA 5CHVA 3C3DA 2DI0A 1N60A 2R65A 2VF7A 4XX5A 5JHBA 3N3GA 4CDDB 3H4MA 1K3BB 3PBHA 4JI6M 3RULA 2ZPNA 2CS4A 2O6VB 1EU4A 3H4JA 4MH0E 1L5PA 4II2B 1IN5A 3A33B 1PM5A 3TQSA 1YX6B 5MPOA 1KM7A 1R4NI 1FNNA 4JI0M 1CTEA 1SIJA 1CV8A 3HK0A 1Q5WB 3HU1A 2CU1A 5BR8M 1D6EC 2CHQA 3GO8A 4ZDVA 1BXTA 1F1HA 4I6NB 1SXJD 2L1AA 3SAVA 1DGFA 1W5SA 4N4ZA 1H6UA 5H92C 1IBXB 3GPUA 3T8MA 4BKSA 2IPPB 3MMPA 2VIIA 2B76B 2DC9A 4M8NA 3N30A 4GXBA 3HZJA 1VZ8A 3PZDA 3QWZB 1D0LA 1JWBD 1T5XD 3ML8A 5AEKB 1Q1OA 1YD8U 1SE9A 4YYSA 1V1OA 1F2BA 2KX0A 5EJCA 4GKJM 5LMUM 2HWKA 4W9IA 3JSVB 1WMHB 3N3KA 1IN8A 1JWMD 2KNBA 2WXPA 3AOGA 3U8ZA 4IM0A 1I4HA 1GUAB 1IY1A 2KW0A 1AU3A 2V1YA 3TSSA 1L1TA 4NJ7A 3AKZA 2DBYA 4W9CA 3B7QA 2W55A 1JR3D 1IGCA 2PLPA 4ZPXA 3GPXA 4Z6YA 1SBBB 3LB8C 1I42A 1EF7A 2KEBA 1L1ZA 3W1YA 1IBLM 3O65A 5AUIA 1F4IA 1R4MB 4PS8A 3ZUAA 4PDIA 1XT9B 1T43A 2D3BA 2VHFA 2HHHM 2SAKA 3UQAA 1XCTL 1NLJA 5ITRA 3U61A 2QQ8A 2V1CA 4IBFA 3TMPB 2CHZA 3FD9A 5CX3A 1MEMA 2JY5A 2J5YA 1SXTA 4KVGB 4QAYA 4RGTA 4ZRJA 1K3XA 1Z5SB 1DGBA 3BINA 1QZEA 4G4OA 1ESFA 2OJWA 4ZYSA 3RZWC 1AU0A 3EFUA 3M95A 4HXDB 2M0XA 1ENFA 1ME3A 1NO1A 4DQOC 1UWXA 2KN5A 4LRTA 2MA9B 4FADA 3KP0E 1WGYA 1HTOA 4DUZM 2GB1A 2VHSA 1TH2A 1TU6A 3PHWA 2XEWA 1HZ5A 3RCZA 4OEMA 2DKLA 1ZMVA 1TKEA 3H6NA 1GC7A 4ANWA 1LO5D 3GLIB 4DR1M 1PGYA 2N1WA 3GCBA 2YJBA 4MB7A 1ZCMA 2YJ8A 2EKKA 4RF0A 2I38A 3SMPA 3ZVVA 2JRIA 1YN4A 3LQRA 4PP1A 4JI3M 2D3CA 2BYFA 2GBMA 3IAS1 3K9PA 1F2RI 1QOAA 1E9MA 4GDKB 3Q8AA 1FRRA 2DNFA 3SC3A 3B2FA 4LDTB 2DWNA 4US9A 3O0UA 1Q3BA 3ZNHB 3C58A 1N78A 1KTKA 1LV7A 2I7PA 2KWVB 5BMGA 1ZXIA 2O6XA 4QHTA 5DNYA 4DV0M 4HLQA 3PZ8A 1UWMA 5C23A 2DAKA 2DAEA 1ZOYB 4DHJB 1WJ6A 5F3WA 4YYUA 3APDA 1A5RA 2JYTA 1T0YA 3KVWA 2MJ3A 3KVFB 4NSRA 4DXGA 3M99A 4FCVA 2ZNVC 1L2CA 1YSYA 4XZ4A 4WURA 3BCNA 1JB0F 4P17A 4BKSD 2HD5A 1ZQ9A 2DWLA 3QJ3A 3DVNU 1L6UA 2L2DA 2UUCM 3U6MA 1C4CA 3C3EA 2K6DB 3PZ7A 5EE0A 1NV8A 2KZRA 1DF0A 3DOWA 3ZQ4A 1UF0A 1NB5A 1Q3CA 5L95C 1PE6A 1WH3A 2F5OA 3PFIA 4JI5M 2JU6X 1K52A 2LBCA 1SB3C 4JI1M 5GMVA 5DPSA 4W4UA 2N9KA 4DR2M 3PPAA 1VJKA 4MGZE 1GB4A 4BOSA 3IFWB 2JTCA 2MP2B 2UXDM 1SJHD 3KUCB 3QK0A 4N58A 4DHZE 3UK6A 2EELA 4YSYB 1XLQA 2CP8A 3MC9A 2Q2EB 4BS5A 1G8PA 2JY8A 1J7BA 2KDIA 2N1VA 2V3NA 2N9XA 3ZTDA 2BS3B 3H8HA 1R7RA 2PIAA 4NSOB 2GMIC 5ITXE 1E8XA 1G71A 2BWES 2QPAA 2GRIA 1D0KA 4MACA 2LI5A 5FTKA 1V1PB 4B95A 5F02A 2GHUA 2WXNA 1K50A 4XWWA 2L76A 4MJSA 3S3RA 4MGKE 3AI5A 4NC6A 2XGNA 2G9HD 1MX0A 2KFKA 4RF1A 3SHGB 3T1HM 3AEGB 3IOQA 4CZWA 4BOZA 3NZSA 3FTFA 4HWYA 2DHYA 2YJ2A 4JI7M 4WW0A 1R2YA 1VEJA 4AXMA 1YQ4B 2CJOA 5I4DA 1N33M 3ZTCA 2LVOC 2OHFA 4OHJA 4DWFA 2LVOA 4W5WA 5EP1A 4K81A 2DZJA 1DGJA 4HRSA 3VR9B 2Y5CA 2VH1A 2B1MA 2ZANA 1R5LA 4IIWA 3I04M 2ZJDA 5FTNA 2J7QB 4OVZA 3PV1A 1BP4A 2HWJA 4GDLB 1HTQA 3LXFA 1OTRB 3TIXA 3RNEC 1S3SG 3L2AA 1QDQA 3T38A 1NYRA 3LCUA 2LD9A 2LWPA 2DJFB 3CGWA 3L0WB 4HWIB 3V3XA 4M9ZA 1TBEA 4EZKA 2Q5WD 2V1UA 3VDZA 1E0ZA 4N9F4 2XU4A 5KPRA 1QOFA 5L83A 1GG3A 3E21A 1IUEA 1SXJE 3GLIA 1MIRA 4MZOA 3AEEB 3W5UB 2UU9M 3KKUA 2LXCA 1WWTA 1QOGA 3X23A 5KQ8A 2BYVE 3U8EA 1RM6C 4ANXA 1ET9A 1UFZA 1I4XA 2LXEA 2QSFX 2DZKA 3ZYYX 4LF8M 2ASQA 3TJPA 2E02A 1WI0A 4FW9A 4DR5M 5C1BA 2C7MB 4G4NA 1FJGM 4CIZA 3DBHI 1ICFA 3TNXA 2G3QA 4LNNA 3FKEA 4A3VB 2KC2A 2FUHB 5DPTA 1WE7A 1OFHA 2K9XA 2LGDA 1FXTB 3E46A 3D32A 2Z59B 2L7RA 4FN2A 3PNRA 2BVCA 1QDTA 2VQFM 3V6EB 4JX1C 4WJPA 2ZNVB 3BIID 1GCBA 3AI8A 2DZIA 2Y6EA 1YK8A 2BB5A 1U9VA 5PADA 2YQZA 4PD2A 3L10B 4LF5M 2KAJA 1NQCA 2M19A 2PVGC 2Z84A 3L25A 2WXLA 1QILA 1KFUL 4IP3A 2JY7A 2HKJA 3V6CA 4OVVA 3PHUA 4LJOB 3VVWB 4FD2A 1MHWA 1N36M 2RGHA 3ZW3A 1G6JA 1KH0A 2C9WB 1ZP0B 2OZ2A 2P7UA 2EKFA 1PJJA 5EE1A 2DCBA 2BTWA 4CO7A 2G8JA 4YT0B 5FLXS 1XLPA 2A5YB 2MRPA 4IWQA 1D5MC 4JXJA 1UH6A 2ZVOA 2VRRB 3N9YC 1G41A 3IAM1 1K51A 5H8YE 2IYDB 4M01A 2WNMA 1KFXL 1V9JA 4AG5A 2IJ0A 4YYQA 1SG9A 2Y21A 3ECIA 4IKGA 1B9RA 3AE2B 1FXIA 4D80A 2K47A 2ERCA 2N9PC 3ZJVA 4RMAA 2JWSA 3P5WA 2EKEC 3I4YA 4PI3A 4XZXA 1FH0A 3RGSA 2C5LC 1ZGUB 3CBKA 3ZRCA 4DXAB 2LJIA 5D7GA 2AYNA 3KLSX 2LNHC 2CWBA 3P42A 3W30A 3VUWA 2D11A 3VUYA 2XU5A 1JR3E 4DUYM 5LLIA 3CF2A 1WY8A 3KW6A 3PSEA 1V1PA 2E00A 1S1QB 4NAWB 2WHIA 2QP9X 3ZNID 4EE2A 1IPGA 4US8A 4BZAA 4MJSB 1YZBA 3TUOA 4KGSA 2IBIB 3LW5F 2B1NA 3DWMA 1HNZM 1E32A 3VDPA 2MR9A 3AU4A 4HROA 2KDFB 1WYWB 1FNVA 3U6CA 2BWEA 3U5ZA 2MWSB 2AYOB 3MP9A 5DPRA 3JR5A 1P7FA 3DZDA 1ZPSA 3K9OA 4BOZB 1CPJA 1WR6E 2JUJA 1Z5AA 1U5IA 1QUTA 2NQDB 2XEPA 5CHFA 1ZMUA 5TR5A 1D5ZC 2QNJA 3NY5A 3PRMB 1MVKA 2D10A 3AOEC 1GJSA 3IG8A 3W31A 3MHHA 4JI2M 2R6FA 1XLOA 3Q3JA 2YEPB 2LHEA 3KOXE 3L28A 1EIJA 3GLGE 3CF0A 1KHQA 4IWOA 1YNTE 4OVZB 2FRQA 1JRUA 3AE4B 3PT2A 2R62A 2C5RA 3ALBA 2MHJA 2VH2A 1F0ZA 4PS3A 3TWKA 1X37A 1C7YA 1JMLA 2LRWA 2DCCA 3AE1B 1IBXA 1POPA 3PXGA 2XK5A 1C3TA 4DBGB 2L6OA 4BOPA 3J81S 4UN2B 2D7GA 3V05A 1C9FA 2XFSA 3U4EG 4I6PA 3RVXA 4C56C 4NRWA 2IGDA 3VHTC 1IBKM 2RR9A 4B6WA 2QILA 3K9MA 4CDEB 3SARA 4D2KA 4IBKA 5GKNA 3D6SA 3VUXA 2AWTA 1HA5A 3WXGA 1E9SA 3RPFC 2DNAA 8PCHA 1FNWA 3O13A 4CDCB 1KLUD 2DOSA 3GPPA 1CJLA 2ZZPB 5EXSA 4HPPA 4G3XB 2WZJA 2WXKA 3L26A 4K7SA 1WX9A 3DBSA 2R6NA 3ZRFA 2ZPYA 2KRUA 4LJ4A 4K1RB 1IP9A 3ZXRA 3HWSA 2KHWB 3K8UA 1DOYA 1XO3A 2KDMA 2C9CA 2G3QB 4MZSA 2E6XA 3MK6A 2L52A 2OOBA 3Q8FA 4FBJB 1NY5A 2PMVA 2QCZA 1E7UA 3FTDA 2XN9C 2ZCCA 2PADA 3ZO5B 3OQCA 2HL7A 2MGWA 4KKIA 1MJDA 4GMVA 3A1QA 1WGKA 2EKIA 1PJTA 3NUHB 3HRDD 4HXDA 2ONQA 2UU7A 1DO2A 1T3TA 3SEBA 5FTLA 1C77A 4USAA 3V6CB 3GRYA 4IBDA 2OQ4A 4AI6A 2PREA 1QAQA 2MROB 1LTMA 3IECA 4NJ6A 1WGDA 2VZKD 3MC8A 4NOOB 2HHNA 2IO1B 1Q39A 4LJ8A 2HDEA 1AU2A 2JQFR 4KIKA 1SF0A 4KODA 1OQYA 1PXVA 1VDLA 4M0WB 3P1MA 4IOIE 2W3RA 1C1YB 2GLSA 3HHAA 4NXMM 4MM3B 3N1XC 2WU2B 1G59A 2AVWA 3HWNA 4GDKA 1D3ZA 1WHCA 1P3QQ 4IUMA 1HUCB 1MS6A 1XKGA 2F5NA 2INPE 2CR5A 3AE3B 1FEHA 1M94A 1IY2A 1PGBA 4G11A 2R9FA 3FUVA 2D3GA 3JYUA 1TTEA 3QAUA 2KQSA 5ITTA 3VH4B 4C80A 2MH7A 1DO0A 5KPTA 2KT7A 1D2NA 1KJTA 4PK1A 3FTEA 1N6ZA 4HPLB 1I7HA 1C78A 2LVPC 3B7ZA 3TE6A 5KPZA 1THEA 2RGOA 2QBYA 2G4DB 3U5ZB 2NTTA 2KWDA 1OAIA 3HD3A 3HU3A 3K9OB 4FLHA 2QENA 4EZLA 4QOSA 1Q0WB 4GB9A 2Y0TA 2ZW1A 1U4AA 1PGAA 3M62B 3EGRA 1T6OA 2V3SA 1QF6A 3GLGA 2LVNC 3H7DA 1Z6TA 2J7OA 4OZAA 4AXLA 2L4FA
chains in the Genus database with same CATH topology
2MJEA 2FNAA 4BBAA 3AECB 1HQRD 3Q8CA 3A98B 4WIPA 2XSZD 4S12A 3SFDB 3HJQA 4GITA 4IDIA 1GB1A 3FUWA 5FSWA 3TMPA 3BYTB 2ZBKB 3RGPA 4LGYA 4QHSA 4D82A 1FXAA 1UUPA 4IJFA 3VKHA 3FYCA 3TL4X 4FWGA 4OX9M 1B1ZA 3ZH9B 3IFUA 1GL7A 4L16A 4RGNA 2XH9A 1GVNA 4R7GA 1K82A 1I4WA 3GRUA 4KO8A 1CZPA 4GC9A 3CWIA 2C98A 2W3SA 2INNE 1WXQA 3HHXA 5EXXA 1DGHB 2DWQA 3TEWA 1HT2E 3R2TA 1J7CA 1QQRA 3KS8A 1VR9A 1NENB 5EXPA 1Q10A 2F5PA 1TS5A 4AG6A 3U60A 3RFWA 3E56A 3NVZA 4RH6A 1XXGA 3FILA 4JE3B 2LFIA 3HHYA 3SYLA 2M0AA 4NZLB 1VDVA 4JV5M 2R4JA 1N5WA 3LVVA 3KOYE 1N75A 2BT6A 4HKQA 4FWHA 1RYJA 3GLFB 4PT5A 2XNAC 4IBEA 4IBIA 1NY6A 3SMSA 1L2DA 1VZ7A 1FIQA 1UNSA 5HI1A 2BBCA 1GOZA 4WH4A 4BOQA 4NRVA 1HR0M 4GHAA 4HJGE 3M6AA 1F77A 3AV0A 4UDUC 1IQPA 4DV5M 5FK9C 3CIRB 4DR6M 2G8LA 4KGRA 2BTWB 4L4UA 1NSFA 3BBAA 1MU5A 1L0VB 1ZXHA 2ICIA 2BS2B 4C7ZA 1EWYC 4I81A 1KFVA 3U7ZA 1MPEA 3DWGC 3T3OA 4A5UA 4KHPM 5FTMA 1TGUA 2KZSA 5HG2A 4RCOA 3ILKA 2AQ2B 3HHWA 1PJIA 4YWGG 1BUIC 4L1BA 3IT6B 3K8ZA 1PVJA 2X38A 4ZTBA 3A42A 3SASA 2C99A 2BYTA 1YUBA 4KLNA 3A46A 4G6ZA 5E26A 1XF5L 3AEBB 5ITXA 1YJIA 2DWZB 3DA1A 3PO0A 1TY0A 5ITUA 3BVGA 1QT9A 3WCQA 2IDYA 2F5QA 2KMMA 3AH7A 1NHWC 1W5TA 2M60A 2Z7JA 3PRMA 3NVWA 5EZQA 4B3RM 2CU3A 1IXRC 3T15A 3FYDA 2FE8A 2CV1A 4HEA1 5BMHA 3NS1A 1KRHA 3KWLA 3KOWE 2J7NA 1C79A 1NJGA 3U6EA 4ITKA 3HJ8A 1UKFA 3R9XB 2I7NA 4NXNM 2BU3A 2WQYB 2DWMA 2VZKB 3U6LA 2WXMA 3HUIA 3U6PA 1J5EM 1IGDA 2YR0A 3L27A 1QZMA 1IBMM 3GQ3A 3WHLA 1RFKA 2X4AA 3KQ4A 2EUCA 2K0PA 1Z59A 1R2ZA 2IPKD 1IN4A 1NHGC 4LZJA 1NNJA 4AW4A 2YFQA 2QCUA 2H89B 1HQCA 3DOAA 4LJAA 2KRKA 4B0MA 2WXGA 3W0LB 3U2SC 1QAMA 3RNVA 1N34M 1FRDA 4D8IA 4YTPB 1SXJA 5ITYA 3K2LA 3ABVB 3BK2A 2AHMA 2J7QC 3W2DA 5EZSA 1AYFA 3AL0C 1SE2A 3BB7A 4OW0A 4IJEA 4JN6A 1ET6A 4EIWA 1FFVA 2HCBA 3AE9B 4RNAA 1Y56A 4BB9A 3J7AS 1IN7A 4M0WA 2Z3XA 1HEZE 3Q8EA 4I4LA 3KDSE 3ZCBB 2WXJA 2AGAA 2X8AA 1STEA 4OZBA 1CK1A 4CISA 4XDDA 4HKZE 4LZZA 2YNMD 1SEBD 4AKGA 4AKHA 1JWUD 1VZ6A 5C2TB 3RFZB 1QYRA 2BS4B 3HVZA 1R7SA 3P4PB 4IBCA 1MHHE 2IGHA 5D3IB 1P7EA 5G5GA 4B3TM 4B7GA 4JYAM 3SAWA 3BVZA 1XCQL 3E9SA 2KZUA 1AN8A 2F5SA 5EE3A 5BYSA 4TQ1A 3WHKA 1E10A 4GKKM 4OU7A 4RGMA 1ZAEA 2HTME 1JWAD 2KQ4X 3OWEB 2Y0QA 5FKAC 3AE8B 2RPVA 3EUB2 3NZ3A 3PHXA 4JI4M 3U6QA 1YJJA 3AMZA 3M7GA 4IBBA 2WXHA 2BW2A 5TSSA 4IBJA 2Y20A 4L23A 2F4VM 2M5ZA 5LMNM 4AQYM 3GP7A 4DV1M 2J53A 2JX5A 4Q2JA 2I2YA 2V6ZM 2CV0A 3P4RB 5EQTA 4O1NA 5DYGA 3BYYB 4G4RA 1HXYD 5GXGB 8CATA 4M9SA 2ZM6M 2MJDA 4XDCA 3AEAB 3AB5A 2Z4SA 5KO3A 2JZPA 3BVMA 4GLSC 1TS2A 5JI2E 2IGGA 1I4RA 2UUBM 1JRPA 5KQDA 2RDGA 3BWUD 3GS2A 3KS4A 2MEKA 1YQ3B 3ZC7B 5D3DA 1DGHA 3GLHA 3EIEA 3PVSA 2C96A 1L4DB 3MHVC 3SAUA 2WDVB 4LJ6A 1N62A 3AE7B 1J7AA 4X62M 3R8FA 2WU5B 3U6OA 3J27B 1N63A 2JA2A 3FILB 1MI0A 1XEEA 3VLFB 4WWMA 2YEPF 4LF7M 1C4AA 2WXIA 4TQ0A 3SHFA 5EE9A 1YN5A 1QKZA 4ZRPA 3VDUA 2NMQA 1PGXA 3VR8B 2R18A 3SYKA 3GLGB 2R46A 2DVWB 4KKJA 4RGOS 3EA6A 4ARIA 1HZ6A 4LJ7A 4B7FA 3FC4A 3W0FA 4NJCA 4QOZC 4YXDB 1SXJC 2DXIA 4PDGA 1J7KA 3J80S 2DZOB 2ON8A 3CTWB 1FFUA 3HKPA 2CHGA 3LYYA 1IXZA 1NVID 4A55A 2JYEA 3AE5B 5IWAM 2X49A 4FCWA 1I4PA 3C0RA 4FVMA 4XWTA 4JPSA 4XE0A 4D8EA 1J09A 4G4QA 1CJEA 2CJNA 1CQVA 2QEJC 2XF3A 1IN6A 2XSZA 2KACA 2XLJA 3KSXA 3TEYA 2P5TA 3BOSA 2VQEM 1TDZA 2WXFA 2CHVA 1RWSA 3B21A 1OFIA 4A9AA 2WDRB 4WAFA 1UGJA 2E5LM 1I4QA 1HNXM 2AX5A 4MT5A 5IT9S 4CHTB 4XGIA 4LF4M 3K92A 4FWDA 2XZUA 2O5RA 3U60B 4LK0M 2DYOA 3ETRA 2N7JA 1HT1E 4AS1A 1XHBA 2ZW0A 4DXFA 3MTVA 3TEXA 5EP2A 3HHZA 3VKGA 1TYGB 1N61A 5G5HA 2PVOD 1YMHE 2L7IA 3MFGA 4GIPA 2W82A 4DR7M 1NI3A 2LMCA 1FO4A 3NVYA 2L83A 2M56B 3IT4B 4TUWA 3CF6E 2H1RA 1K3WA 3GPYA 1JW9D 1XMOM 3VFDA 1T3QA 1JCKB 3U6DA 3ZJUA 4LLGM 1VDDA 3PNYA 1WSPA 4L2YA 1QQWA 4L8RC 1NNUC 3K1JA 1N32M 1SXJB 2V4IB 1NYQA 1GL6A 4M0DA 1QAOA 4DV3M 4B3MM 3HGIA 2E3TA 1DYQA 2J42A 3SR6A 3KSJA 2UUAM 3FUXA 3AN1A 4TMAB 3UMMA 4ITQA 3P63A 1TDHA 4JWUC 3I57A 4X64M 2QIEB 4LF6M 2L7HA 3FUUA 2J52A 4ZOHC 3AOEA 1YE9A 3U52E 4GUAA 2QBYB 4N59A 3I9V1 3KFUG 3LVWA 1E9RA 1IXSB 4HL4A 3EIHA 2W54A 3MHZA 3R8BA 1PFDA 4GRIA 3FTCA 1GKIA 3C8YA 2K22A 4KX6B 2D7EA 4II7A 4B3SM 4YTNB 2CV2A 2GI9A 3GRVA 2FBWB 1G3IA 4FXCA 2WP9B 3SBJA 1QOBA 1YN3A 4Z8XA 1JR3A 5ITQA 4GH9A 3TRKA 4LTUA 4TSSA 3THGA 1ZE3D 3AM9A 1PUTA 4BOUA 3GP1A 4I8OA 2N9LA 3SATA 1FCLA 4L78A 5DYIA 4RFBA 5FTJA 2DZNB 3NBIA 2QSDA 1JALA 3AEDB 1T6BX 4K0KM 1D5XC 3IXSA 4LFAM 2QJLA 1GLNA 3TEZA 1XWIA 3W5VB 4LCBA 1FMAD 3P4QB 2ZAOA 7CATA 5BYRA 2K3UA 1TY2A 2WDQB 4DV6M 4WQMA 2CUZA 3TPZA 3B9JA 4YHHM 2DLBA 3BK1A 3UGJA 5IREB 2BNKA 2PTLA 1XNRM 4CGYB 4MGYE 4QNRA 3W1SA 4LY6A 1KLGD 4D81A 3Q69A 3J9CA 1BMLC 1HQYE 2PW9A 1L4ZB 1C4PA 2JQRB 4DR4M 4ARCA 3I4VA 4FCTA 4IBGA 1MHXA 4GMQA 3T1YM 2JSVX 1JQJC 1NVMA 1FNUA 1TH3A 1JQ4A 3GQ5A 2EO2A 3GLFA 3LMMA 2R61A 5HHDG 1SE4A 2Z4RA 5EP4A 1A70A 3SFEB 1ACCA 2UXCM 4OZCA 5EP3A 3B2GA 4PCZA 2LUMA 3AJIB 3VRAB 1TS3A 1HNWM 4B08A 2PKOA 5C18A 4YY3M 4AQ7A 4M9XA 5AUKA 4DV2M 3AE6B 1DOXA 4LRSA 1XMQM 2UXBM 3P4SB 5BMIA 4YSZB 2ZAMA 3VK7A 1KYIA 4YTMB 4MH8A 3TWLA 2V3PA 3JAMS 4YSXB 1I4GA 2BJVA 1IM2A 1N5XA 4LFCM 4GHLA 5JXVA 3KWVA 2H88B 1C1KA 2WXQA 1WYGA 4LJ9A 3VRBB 1TKYA 4ZRQA 4B0EA 2L09A 4NL4H 2KN4A 3R2IA 1AWDA 2N0SB 3MP2A 4A6QA 2LH0A 2Y5PA 2LGIA 2WS3B 1TKGA 3NWLA 1PYWD 1F2RC 2AQ1B 4MGIE 2K5PA 1TS4A 1EE8A 1SE3A 1TJEA 2KXEA 1NJFA 4AZFA 2NQ8C 1Z5BA 1WRIA 4L15A 3VK8A 3LQQA 2L32A 2FFJA 2FUG1 3AEFB 4AKIA 3ZJTA 2AQ3B 5BPVA 2J7QA 2LEKA 5LNK1 2D5GA 1XC8A 5H37D 1XLNA 1ROEA 1XXHA 3GLHB 3U6SA 1OFFA 3DFZA 3PNVA 2WLBA 1QVRA 2NTSA 4GC5A 5JI3E 1PDXA 1OJLA 2JXTA 4ZHPA 4D8BA 3PRPA 3BZDB 1DGGA 4JI8M 4MI7A 5IZ7D 2C9OA 2QZ4A 1JWSD 3HJSA 4LGMA 4B7HA 3GQ4A 1TH4A 1VRAB 1DOIA 1KF6B 1N77A 1NEKB 1D4BA 3L4PA 2D7HA 2CE7A 1KSFX 4KGTA 4LF9M 3T3NA 4REZA 3UI3A 2SEBD 4A90A 2OPFA 1FD6A 1XNQM 4H2AA 4C7YA 1ZUD2 5C3JB 2WXRA 4NAMA 1L0YB 3QWLA 1Z5CA 4N6EB 3HVDA 3D8LA 1V97A 1FCCC 1KFYB 4DV4M 3KOZE 4MGHA 1IY0A 2G1EA 2ACZB 2BTEA 4X65M 3AV8A 1SJED 2DHRA 2LHDA 4X66M 3AFHA 1C76A 3E4RA 3TWMA 2J4XA 4RKXA 2WXOA 2EA0A 1AW7A 3FAHA 1M4VA 3NVVA 1OQQA 3MC0B 1ZDVA 3D8BA 1E94E 5BYQA 3KP1E 4ZHOA 4LG2A 2JWUA 4P16A 1G4AE 2LWXA 3M0EA 1FM0D 1VLBA 3KXEC 5FR3A 3FUTA 4I5SA 3Q8XA 4DR3M 5T8IA 5EXTA 1ZDXA 1EWCA 3J2PB 1JROA 3RE8A 2BJWA 2G5GX 1K53A 1L8QA 3JR4A 3NRZA 1XXHB 1ORYB 4BLCA 4LFBM 3UJNA 3GB1A 4J3OD 3GRRA 4DV7M 3A45A 3Q8BA 3U61B 1R6BX 5E6JA 1GPXA 4A8XC 3BY4A 2XFTA 2RMMA 1EM7A 2Z8LA 1QLBB 2R45A 2UZJA 1L2BA 4CQNA 4JWSC 1L6VA 1EU3A 1UM8A 2R4EA 4XBOA 1I94M 1TZOA 3L29A 3VQIA 3OTOM 1E7PB 5A2QS 3I51A 2BB6A 3SFZA 3B9PA 4QNMA 1QANA 3W9CB 4LJ5A 2DYMA 5HFYA 2CFOA 3MJ5A 1E6EB 2RKOA 5JZEA 2OEDA 3IG5A 1SSNA 3ZNHA 1DKIA 1GAQB 3UZUA 2CEAA 1S3SA 2Y3AA 3HU2A 3J7BA 1OQRA 1L0XB 2FOIC 2TSSA 3URYA 3ZGZA 2QMTA 1V8CA 2XZFA 2RDHA 4R3DA 2KA6B 4P6VF 2V0GA 1N60A 2R65A 3H4MA 4JI6M 1EU4A 4MH0E 1L5PA 1IN5A 1PM5A 3TQSA 5MPOA 1FNNA 4JI0M 1SIJA 3HU1A 5BR8M 1D6EC 2CHQA 3GO8A 1BXTA 1SXJD 2L1AA 3SAVA 1DGFA 1W5SA 5H92C 1H6UA 1IBXB 3GPUA 2VIIA 2B76B 1VZ8A 1JWBD 1T5XD 1V1OA 5EJCA 4GKJM 5LMUM 2HWKA 1IN8A 1JWMD 2WXPA 3AOGA 1I4HA 1IY1A 2KW0A 3TSSA 1L1TA 3AKZA 2DBYA 2W55A 1JR3D 1IGCA 2PLPA 4ZPXA 3GPXA 4Z6YA 1SBBB 3LB8C 2KEBA 1L1ZA 1IBLM 3O65A 5AUIA 4PDIA 2HHHM 2SAKA 1XCTL 5ITRA 3U61A 2V1CA 4IBFA 3FD9A 1SXTA 4RGTA 1K3XA 1DGBA 4G4OA 1ESFA 4ZYSA 4HXDB 1ENFA 4DQOC 1UWXA 4LRTA 3KP0E 4DUZM 2GB1A 1TH2A 3PHWA 1HZ5A 1TKEA 1LO5D 3GLIB 4DR1M 4MB7A 4RF0A 2I38A 3SMPA 2JRIA 1YN4A 3LQRA 4JI3M 3IAS1 1F2RI 1QOAA 1E9MA 4GDKB 3Q8AA 1FRRA 3SC3A 3B2FA 2DWNA 4US9A 1Q3BA 3C58A 1N78A 1KTKA 1LV7A 2I7PA 5BMGA 1ZXIA 4QHTA 5DNYA 4DV0M 4HLQA 3PZ8A 1UWMA 1ZOYB 5F3WA 2JYTA 3KVWA 2MJ3A 4NSRA 4DXGA 4FCVA 1L2CA 1YSYA 4WURA 1ZQ9A 2DWLA 1L6UA 2UUCM 3U6MA 1C4CA 3PZ7A 5EE0A 3ZQ4A 1Q3CA 2F5OA 3PFIA 4JI5M 2JU6X 1K52A 1SB3C 4JI1M 2N9KA 4DR2M 1VJKA 4MGZE 1GB4A 4BOSA 2JTCA 2UXDM 1SJHD 4N58A 3UK6A 2EELA 4YSYB 1XLQA 2Q2EB 1G8PA 1J7BA 2V3NA 2BS3B 3H8HA 1R7RA 2PIAA 4NSOB 5ITXE 2GRIA 2QPAA 4MACA 5FTKA 1V1PB 2WXNA 1K50A 4XWWA 4MGKE 2XGNA 2G9HD 1MX0A 4RF1A 3SHGB 3T1HM 3AEGB 4BOZA 3FTFA 4JI7M 4WW0A 1R2YA 1YQ4B 2CJOA 5I4DA 1N33M 2OHFA 4OHJA 4W5WA 5EP1A 1DGJA 4HRSA 3VR9B 2Y5CA 2ZANA 4IIWA 5FTNA 4OVZA 4GDLB 3LXFA 3L2AA 3T38A 1NYRA 3V3XA 4M9ZA 2Q5WD 2V1UA 1E0ZA 5KPRA 1QOFA 1IUEA 1SXJE 3GLIA 3AEEB 3W5UB 2UU9M 1WWTA 1QOGA 5KQ8A 1RM6C 1ET9A 1I4XA 2LXEA 3ZYYX 4LF8M 4FW9A 4DR5M 5C1BA 4G4NA 1FJGM 3FKEA 4A3VB 1OFHA 2K9XA 2VQFM 4JX1C 3BIID 2BB5A 2YQZA 4PD2A 4LF5M 2KAJA 2M19A 2PVGC 2Z84A 3L25A 2WXLA 1QILA 4IP3A 2HKJA 3PHUA 4FD2A 1N36M 2RGHA 1KH0A 1ZP0B 5EE1A 1PJJA 2BTWA 4YT0B 5FLXS 1XLPA 2A5YB 1D5MC 4JXJA 3N9YC 1G41A 5H8YE 3IAM1 1K51A 2WNMA 4AG5A 2IJ0A 2Y21A 4IKGA 1B9RA 3AE2B 1FXIA 4D80A 2K47A 2ERCA 3ZJVA 3I4YA 4XZXA 3RGSA 2LJIA 5D7GA 3KLSX 2LNHC 3P42A 3W30A 4DUYM 3CF2A 3KW6A 3PSEA 1V1PA 4NAWB 2QP9X 4EE2A 4US8A 1YZBA 3TUOA 4KGSA 3DWMA 1HNZM 1E32A 3VDPA 4HROA 1FNVA 3U6CA 3U5ZA 3MP9A 3JR5A 1P7FA 3DZDA 1ZPSA 1Z5AA 2XEPA 1D5ZC 1MVKA 3AOEC 3IG8A 3W31A 4JI2M 1XLOA 2YEPB 2LHEA 3KOXE 3L28A 3CF0A 1YNTE 4OVZB 3PT2A 3AE4B 2R62A 2C5RA 1F0ZA 3TWKA 1X37A 1JMLA 3AE1B 1IBXA 3PXGA 2L6OA 4BOPA 3J81S 2D7GA 3V05A 1C9FA 2XFSA 3U4EG 4C56C 4NRWA 2IGDA 1IBKM 2QILA 3SARA 4D2KA 4IBKA 5GKNA 1HA5A 1E9SA 3RPFC 1FNWA 3O13A 1KLUD 2DOSA 3GPPA 5EXSA 2WXKA 3L26A 2KRUA 4LJ4A 3HWSA 1DOYA 1XO3A 2KDMA 2C9CA 2E6XA 3MK6A 2L52A 3Q8FA 1NY5A 2PMVA 3FTDA 2XN9C 3OQCA 2HL7A 4KKIA 1WGKA 2EKIA 3NUHB 3HRDD 2ONQA 1DO2A 1T3TA 3SEBA 4USAA 5FTLA 1C77A 3GRYA 4IBDA 2OQ4A 4AI6A 1QAQA 2VZKD 4NOOB 1Q39A 4LJ8A 2HDEA 1SF0A 4KODA 3P1MA 4IOIE 2W3RA 4NXMM 4MM3B 2WU2B 1G59A 4IUMA 2F5NA 2INPE 3AE3B 1FEHA 1IY2A 1PGBA 3FUVA 3QAUA 5ITTA 4C80A 2MH7A 1DO0A 5KPTA 1D2NA 3FTEA 1I7HA 1C78A 3TE6A 5KPZA 2RGOA 2QBYA 3U5ZB 2NTTA 2KWDA 3HU3A 2QENA 4QOSA 2Y0TA 2ZW1A 1PGAA 3EGRA 1QF6A 3GLGA 1Z6TA 2J7OA 4OZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVZ B;  4OW0 A;  4REZ A;  5KO3 A;  4PT5 A;  4MM3 B;  4P16 A;  3MJ5 A;  3MP2 A;  4RF1 A;  5E6J A;  4WUR A;  3E9S A;  4M0W A;  4OVZ A;  4RNA A;  2FE8 A;  4RF0 A;  4R3D A; 
#chains in the Genus database with same CATH topology
 2KDB A;  2MJE A;  2FNA A;  2FS1 A;  1K8R B;  3HM3 A;  4BBA A;  3UF8 A;  1F29 A;  3B79 A;  3ERV A;  3AEC B;  2HAK A;  1F52 A;  2KK8 A;  1HQR D;  4W9F A;  3Q8C A;  3C9P A;  3O65 B;  4PYZ A;  3A98 B;  4WIP A;  2XSZ D;  4CJ6 A;  4S12 A;  3SFD B;  1DEU A;  3HJQ A;  4GIT A;  4IDI A;  2V9H A;  1PPN A;  2WSF F;  3V60 A;  1GB1 A;  5KHO A;  3FUW A;  5FSW A;  3MTN A;  3VXW A;  3TMP A;  2ZTC A;  4JL9 A;  3APF A;  2K0B X;  2QC8 A;  3BYT B;  2ZBK B;  4OVU A;  3RGP A;  2HXZ A;  1WXA A;  3WAL A;  4LGY A;  4QHS A;  4D82 A;  1FXA A;  1PPO A;  2Y5B A;  1UUP A;  1YAL A;  4IJF A;  3QYB A;  3VKH A;  3FYC A;  3TL4 X;  4JLC A;  4FWG A;  2NR2 A;  4OX9 M;  1B1Z A;  3ZH9 B;  7PCK A;  3IFU A;  1GL7 A;  2AU1 A;  4FJY A;  4L16 A;  3H8B A;  3QQ8 B;  4RGN A;  2XH9 A;  1GVN A;  4R7G A;  1K82 A;  3H7P B;  1J8C A;  1I4W A;  4E74 A;  3GRU A;  3Q2A C;  4KO8 A;  2NPT B;  5IAA C;  1CZP A;  4GC9 A;  3CWI A;  4DDG D;  4PAD A;  2C98 A;  2JRI B;  2W3S A;  2INN E;  1WXQ A;  3HHX A;  2WX0 A;  3K9P B;  3WA0 A;  5EXX A;  4GDL A;  2G8E A;  1DGH B;  1OTR A;  2DWQ A;  1OAO C;  3A1Q B;  3TEW A;  1HT2 E;  3OJ3 A;  3R2T A;  5HKH A;  3UIP B;  1J7C A;  2KDL A;  1QQR A;  3KS8 A;  1VR9 A;  1NEN B;  5EXP A;  1Q10 A;  2F5P A;  1TS5 A;  2LJ5 A;  4AG6 A;  3U7D A;  4AOF A;  3P5V A;  3U60 A;  3RFW A;  1ME4 A;  3E56 A;  3NVZ A;  4RH6 A;  1XXG A;  3BY4 B;  3FIL A;  4JE3 B;  3N4C A;  1HE8 A;  2LFI A;  3HHY A;  3SYL A;  3B89 A;  4AWJ A;  2M0A A;  4NZL B;  4KIK B;  1VDV A;  4LCD E;  2HH5 A;  4JV5 M;  2R4J A;  1N5W A;  3LVV A;  2EMS A;  3KOY E;  1N75 A;  2BT6 A;  2WX1 A;  4HKQ A;  2DAF A;  1WF9 A;  4FWH A;  1RYJ A;  2DYB A;  2F1G A;  4BSQ A;  4FA6 A;  3N1Z C;  3GLF B;  1WGR A;  2K8B A;  4PT5 A;  1U9X A;  2XNA C;  4IBE A;  3H1U A;  2RSU A;  5EGW A;  4IBI A;  1NY6 A;  4GGQ A;  3SMS A;  1L2D A;  2JZ3 B;  2KWC A;  1VZ7 A;  1VCB A;  1FIQ A;  5IO9 A;  2R44 A;  2BQQ A;  1WGN A;  1UNS A;  2J0K A;  4ACF A;  5HI1 A;  3LCV B;  2BBC A;  4IM2 A;  2RRU A;  1GOZ A;  3IBE A;  4WH4 A;  4P1C C;  4BOQ A;  4NRV A;  1HR0 M;  4GHA A;  4HJG E;  3M6A A;  1F77 A;  4KSL C;  5DPW A;  2E03 A;  2R2Q A;  2KO3 A;  4KDL B;  5EF4 A;  3AV0 A;  3VTU A;  1WJN A;  2KTF A;  3GLH E;  4UDU C;  1OIP A;  1IQP A;  4DV5 M;  5FK9 C;  3QC8 B;  3OLM D;  3KH0 A;  3I3T A;  2KHH A;  3B7N A;  3CIR B;  4DR6 M;  2G8L A;  4KGR A;  2A4Z A;  2BTW B;  1UEL A;  3Q6B A;  3CH2 X;  4L4U A;  1NSF A;  3BBA A;  1H8C A;  1MU5 A;  2DAI A;  2JP7 A;  2MBE A;  3H9D A;  1L0V B;  1ZXH A;  2ICI A;  4W9H A;  2CRU A;  2BS2 B;  2M4N A;  4C7Z A;  2RPQ A;  2KFK B;  1EWY C;  4G3O A;  4I81 A;  1KFV A;  2FCN A;  5G2N A;  3U7Z A;  2KQ7 A;  1MPE A;  4ICU A;  3DWG C;  3T3O A;  3DBL B;  4A5U A;  3FRH A;  4KHP M;  5FTM A;  1TGU A;  5E6P A;  3KWZ A;  2KZS A;  5HG2 A;  4DDI D;  3GZN I;  4RCO A;  3ILK A;  2AQ2 B;  3HHW A;  4K3C A;  3A9J A;  1PJI A;  3QSD A;  4F8C B;  1RRB A;  4YWG G;  1BUI C;  2DZL A;  4L1B A;  5IOI A;  3IT6 B;  3K8Z A;  4CHK A;  1PVJ A;  4BQV A;  2X38 A;  2O6V A;  2RDB C;  4ZTB A;  3A42 A;  2BF8 B;  3SAS A;  3EHV A;  4G54 A;  2C99 A;  2BYT A;  2E01 A;  4WJQ A;  1YUB A;  4KLN A;  1RAX A;  4FHJ A;  3A46 A;  1PPP A;  4G6Z A;  1QDR A;  3PW3 A;  1XXH E;  3NHE A;  3A9K B;  4WQO B;  1MG8 A;  5E26 A;  2INC C;  1AAR A;  1XF5 L;  2G4S A;  3AEB B;  5ITX A;  1SP4 B;  2MBH A;  1YJI A;  2DWZ B;  3DA1 A;  1TY0 A;  3PO0 A;  5ITU A;  3BVG A;  1QT9 A;  3RNC C;  3WCQ A;  2IDY A;  2FNJ B;  2F5Q A;  3GLF E;  5IP4 D;  2KMM A;  2DZM A;  3AH7 A;  1NHW C;  1W5T A;  2RGF A;  4WJO A;  2M60 A;  2Z7J A;  3QA8 A;  3HY5 A;  1V92 A;  1VQ1 A;  2KNA A;  1V2Y A;  3PRM A;  3GLI E;  2KTR A;  3NVW A;  5EZQ A;  4B3R M;  2CU3 A;  1IXR C;  2GQF A;  4E71 A;  3T15 A;  2FE8 A;  3FYD A;  2CV1 A;  4HEA 1;  5BMH A;  3NS1 A;  1KRH A;  3KWL A;  3KOW E;  2J7N A;  5A24 A;  1C79 A;  1NJG A;  3U6E A;  2HTH A;  4ITK A;  3H6S A;  3HJ8 A;  1UKF A;  4KT0 F;  2JPH A;  1WZ0 A;  3R9X B;  2I7N A;  3FKY A;  3M3J A;  4NXN M;  2BU3 A;  4S0R A;  5JA7 A;  3KSE A;  1P3Q U;  2WQY B;  2DWM A;  2VZK B;  3U6L A;  1CSB B;  2WXM A;  1TTN A;  2M8S A;  2KDE B;  3HUI A;  2BYE A;  2QDF A;  1UD7 A;  1MN3 A;  4DBG A;  2REX A;  3U6P A;  1J5E M;  1IGD A;  3V61 A;  4YYR A;  2YR0 A;  1V81 A;  3L27 A;  3W67 A;  1QZM A;  1IBM M;  3GQ3 A;  3WHL A;  1RFK A;  2CHW A;  3V6E A;  2X4A A;  1QUS A;  3KQ4 A;  2EUC A;  4A20 A;  3ZKJ C;  2K0P A;  1Z59 A;  1UBI A;  3BPM A;  1R2Z A;  2IPK D;  1IN4 A;  2OJR A;  1NHG C;  2YVC A;  3APC A;  4LZJ A;  2KJ6 A;  4J6I A;  4X6I A;  1NNJ A;  3PS6 A;  4AW4 A;  2MBO A;  2YFQ A;  2QCU A;  2H89 B;  1HQC A;  3HIZ A;  3DOA A;  3OF9 A;  4LJA A;  1BY8 A;  2KRK A;  3QHT A;  4B0M A;  4W5C A;  3WXE A;  1YOV B;  4EFO A;  2WXG A;  3W0L B;  4JGH B;  2NBU A;  3U2S C;  3W1S C;  1QAM A;  3RNV A;  2ATO A;  1N34 M;  3WAP A;  4HDO A;  1TT5 B;  1U9W A;  1RFA A;  1MG4 A;  1FRD A;  4D8I A;  4YTP B;  1SXJ A;  3L16 A;  5ITY A;  3K2L A;  3IVF A;  3ABV B;  2JF5 A;  3BK2 A;  3DVN V;  1KOT A;  2AHM A;  2VF8 A;  2J7Q C;  5E6O A;  2DJG B;  1SIF A;  2ZCB A;  3W2D A;  2AEH A;  1KXR A;  5EZS A;  3N20 C;  1AYF A;  3AL0 C;  1SE2 A;  1EFU B;  3VAW A;  4GU2 A;  3BB7 A;  4OW0 A;  4ICV A;  3I01 M;  1CVZ A;  4IJE A;  2O6V D;  4JN6 A;  1ET6 A;  4EIW A;  1FFV A;  4AUQ C;  2FRA A;  2A5U A;  4KDI C;  4PP2 E;  2HCB A;  2V4L A;  2OP3 A;  3AE9 B;  4RNA A;  4ZYN A;  4WA6 A;  4DK5 A;  1TF0 B;  3ZNG C;  1Y56 A;  4W9L A;  3WXF A;  3A4R A;  4BB9 A;  3J7A S;  4CDF B;  1IN7 A;  2K8C A;  4M0W A;  2Z3X A;  1HEZ E;  2WDT B;  3Q8E A;  2AYO A;  3I63 C;  2K8H A;  2O2V A;  2K6B A;  5JH5 C;  4I4L A;  2DZY A;  1VJV A;  3OVX A;  3KDS E;  2HD5 B;  2MBB B;  3ZCB B;  1I35 A;  3F5V A;  4R71 A;  2WXJ A;  3ZUN A;  2YJ9 A;  1T0R C;  2AGA A;  2ARY A;  2X8A A;  1STE A;  4OZB A;  1CK1 A;  4CIS A;  4XDD A;  4HKZ E;  4LZZ A;  1WX8 A;  2YNM D;  3ZQJ A;  1GLO A;  1AUA A;  1YQB A;  1SEB D;  4AKG A;  4AKH A;  2DZZ A;  3KX1 A;  1YLA A;  1JWU D;  1VZ6 A;  3T6P A;  5C2T B;  3SHQ A;  3RFZ B;  1QYR A;  2JUO A;  1VEK A;  2BS4 B;  3NHE B;  3HVZ A;  3A9K A;  4ASW C;  1R7S A;  1UBQ A;  2FTD A;  2KXJ A;  5DCN A;  3P4P B;  4IBC A;  1MHH E;  3QAQ A;  3X0W A;  4HPM B;  2IGH A;  3DVG X;  3DBL I;  5D3I B;  4QRG A;  3DQV A;  1P7E A;  2PE6 B;  5G5G A;  4B3T M;  4B7G A;  4JYA M;  3SAW A;  3DBR B;  3BVZ A;  5EDS A;  2IZV B;  4WP2 A;  1XCQ L;  3E9S A;  5IN7 A;  5D94 A;  4HVB A;  1ZKH A;  2KZU A;  1AN8 A;  2F5S A;  4GSW A;  5EE3 A;  5BYS A;  2KTR B;  4TQ1 A;  3WHK A;  2C0Y A;  1E10 A;  4GKK M;  2L0F A;  4OU7 A;  4RGM A;  1ZAE A;  2GBJ A;  2HTM E;  5CHW A;  1JWA D;  2KQ4 X;  5FR6 A;  3OWE B;  5AZG A;  2Y0Q A;  2CIO A;  3OAW A;  2MH8 A;  3PLV A;  4Q8H A;  5FKA C;  1H4R A;  3AE8 B;  2RPV A;  3V76 A;  1MFW A;  4XK8 F;  2IO0 B;  3EUB 2;  3NZ3 A;  3PHX A;  4JI4 M;  3U6Q A;  3NS8 A;  2ZEQ A;  2PE9 A;  1YJJ A;  3WIM A;  3AMZ A;  1IWD A;  3F75 A;  3M7G A;  1SGH A;  3WAN A;  4IBB A;  2WXH A;  2BW2 A;  1GO5 A;  2KFJ A;  2KAN A;  2D3A A;  5TSS A;  3FE3 A;  1TIF A;  2BPS A;  2FH0 A;  4IBJ A;  2Y20 A;  1OEY A;  4BBN C;  4L23 A;  2F4V M;  2M5Z A;  1YIW A;  4W9E A;  2ZTD A;  5LMN M;  1D0M A;  2NS5 A;  4M8M A;  1BVS A;  3PTF C;  1PAD A;  4AQY M;  2L8J A;  3GP7 A;  4DV1 M;  3DDC B;  2J53 A;  5G55 A;  4LDT D;  1T0S C;  2JX5 A;  4Q2J A;  2DEN B;  2I2Y A;  3RNG C;  4I6L B;  2V6Z M;  2CV0 A;  3P4R B;  5EQT A;  2LHG A;  5DYG A;  4GN1 A;  4O1N A;  3R7R A;  3BYY B;  3TL5 A;  1ZIV A;  2BDL A;  2CB5 A;  4G4R A;  2CKH B;  4LNK A;  1HXY D;  5GXG B;  4GIV A;  8CAT A;  4M9S A;  2ZM6 M;  2MJD A;  1WGH A;  3Q3N C;  4XDC A;  3AB5 A;  3AEA B;  2Z4S A;  2DC7 A;  5KO3 A;  2JZP A;  3BVM A;  4GLS C;  1KHP A;  1TS2 A;  5JI2 E;  2IGG A;  1I4R A;  2UUB M;  1JRP A;  5KQD A;  2RDG A;  3BWU D;  3GS2 A;  2J0J A;  1X1M A;  3KS4 A;  2MEK A;  1YQ3 B;  2JZ0 A;  3OJ4 B;  3ZC7 B;  1ITO A;  1PJS A;  5D3D A;  3RZF A;  2FT2 A;  1DGH A;  3F92 A;  3SDL C;  1AYV A;  4JIO U;  3GLH A;  3EIE A;  4KZC A;  3PVS A;  2IY1 B;  2C96 A;  3RD2 A;  1L4D B;  2GBR A;  3MHV C;  1R4N B;  3SAU A;  2FCM A;  2AIM A;  2HE7 A;  2KLG A;  2WDV B;  4LJ6 A;  1N62 A;  3AE7 B;  1EO6 A;  4XGA B;  1J7A A;  5IA7 A;  1SNK A;  4X62 M;  3R8F A;  2R0I A;  2WU5 B;  1NBF C;  3U6O A;  1GNU A;  2ZVN A;  3J27 B;  1N63 A;  2JA2 A;  3FIL B;  2KX3 A;  3NOB A;  1MI0 A;  1OIZ A;  4GEW A;  4FUL A;  1E8Y A;  4ZUX U;  1XEE A;  3IUT A;  2R9N A;  3VLF B;  3TBL D;  4WWM A;  2FYE A;  2JY6 A;  2YEP F;  4LF7 M;  1C4A A;  2MLB A;  2WXI A;  4FJV B;  3SHF A;  4TQ0 A;  5EE9 A;  1YN5 A;  1ATK A;  1QKZ A;  4ZRP A;  3VDU A;  3L54 A;  3S3Q A;  2NMQ A;  1PGX A;  4I04 A;  3VR8 B;  2R18 A;  3SYK A;  3GLG B;  2R46 A;  2DVW B;  4KKJ A;  4RGO S;  3PGE A;  4FIP A;  2M1M A;  3H8C A;  3EA6 A;  4ARI A;  1HZ6 A;  1LFD A;  4LJ7 A;  3CST A;  4B7F A;  2WGS A;  3FC4 A;  3W0F A;  4MSQ B;  4NJC A;  3R66 C;  3I5J C;  4QOZ C;  4WJN A;  4YXD B;  1SXJ C;  2DXI A;  4PDG A;  1J7K A;  3J80 S;  2DZO B;  2ON8 A;  4KV2 A;  3CTW B;  2GBN A;  1FFU A;  3I3T B;  1GAB A;  3HKP A;  4S17 A;  3LFY A;  2CHG A;  3LYY A;  3QYE A;  3DVG Y;  1IXZ A;  2ACT A;  5K16 A;  1NVI D;  1V34 A;  4A55 A;  2FID A;  1P0R A;  2JYE A;  2L00 B;  3AE5 B;  5IWA M;  3BPF A;  2X49 A;  3CBJ A;  4FCW A;  1WIA A;  1I4P A;  3C0R A;  4FVM A;  3U30 A;  4XWT A;  4LNO A;  5J18 A;  4JPS A;  4XE0 A;  4D8E A;  1J09 A;  2Z0E B;  4G4Q A;  1LGR A;  4L6V 6;  1CJE A;  2CJN A;  2FIF A;  1CQV A;  2QEJ C;  1Q02 A;  2XF3 A;  1ISN A;  3JW0 X;  1IN6 A;  2XSZ A;  3H7P A;  2KAC A;  2XLJ A;  3A9J B;  3KSX A;  4WWN A;  4FK5 A;  4TUU A;  2NPT A;  2C7H A;  3TEY A;  3WAO A;  3A4S C;  2P5T A;  2IO3 B;  3BOS A;  2VQE M;  2NVU I;  3GE8 C;  2O25 A;  1TDZ A;  2WXF A;  2CHV A;  1RWS A;  3B21 A;  1VD2 A;  1OFI A;  4IG7 B;  4A9A A;  2WDR B;  4WAF A;  1UGJ A;  2L4E A;  2E5L M;  3RMK C;  1I4Q A;  1HNX M;  2AX5 A;  2MSE D;  2WBF X;  4MT5 A;  3RN9 C;  5IT9 S;  4CHT B;  3QCA A;  4XGI A;  4LF4 M;  3K92 A;  4FWD A;  2XZU A;  2O5R A;  3U60 B;  3PRP B;  4LK0 M;  2DYO A;  3ETR A;  3HM6 X;  4EOY A;  3PHW B;  3KW5 B;  2N7J A;  1DV0 A;  1HT1 E;  1EF1 A;  4AS1 A;  1YK7 A;  1XHB A;  2BDZ A;  1PQS A;  1QXP A;  2ZW0 A;  4DXF A;  4BVU C;  4Q7J A;  2LGS A;  3R3M A;  3TEX A;  1GEC E;  3MTV A;  5EP2 A;  1V49 A;  3HHZ A;  3VKG A;  1VSN A;  1TYG B;  1N61 A;  1RLF A;  5G5H A;  3WAM A;  2PVO D;  3HHM A;  2IND C;  1YMH E;  1V5O A;  2B3A A;  2NBW B;  2L7I A;  3MFG A;  4BS6 A;  4GIP A;  2LHC A;  2W82 A;  2JZ1 A;  4DR7 M;  4I05 A;  1NI3 A;  2BWF A;  2UWQ A;  3Q3F A;  4N8W A;  2LMC A;  4HJK A;  1FO4 A;  3NVY A;  3L08 A;  2DCA A;  3DHH C;  2L0T A;  2L83 A;  4HCN B;  2FO5 A;  2LRU A;  3DF0 A;  4PYU A;  2M56 B;  2I1J A;  2I1K A;  2AS8 A;  4XR7 A;  3IT4 B;  1XB2 B;  4DMX A;  1EWP A;  2WYQ A;  4TUW A;  3CF6 E;  4FJC A;  4ZRK A;  3VTV A;  2H1R A;  4P1B C;  4XC2 A;  4KZ0 A;  1K3W A;  5LXI B;  3GPY A;  1JW9 D;  4W9G A;  1XMO M;  3VFD A;  3N1Y C;  1T3Q A;  1JCK B;  2NQG A;  3U6D A;  2MBQ A;  2JWZ A;  2L05 A;  4LJP B;  1A6R A;  3ZJU A;  4LLG M;  4RY2 A;  1WXV A;  1VDD A;  3PNY A;  2KNV A;  1F9J A;  3M63 B;  1EWM A;  4P7I A;  1WSP A;  3BXW A;  4NPN A;  2DC8 A;  4L2Y A;  1QQW A;  4L8R C;  2KVR A;  1NNU C;  3K1J A;  1N32 M;  4FJZ A;  1SXJ B;  2V4I B;  1NYQ A;  1GL6 A;  4M0D A;  1QAO A;  4DV3 M;  3CSF A;  3NJT A;  4QBB A;  3OF8 A;  4B3M M;  3LDZ E;  3RI7 C;  3HGI A;  4G50 A;  4W9J A;  4LNI A;  5J2R A;  2LAS A;  2E3T A;  2JT4 B;  1DYQ A;  1AIM A;  1LXD A;  2J42 A;  3KSJ A;  3SR6 A;  2MP2 A;  1AEC A;  2UUA M;  3FUX A;  1WX7 A;  3AN1 A;  4TMA B;  3UMM A;  3CH3 X;  2N7E A;  3K24 A;  2QHO B;  4ITQ A;  2DX5 B;  3P63 A;  1TDH A;  1J0G A;  4JWU C;  1V33 A;  4ANR A;  3RYT A;  1Q6K A;  3I57 A;  4X64 M;  2QIE B;  1WGL A;  4LF6 M;  2C60 A;  1VG5 A;  4KSK C;  4MEM A;  2OOA A;  2L7H A;  3FUU A;  4NY0 A;  2J52 A;  3FRI A;  4ZOH C;  3AOE A;  3ZIM A;  1YE9 A;  2KWU B;  4FHK A;  3U52 E;  2KYW A;  4G0N B;  3I06 A;  4GUA A;  5IKC M;  2QBY B;  2XU1 A;  4N59 A;  3I9V 1;  3KFU G;  3LVW A;  1E9R A;  1IXS B;  2JNH A;  4HL4 A;  2O2V B;  5J17 A;  1WJ4 A;  4E3C A;  3EIH A;  2W54 A;  4LNF A;  1F2C A;  4PS7 A;  1STF E;  4DHJ D;  2N9E B;  1WE6 A;  1IFY A;  3MHZ A;  3R8B A;  1PFD A;  3AUL A;  4GRI A;  3FTC A;  4QRV A;  1GKI A;  3C8Y A;  2K22 A;  4KX6 B;  2D7E A;  1CB5 A;  4N79 A;  4II7 A;  4B3S M;  4YTN B;  1WIV A;  3Q8G A;  1FPY A;  2CV2 A;  2GI9 A;  3GRV A;  2FBW B;  3LJ3 A;  1G3I A;  4W9D A;  4BFR A;  5E6N A;  4IW0 A;  4FXC A;  2WP9 B;  4BOS C;  3SBJ A;  1QOB A;  3DHI C;  1YN3 A;  4Z8X A;  4K7W A;  1JR3 A;  1WXS A;  5ITQ A;  4YYW A;  4GH9 A;  3ZDT A;  3TRK A;  4LTU A;  4TSS A;  3THG A;  1YT7 A;  3RVW A;  1ZE3 D;  3UQB A;  3AM9 A;  2LXA A;  3KW9 A;  1PUT A;  4BOU A;  3MTN B;  3VFK A;  3GP1 A;  2NCN A;  4I8O A;  2N9L A;  3NG0 A;  3IMA A;  3SAT A;  5AZF A;  1FCL A;  4L78 A;  5DYI A;  2H7J A;  3UIO B;  2CHX A;  4W9K A;  4RFB A;  5FTJ A;  2DZN B;  3NBI A;  1GC6 A;  2QSD A;  1V5T A;  1JAL A;  3AED B;  3JSV A;  1T6B X;  4K0K M;  5J94 A;  1D5X C;  3IXS A;  2KNZ A;  2DAM A;  1GMY A;  3IG3 A;  4LFA M;  2QJL A;  3KWB X;  4EEW A;  1GLN A;  4P6G A;  3RNA C;  3RNB C;  4ANU A;  3TEZ A;  1XWI A;  3W5V B;  4LCB A;  1FMA D;  1MDW A;  3HX3 A;  3PRE A;  3P4Q B;  5BO4 B;  2AUX A;  4Y28 F;  2ZAO A;  7CAT A;  2GBK A;  5BYR A;  2K3U A;  5L8R F;  5DFL A;  2K39 A;  3R7Q A;  1TY2 A;  2WDQ B;  4DV6 M;  2D07 B;  4WQM A;  4F2L A;  2CUZ A;  3TPZ A;  3B9J A;  4YHH M;  2OO9 A;  4K7U A;  1TLO A;  2DLB A;  1E7V A;  3EC8 A;  3VTW A;  1WJ7 A;  3BK1 A;  3UGJ A;  5IRE B;  3LXS A;  2BNK A;  2PTL A;  3B0A A;  1XNR M;  2APL A;  4MSM B;  3DBH B;  2YLM A;  4CGY B;  3C9E A;  4MGY E;  2AUZ A;  3IV2 A;  4QNR A;  3W1S A;  2FUD A;  3Q14 C;  4LY6 A;  1KLG D;  4D81 A;  5JZE B;  1PIP A;  3Q69 A;  2G45 B;  3J9C A;  3ONS A;  3NZU A;  2LZ6 A;  1BML C;  2G7Y A;  2K6Q A;  3RUI B;  3IHP A;  2HJ8 A;  1O0E A;  1HQY E;  4KLB A;  2PW9 A;  1L4Z B;  1C4P A;  2JQR B;  4DR4 M;  5CVO B;  3RNF C;  4ARC A;  1CUK A;  3I4V A;  2JXN A;  4FCT A;  4IBG A;  1MHX A;  2KJH B;  4GMQ A;  3T1Y M;  2JSV X;  1JQJ C;  3L17 A;  4C4V B;  1UZX B;  3BOW A;  1NVM A;  1FNU A;  2BKR B;  1TH3 A;  4HDQ A;  2LGX A;  1AIP C;  1JQ4 A;  3GQ5 A;  2EO2 A;  3GLF A;  3LMM A;  3C19 A;  2R61 A;  5D2M B;  5HHD G;  2C7N B;  1F2A A;  1SE4 A;  2Z4R A;  2PBH A;  5EP4 A;  3OG5 A;  1OEY J;  1A70 A;  3SFE B;  1ACC A;  1UGM A;  2KOX A;  4HEO A;  1Z2M A;  2UXC M;  4OZC A;  5EP3 A;  3B2G A;  4NNJ B;  4PCZ A;  1WJU A;  1YVB A;  2LUM A;  3AJI B;  2AL3 A;  4ZRI A;  3KUD B;  3VRA B;  1TS3 A;  1HNW M;  4IC7 B;  3DPD A;  3KUZ A;  3QX1 A;  4NAW A;  4B08 A;  2PKO A;  5C18 A;  4YY3 M;  2PEA A;  1JQP A;  4AQ7 A;  4M9X A;  2JZZ A;  5AUK A;  3T9L A;  4DV2 M;  3CMM B;  3AE6 B;  1DOX A;  1GJT A;  4LRS A;  2KD0 A;  4IM3 A;  2MQJ A;  1NB3 A;  4M00 A;  2YJC A;  1XMQ M;  2UXB M;  3NBX X;  1TL9 A;  1Y8G A;  3P4S B;  2N4F A;  2EJS A;  1E8Z A;  2FAZ A;  5BMI A;  4YSZ B;  3ML9 A;  3GZN B;  2ZAM A;  3VK7 A;  1KLV A;  1KYI A;  4YTM B;  2H5X A;  2PNS A;  3E1Z B;  3QIJ A;  3N3K B;  1RU3 A;  4MH8 A;  1WMH A;  4A3O A;  1VEG A;  3TWL A;  2V3P A;  3KYC D;  3JAM S;  4YSX B;  1I4G A;  4DHZ B;  4K7C A;  5CVM A;  2BJV A;  1IM2 A;  1N5X A;  1PCI A;  3PDF A;  1OKS A;  1NV9 A;  4LFC M;  1WRD B;  3BBZ A;  3W68 A;  4GHL A;  4ANV A;  5JXV A;  3KWV A;  2H88 B;  2J0M A;  3PHX B;  2W9N A;  3DHG C;  2KC1 A;  1NL6 A;  1ZMW A;  1C1K A;  1YJ1 A;  1A5T A;  2WXQ A;  2WSC F;  1WM3 A;  1WYG A;  4LJ9 A;  3VRB B;  1TKY A;  2X8X X;  3IHP C;  4ZRQ A;  3RT3 B;  4HCP B;  4B0E A;  2L09 A;  3QAR A;  3UIN B;  2VDB B;  4RM8 A;  4NL4 H;  4XUI A;  2KN4 A;  1EUV B;  3R2I A;  2GOW A;  1AWD A;  1CMX B;  2N0S B;  2R9C A;  3MP2 A;  4C00 A;  3C0R B;  4A6Q A;  2LH0 A;  3L13 A;  4Q8G A;  1QMY A;  2Y5P A;  2LGI A;  2WS3 B;  1X9Y A;  1TKG A;  3NWL A;  2IY0 B;  1L2N A;  1PYW D;  3EFC A;  1F2R C;  2AQ1 B;  2WWZ A;  4JQW C;  4MGI E;  2K5P A;  1TS4 A;  1EE8 A;  1SE3 A;  1WM2 A;  1TJE A;  2FQ9 A;  2KXE A;  1NJF A;  1XD3 B;  4QRX A;  3H7S A;  4AZF A;  4A3P A;  2NQ8 C;  1Z5B A;  1EF5 A;  1WRI A;  2K25 A;  1OGW A;  4L15 A;  2NBV B;  3VK8 A;  3BC3 A;  3Q3O C;  3SD5 A;  1BGO A;  3LQQ A;  2OOB B;  2L32 A;  1YX5 B;  4MEL A;  2FFJ A;  2FUG 1;  4I07 A;  3AEF B;  4AKI A;  3ZJT A;  2AQ3 B;  5BPV A;  9PAP A;  5CVN B;  2J7Q A;  1NI2 A;  2LEK A;  5LNK 1;  2D5G A;  1XC8 A;  5H37 D;  1XLN A;  1P98 A;  1ROE A;  2FCQ A;  2L3Z A;  1XXH A;  1WFY A;  4BKG A;  2NQA A;  4OEL A;  3GLH B;  3U6S A;  2K1F A;  5D6J B;  3VH3 B;  1OFF A;  3DFZ A;  3PNV A;  2FCS A;  2WLB A;  1QVR A;  2NTS A;  2DHZ A;  4BPV A;  2PPH A;  4GC5 A;  5JI3 E;  1R4M I;  1PDX A;  1OJL A;  2Z0D B;  2KLC A;  2JXT A;  4ZHP A;  4D8B A;  3PRP A;  1NDD A;  1MJG M;  3BZD B;  1DGG A;  4JI8 M;  1V80 A;  4NQK E;  2O01 F;  5IZ7 D;  3ZLZ A;  4MI7 A;  1PJQ A;  2C9O A;  2QZ4 A;  1JWS D;  3HJS A;  2D2Q A;  4LGM A;  1M6D A;  4B7H A;  3GQ4 A;  2JY6 B;  1TH4 A;  4C4V A;  1IYF A;  3PVL A;  1R4G A;  2KMA A;  1VRA B;  1DOI A;  1KF6 B;  2LVQ A;  4B9K A;  1N77 A;  1NEK B;  2LVP A;  5CHT A;  1D4B A;  3L4P A;  3JVZ X;  1U9Q X;  4MM3 A;  2D7H A;  2CE7 A;  4IUM B;  1KSF X;  4KGT A;  4LF9 M;  1PBH A;  4RM9 A;  3DCG A;  3T3N A;  4REZ A;  1TGZ B;  3QJZ A;  4YV8 A;  3UI3 A;  2SEB D;  4F1I A;  3H89 A;  3KFQ A;  1V86 A;  4A90 A;  2BGF A;  3OIS A;  2OPF A;  1GJZ A;  1FD6 A;  1XNQ M;  4F7Z A;  2KKC A;  2OUL A;  4H2A A;  3Q3M C;  1CS8 A;  1QOL A;  4C7Y A;  1ZUD 2;  5C3J B;  3ENE A;  1E90 A;  4AJY B;  2WXR A;  5KHQ A;  4HK2 A;  4YVA A;  4NAM A;  1L0Y B;  3QWL A;  1Z5C A;  4N6E B;  3HVD A;  4YL8 A;  3D8L A;  2DAJ A;  3P2B A;  1V97 A;  2M17 A;  1FCC C;  2F7D A;  2N7D A;  1WR1 A;  3B1L X;  3MHS D;  3PRZ A;  5FPW A;  5AZH A;  1KFY B;  2EMT A;  4DV4 M;  3KOZ E;  4BKT A;  4MGH A;  5CTR C;  1IY0 A;  2G1E A;  1LQB A;  2ACZ B;  2BTE A;  4GOC A;  4X65 M;  3AV8 A;  3UGB B;  1SJE D;  2DHR A;  3S2A A;  2LHD A;  1J19 A;  1BT0 A;  4YYV A;  1T0Q C;  4X66 M;  2XBB C;  2WSE F;  2R9O A;  1WZ3 A;  4AP4 C;  3AFH A;  3BWK A;  2QHO A;  1C76 A;  1LM8 B;  1AU4 A;  3GE3 C;  3E4R A;  3TWM A;  2J4X A;  1BQI A;  2GNO A;  3DBR I;  4NQL B;  4RKX A;  2WXO A;  4IWP A;  2EA0 A;  1AW7 A;  2LGY A;  4K3B A;  2K9D A;  5CHV C;  3FAH A;  2KJR A;  1M4V A;  3NVV A;  2Y5B B;  1OQQ A;  3MC0 B;  1ZDV A;  3D8B A;  4II3 B;  1E94 E;  3PLU A;  2PJH A;  4P6E A;  4WWP A;  5BYQ A;  3KP1 E;  4ZHO A;  4LG2 A;  4URK A;  2JXX A;  1V6E A;  3HHI A;  1P1A A;  2JWU A;  4P16 A;  2R9M A;  1G4A E;  2JQG R;  2LWX A;  3M0E A;  2JRH A;  2DCD A;  1FM0 D;  3MJW A;  1VLB A;  3KXE C;  5FR3 A;  3FUT A;  4I5S A;  3RVV A;  2R2O A;  3Q8X A;  3EEC A;  4HLE A;  4DR3 M;  5T8I A;  4BBN F;  5EXT A;  1ZDX A;  1EWC A;  2RD0 A;  3J2P B;  2MX2 A;  1JRO A;  4EZJ A;  3RE8 A;  1S4V A;  2BJW A;  2G5G X;  3PT2 B;  4RKU F;  1K53 A;  1L8Q A;  3TCA A;  3JR4 A;  1XQQ A;  3NRZ A;  3O1G A;  1TR8 A;  1XXH B;  2LVA A;  2MCN B;  3KYD D;  1ORY B;  4BLC A;  3SU8 X;  4X6H A;  4LFB M;  1TZ1 A;  2XU3 A;  3UJN A;  3GB1 A;  2KVZ A;  2BKF A;  4J3O D;  2XK5 B;  3GRR A;  4DV7 M;  2LUE A;  3A45 A;  3Q8B A;  2P0R A;  3U61 B;  1ZV1 A;  4X57 B;  4TV3 A;  1R6B X;  5E6J A;  2LVQ D;  4A8X C;  1GPX A;  3BY4 A;  3MOR A;  2N35 A;  3GOE A;  4WAA A;  2XFT A;  3ZNZ B;  1AYW A;  2RMM A;  1EM7 A;  6PAD A;  3P5X A;  2HJ1 A;  2P86 A;  1QLB B;  2Z8L A;  3B08 A;  2R45 A;  2DEN A;  2UZJ A;  2UYZ B;  4BAX A;  4QH6 A;  2Z8Y M;  2DAG A;  1L2B A;  4DMY A;  4CQN A;  4JWS C;  1L6V A;  1EU3 A;  2GFO A;  4MSX A;  3USV A;  1WGG A;  1UM8 A;  2DC6 A;  2R4E A;  4XBO A;  1I94 M;  5C1Z A;  1TZO A;  3L29 A;  2IO2 B;  3ZDM C;  2KMC A;  3VQI A;  1E5W A;  3OTO M;  1Y8R C;  1MEG A;  4XYC A;  1E7P B;  2MJ5 B;  5A2Q S;  1WXM A;  1HJP A;  3I51 A;  2BB6 A;  4EKU A;  1E8W A;  3N32 A;  4CYE A;  3SFZ A;  2MW5 A;  2LTU A;  5JH3 A;  4F1S A;  3B9P A;  4QNM A;  1QAN A;  3AU5 A;  3W9C B;  4LJ5 A;  2DYM A;  5HFY A;  2CFO A;  3IEJ A;  3MJ5 A;  1E6E B;  1ZW7 A;  4W5B A;  2RKO A;  5JZE A;  2OED A;  2NQI A;  3IG5 A;  3MHS A;  1Y08 A;  1SSN A;  3ZNH A;  3ZXV A;  4WWO A;  1DKI A;  1GAQ B;  1NPZ A;  1EWL A;  1P9D U;  3OVZ A;  3UZU A;  3PSE B;  2CEA A;  1PPD A;  1PRB A;  4TKN A;  3AXC A;  3P5U A;  2B3T A;  1S3S A;  2Y3A A;  3HU2 A;  3V62 A;  3J7B A;  1Y4H A;  2IBI A;  1OQR A;  1L7Y A;  5JHA A;  1WR1 B;  1L0X B;  2JVC A;  4M02 A;  4EUT A;  4X6J A;  2FOI C;  2TSS A;  3URY A;  3ZGZ A;  1IXS A;  2QMT A;  2AL6 A;  2BWB A;  1V8C A;  2XZF A;  2RDH A;  1AYU A;  3QT4 A;  4R3D A;  1EWO A;  1CQD A;  5LXH A;  4AJW A;  2KA6 B;  3B74 A;  4MDK E;  4P6V F;  2V0G A;  2G6D A;  5CHV A;  3C3D A;  2DI0 A;  1N60 A;  2R65 A;  2VF7 A;  4XX5 A;  5JHB A;  3N3G A;  4CDD B;  3H4M A;  1K3B B;  3PBH A;  4JI6 M;  3RUL A;  2ZPN A;  2CS4 A;  2O6V B;  1EU4 A;  3H4J A;  4MH0 E;  1L5P A;  4II2 B;  1IN5 A;  3A33 B;  1PM5 A;  3TQS A;  1YX6 B;  5MPO A;  1KM7 A;  1R4N I;  1FNN A;  4JI0 M;  1CTE A;  1SIJ A;  1CV8 A;  3HK0 A;  1Q5W B;  3HU1 A;  2CU1 A;  5BR8 M;  1D6E C;  2CHQ A;  3GO8 A;  4ZDV A;  1BXT A;  1F1H A;  4I6N B;  1SXJ D;  2L1A A;  3SAV A;  1DGF A;  1W5S A;  4N4Z A;  1H6U A;  5H92 C;  1IBX B;  3GPU A;  3T8M A;  4BKS A;  2IPP B;  3MMP A;  2VII A;  2B76 B;  2DC9 A;  4M8N A;  3N30 A;  4GXB A;  3HZJ A;  1VZ8 A;  3PZD A;  3QWZ B;  1D0L A;  1JWB D;  1T5X D;  3ML8 A;  5AEK B;  1Q1O A;  1YD8 U;  1SE9 A;  4YYS A;  1V1O A;  1F2B A;  2KX0 A;  5EJC A;  4GKJ M;  5LMU M;  2HWK A;  4W9I A;  3JSV B;  1WMH B;  3N3K A;  1IN8 A;  1JWM D;  2KNB A;  2WXP A;  3AOG A;  3U8Z A;  4IM0 A;  1I4H A;  1GUA B;  1IY1 A;  2KW0 A;  1AU3 A;  2V1Y A;  3TSS A;  1L1T A;  4NJ7 A;  3AKZ A;  2DBY A;  4W9C A;  3B7Q A;  2W55 A;  1JR3 D;  1IGC A;  2PLP A;  4ZPX A;  3GPX A;  4Z6Y A;  1SBB B;  3LB8 C;  1I42 A;  1EF7 A;  2KEB A;  1L1Z A;  3W1Y A;  1IBL M;  3O65 A;  5AUI A;  1F4I A;  1R4M B;  4PS8 A;  3ZUA A;  4PDI A;  1XT9 B;  1T43 A;  2D3B A;  2VHF A;  2HHH M;  2SAK A;  3UQA A;  1XCT L;  1NLJ A;  5ITR A;  3U61 A;  2QQ8 A;  2V1C A;  4IBF A;  3TMP B;  2CHZ A;  3FD9 A;  5CX3 A;  1MEM A;  2JY5 A;  2J5Y A;  1SXT A;  4KVG B;  4QAY A;  4RGT A;  4ZRJ A;  1K3X A;  1Z5S B;  1DGB A;  3BIN A;  1QZE A;  4G4O A;  1ESF A;  2OJW A;  4ZYS A;  3RZW C;  1AU0 A;  3EFU A;  3M95 A;  4HXD B;  2M0X A;  1ENF A;  1ME3 A;  1NO1 A;  4DQO C;  1UWX A;  2KN5 A;  4LRT A;  2MA9 B;  4FAD A;  3KP0 E;  1WGY A;  1HTO A;  4DUZ M;  2GB1 A;  2VHS A;  1TH2 A;  1TU6 A;  3PHW A;  2XEW A;  1HZ5 A;  3RCZ A;  4OEM A;  2DKL A;  1ZMV A;  1TKE A;  3H6N A;  1GC7 A;  4ANW A;  1LO5 D;  3GLI B;  4DR1 M;  1PGY A;  2N1W A;  3GCB A;  2YJB A;  4MB7 A;  1ZCM A;  2YJ8 A;  2EKK A;  4RF0 A;  2I38 A;  3SMP A;  3ZVV A;  2JRI A;  1YN4 A;  3LQR A;  4PP1 A;  4JI3 M;  2D3C A;  2BYF A;  2GBM A;  3IAS 1;  3K9P A;  1F2R I;  1QOA A;  1E9M A;  4GDK B;  3Q8A A;  1FRR A;  2DNF A;  3SC3 A;  3B2F A;  4LDT B;  2DWN A;  4US9 A;  3O0U A;  1Q3B A;  3ZNH B;  3C58 A;  1N78 A;  1KTK A;  1LV7 A;  2I7P A;  2KWV B;  5BMG A;  1ZXI A;  2O6X A;  4QHT A;  5DNY A;  4DV0 M;  4HLQ A;  3PZ8 A;  1UWM A;  5C23 A;  2DAK A;  2DAE A;  1ZOY B;  4DHJ B;  1WJ6 A;  5F3W A;  4YYU A;  3APD A;  1A5R A;  2JYT A;  1T0Y A;  3KVW A;  2MJ3 A;  3KVF B;  4NSR A;  4DXG A;  3M99 A;  4FCV A;  2ZNV C;  1L2C A;  1YSY A;  4XZ4 A;  4WUR A;  3BCN A;  1JB0 F;  4P17 A;  4BKS D;  2HD5 A;  1ZQ9 A;  2DWL A;  3QJ3 A;  3DVN U;  1L6U A;  2L2D A;  2UUC M;  3U6M A;  1C4C A;  3C3E A;  2K6D B;  3PZ7 A;  5EE0 A;  1NV8 A;  2KZR A;  1DF0 A;  3DOW A;  3ZQ4 A;  1UF0 A;  1NB5 A;  1Q3C A;  5L95 C;  1PE6 A;  1WH3 A;  2F5O A;  3PFI A;  4JI5 M;  2JU6 X;  1K52 A;  2LBC A;  1SB3 C;  4JI1 M;  5GMV A;  5DPS A;  4W4U A;  2N9K A;  4DR2 M;  3PPA A;  1VJK A;  4MGZ E;  1GB4 A;  4BOS A;  3IFW B;  2JTC A;  2MP2 B;  2UXD M;  1SJH D;  3KUC B;  3QK0 A;  4N58 A;  4DHZ E;  3UK6 A;  2EEL A;  4YSY B;  1XLQ A;  2CP8 A;  3MC9 A;  2Q2E B;  4BS5 A;  1G8P A;  2JY8 A;  1J7B A;  2KDI A;  2N1V A;  2V3N A;  2N9X A;  3ZTD A;  2BS3 B;  3H8H A;  1R7R A;  2PIA A;  4NSO B;  2GMI C;  5ITX E;  1E8X A;  1G71 A;  2BWE S;  2QPA A;  2GRI A;  1D0K A;  4MAC A;  2LI5 A;  5FTK A;  1V1P B;  4B95 A;  5F02 A;  2GHU A;  2WXN A;  1K50 A;  4XWW A;  2L76 A;  4MJS A;  3S3R A;  4MGK E;  3AI5 A;  4NC6 A;  2XGN A;  2G9H D;  1MX0 A;  2KFK A;  4RF1 A;  3SHG B;  3T1H M;  3AEG B;  3IOQ A;  4CZW A;  4BOZ A;  3NZS A;  3FTF A;  4HWY A;  2DHY A;  2YJ2 A;  4JI7 M;  4WW0 A;  1R2Y A;  1VEJ A;  4AXM A;  1YQ4 B;  2CJO A;  5I4D A;  1N33 M;  3ZTC A;  2LVO C;  2OHF A;  4OHJ A;  4DWF A;  2LVO A;  4W5W A;  5EP1 A;  4K81 A;  2DZJ A;  1DGJ A;  4HRS A;  3VR9 B;  2Y5C A;  2VH1 A;  2B1M A;  2ZAN A;  1R5L A;  4IIW A;  3I04 M;  2ZJD A;  5FTN A;  2J7Q B;  4OVZ A;  3PV1 A;  1BP4 A;  2HWJ A;  4GDL B;  1HTQ A;  3LXF A;  1OTR B;  3TIX A;  3RNE C;  1S3S G;  3L2A A;  1QDQ A;  3T38 A;  1NYR A;  3LCU A;  2LD9 A;  2LWP A;  2DJF B;  3CGW A;  3L0W B;  4HWI B;  3V3X A;  4M9Z A;  1TBE A;  4EZK A;  2Q5W D;  2V1U A;  3VDZ A;  1E0Z A;  4N9F 4;  2XU4 A;  5KPR A;  1QOF A;  5L83 A;  1GG3 A;  3E21 A;  1IUE A;  1SXJ E;  3GLI A;  1MIR A;  4MZO A;  3AEE B;  3W5U B;  2UU9 M;  3KKU A;  2LXC A;  1WWT A;  1QOG A;  3X23 A;  5KQ8 A;  2BYV E;  3U8E A;  1RM6 C;  4ANX A;  1ET9 A;  1UFZ A;  1I4X A;  2LXE A;  2QSF X;  2DZK A;  3ZYY X;  4LF8 M;  2ASQ A;  3TJP A;  2E02 A;  1WI0 A;  4FW9 A;  4DR5 M;  5C1B A;  2C7M B;  4G4N A;  1FJG M;  4CIZ A;  3DBH I;  1ICF A;  3TNX A;  2G3Q A;  4LNN A;  3FKE A;  4A3V B;  2KC2 A;  2FUH B;  5DPT A;  1WE7 A;  1OFH A;  2K9X A;  2LGD A;  1FXT B;  3E46 A;  3D32 A;  2Z59 B;  2L7R A;  4FN2 A;  3PNR A;  2BVC A;  1QDT A;  2VQF M;  3V6E B;  4JX1 C;  4WJP A;  2ZNV B;  3BII D;  1GCB A;  3AI8 A;  2DZI A;  2Y6E A;  1YK8 A;  2BB5 A;  1U9V A;  5PAD A;  2YQZ A;  4PD2 A;  3L10 B;  4LF5 M;  2KAJ A;  1NQC A;  2M19 A;  2PVG C;  2Z84 A;  3L25 A;  2WXL A;  1QIL A;  1KFU L;  4IP3 A;  2JY7 A;  2HKJ A;  3V6C A;  4OVV A;  3PHU A;  4LJO B;  3VVW B;  4FD2 A;  1MHW A;  1N36 M;  2RGH A;  3ZW3 A;  1G6J A;  1KH0 A;  2C9W B;  1ZP0 B;  2OZ2 A;  2P7U A;  2EKF A;  1PJJ A;  5EE1 A;  2DCB A;  2BTW A;  4CO7 A;  2G8J A;  4YT0 B;  5FLX S;  1XLP A;  2A5Y B;  2MRP A;  4IWQ A;  1D5M C;  4JXJ A;  1UH6 A;  2ZVO A;  2VRR B;  3N9Y C;  1G41 A;  3IAM 1;  1K51 A;  5H8Y E;  2IYD B;  4M01 A;  2WNM A;  1KFX L;  1V9J A;  4AG5 A;  2IJ0 A;  4YYQ A;  1SG9 A;  2Y21 A;  3ECI A;  4IKG A;  1B9R A;  3AE2 B;  1FXI A;  4D80 A;  2K47 A;  2ERC A;  2N9P C;  3ZJV A;  4RMA A;  2JWS A;  3P5W A;  2EKE C;  3I4Y A;  4PI3 A;  4XZX A;  1FH0 A;  3RGS A;  2C5L C;  1ZGU B;  3CBK A;  3ZRC A;  4DXA B;  2LJI A;  5D7G A;  2AYN A;  3KLS X;  2LNH C;  2CWB A;  3P42 A;  3W30 A;  3VUW A;  2D11 A;  3VUY A;  2XU5 A;  1JR3 E;  4DUY M;  5LLI A;  3CF2 A;  1WY8 A;  3KW6 A;  3PSE A;  1V1P A;  2E00 A;  1S1Q B;  4NAW B;  2WHI A;  2QP9 X;  3ZNI D;  4EE2 A;  1IPG A;  4US8 A;  4BZA A;  4MJS B;  1YZB A;  3TUO A;  4KGS A;  2IBI B;  3LW5 F;  2B1N A;  3DWM A;  1HNZ M;  1E32 A;  3VDP A;  2MR9 A;  3AU4 A;  4HRO A;  2KDF B;  1WYW B;  1FNV A;  3U6C A;  2BWE A;  3U5Z A;  2MWS B;  2AYO B;  3MP9 A;  5DPR A;  3JR5 A;  1P7F A;  3DZD A;  1ZPS A;  3K9O A;  4BOZ B;  1CPJ A;  1WR6 E;  2JUJ A;  1Z5A A;  1U5I A;  1QUT A;  2NQD B;  2XEP A;  5CHF A;  1ZMU A;  5TR5 A;  1D5Z C;  2QNJ A;  3NY5 A;  3PRM B;  1MVK A;  2D10 A;  3AOE C;  1GJS A;  3IG8 A;  3W31 A;  3MHH A;  4JI2 M;  2R6F A;  1XLO A;  3Q3J A;  2YEP B;  2LHE A;  3KOX E;  3L28 A;  1EIJ A;  3GLG E;  3CF0 A;  1KHQ A;  4IWO A;  1YNT E;  4OVZ B;  2FRQ A;  1JRU A;  3AE4 B;  3PT2 A;  2R62 A;  2C5R A;  3ALB A;  2MHJ A;  2VH2 A;  1F0Z A;  4PS3 A;  3TWK A;  1X37 A;  1C7Y A;  1JML A;  2LRW A;  2DCC A;  3AE1 B;  1IBX A;  1POP A;  3PXG A;  2XK5 A;  1C3T A;  4DBG B;  2L6O A;  4BOP A;  3J81 S;  4UN2 B;  2D7G A;  3V05 A;  1C9F A;  2XFS A;  3U4E G;  4I6P A;  3RVX A;  4C56 C;  4NRW A;  2IGD A;  3VHT C;  1IBK M;  2RR9 A;  4B6W A;  2QIL A;  3K9M A;  4CDE B;  3SAR A;  4D2K A;  4IBK A;  5GKN A;  3D6S A;  3VUX A;  2AWT A;  1HA5 A;  3WXG A;  1E9S A;  3RPF C;  2DNA A;  8PCH A;  1FNW A;  3O13 A;  4CDC B;  1KLU D;  2DOS A;  3GPP A;  1CJL A;  2ZZP B;  5EXS A;  4HPP A;  4G3X B;  2WZJ A;  2WXK A;  3L26 A;  4K7S A;  1WX9 A;  3DBS A;  2R6N A;  3ZRF A;  2ZPY A;  2KRU A;  4LJ4 A;  4K1R B;  1IP9 A;  3ZXR A;  3HWS A;  2KHW B;  3K8U A;  1DOY A;  1XO3 A;  2KDM A;  2C9C A;  2G3Q B;  4MZS A;  2E6X A;  3MK6 A;  2L52 A;  2OOB A;  3Q8F A;  4FBJ B;  1NY5 A;  2PMV A;  2QCZ A;  1E7U A;  3FTD A;  2XN9 C;  2ZCC A;  2PAD A;  3ZO5 B;  3OQC A;  2HL7 A;  2MGW A;  4KKI A;  1MJD A;  4GMV A;  3A1Q A;  1WGK A;  2EKI A;  1PJT A;  3NUH B;  3HRD D;  4HXD A;  2ONQ A;  2UU7 A;  1DO2 A;  1T3T A;  3SEB A;  5FTL A;  1C77 A;  4USA A;  3V6C B;  3GRY A;  4IBD A;  2OQ4 A;  4AI6 A;  2PRE A;  1QAQ A;  2MRO B;  1LTM A;  3IEC A;  4NJ6 A;  1WGD A;  2VZK D;  3MC8 A;  4NOO B;  2HHN A;  2IO1 B;  1Q39 A;  4LJ8 A;  2HDE A;  1AU2 A;  2JQF R;  4KIK A;  1SF0 A;  4KOD A;  1OQY A;  1PXV A;  1VDL A;  4M0W B;  3P1M A;  4IOI E;  2W3R A;  1C1Y B;  2GLS A;  3HHA A;  4NXM M;  4MM3 B;  3N1X C;  2WU2 B;  1G59 A;  2AVW A;  3HWN A;  4GDK A;  1D3Z A;  1WHC A;  1P3Q Q;  4IUM A;  1HUC B;  1MS6 A;  1XKG A;  2F5N A;  2INP E;  2CR5 A;  3AE3 B;  1FEH A;  1M94 A;  1IY2 A;  1PGB A;  4G11 A;  2R9F A;  3FUV A;  2D3G A;  3JYU A;  1TTE A;  3QAU A;  2KQS A;  5ITT A;  3VH4 B;  4C80 A;  2MH7 A;  1DO0 A;  5KPT A;  2KT7 A;  1D2N A;  1KJT A;  4PK1 A;  3FTE A;  1N6Z A;  4HPL B;  1I7H A;  1C78 A;  2LVP C;  3B7Z A;  3TE6 A;  5KPZ A;  1THE A;  2RGO A;  2QBY A;  2G4D B;  3U5Z B;  2NTT A;  2KWD A;  1OAI A;  3HD3 A;  3HU3 A;  3K9O B;  4FLH A;  2QEN A;  4EZL A;  4QOS A;  1Q0W B;  4GB9 A;  2Y0T A;  2ZW1 A;  1U4A A;  1PGA A;  3M62 B;  3EGR A;  1T6O A;  2V3S A;  1QF6 A;  3GLG A;  2LVN C;  3H7D A;  1Z6T A;  2J7O A;  4OZA A;  4AXL A;  2L4F A; 
#chains in the Genus database with same CATH homology
 2MJE A;  2FNA A;  4BBA A;  3AEC B;  1HQR D;  3Q8C A;  3A98 B;  4WIP A;  2XSZ D;  4S12 A;  3SFD B;  3HJQ A;  4GIT A;  4IDI A;  1GB1 A;  3FUW A;  5FSW A;  3TMP A;  3BYT B;  2ZBK B;  3RGP A;  4LGY A;  4QHS A;  4D82 A;  1FXA A;  1UUP A;  4IJF A;  3VKH A;  3FYC A;  3TL4 X;  4FWG A;  4OX9 M;  1B1Z A;  3ZH9 B;  3IFU A;  1GL7 A;  4L16 A;  4RGN A;  2XH9 A;  1GVN A;  4R7G A;  1K82 A;  1I4W A;  3GRU A;  4KO8 A;  1CZP A;  4GC9 A;  3CWI A;  2C98 A;  2W3S A;  2INN E;  1WXQ A;  3HHX A;  5EXX A;  1DGH B;  2DWQ A;  3TEW A;  1HT2 E;  3R2T A;  1J7C A;  1QQR A;  3KS8 A;  1VR9 A;  1NEN B;  5EXP A;  1Q10 A;  2F5P A;  1TS5 A;  4AG6 A;  3U60 A;  3RFW A;  3E56 A;  3NVZ A;  4RH6 A;  1XXG A;  3FIL A;  4JE3 B;  2LFI A;  3HHY A;  3SYL A;  2M0A A;  4NZL B;  1VDV A;  4JV5 M;  2R4J A;  1N5W A;  3LVV A;  3KOY E;  1N75 A;  2BT6 A;  4HKQ A;  4FWH A;  1RYJ A;  3GLF B;  4PT5 A;  2XNA C;  4IBE A;  4IBI A;  1NY6 A;  3SMS A;  1L2D A;  1VZ7 A;  1FIQ A;  1UNS A;  5HI1 A;  2BBC A;  1GOZ A;  4WH4 A;  4BOQ A;  4NRV A;  1HR0 M;  4GHA A;  4HJG E;  3M6A A;  1F77 A;  3AV0 A;  4UDU C;  1IQP A;  4DV5 M;  5FK9 C;  3CIR B;  4DR6 M;  2G8L A;  4KGR A;  2BTW B;  4L4U A;  1NSF A;  3BBA A;  1MU5 A;  1L0V B;  1ZXH A;  2ICI A;  2BS2 B;  4C7Z A;  1EWY C;  4I81 A;  1KFV A;  3U7Z A;  1MPE A;  3DWG C;  3T3O A;  4A5U A;  4KHP M;  5FTM A;  1TGU A;  2KZS A;  5HG2 A;  4RCO A;  3ILK A;  2AQ2 B;  3HHW A;  1PJI A;  4YWG G;  1BUI C;  4L1B A;  3IT6 B;  3K8Z A;  1PVJ A;  2X38 A;  4ZTB A;  3A42 A;  3SAS A;  2C99 A;  2BYT A;  1YUB A;  4KLN A;  3A46 A;  4G6Z A;  5E26 A;  1XF5 L;  3AEB B;  5ITX A;  1YJI A;  2DWZ B;  3DA1 A;  3PO0 A;  1TY0 A;  5ITU A;  3BVG A;  1QT9 A;  3WCQ A;  2IDY A;  2F5Q A;  2KMM A;  3AH7 A;  1NHW C;  1W5T A;  2M60 A;  2Z7J A;  3PRM A;  3NVW A;  5EZQ A;  4B3R M;  2CU3 A;  1IXR C;  3T15 A;  3FYD A;  2FE8 A;  2CV1 A;  4HEA 1;  5BMH A;  3NS1 A;  1KRH A;  3KWL A;  3KOW E;  2J7N A;  1C79 A;  1NJG A;  3U6E A;  4ITK A;  3HJ8 A;  1UKF A;  3R9X B;  2I7N A;  4NXN M;  2BU3 A;  2WQY B;  2DWM A;  2VZK B;  3U6L A;  2WXM A;  3HUI A;  3U6P A;  1J5E M;  1IGD A;  2YR0 A;  3L27 A;  1QZM A;  1IBM M;  3GQ3 A;  3WHL A;  1RFK A;  2X4A A;  3KQ4 A;  2EUC A;  2K0P A;  1Z59 A;  1R2Z A;  2IPK D;  1IN4 A;  1NHG C;  4LZJ A;  1NNJ A;  4AW4 A;  2YFQ A;  2QCU A;  2H89 B;  1HQC A;  3DOA A;  4LJA A;  2KRK A;  4B0M A;  2WXG A;  3W0L B;  3U2S C;  1QAM A;  3RNV A;  1N34 M;  1FRD A;  4D8I A;  4YTP B;  1SXJ A;  5ITY A;  3K2L A;  3ABV B;  3BK2 A;  2AHM A;  2J7Q C;  3W2D A;  5EZS A;  1AYF A;  3AL0 C;  1SE2 A;  3BB7 A;  4OW0 A;  4IJE A;  4JN6 A;  1ET6 A;  4EIW A;  1FFV A;  2HCB A;  3AE9 B;  4RNA A;  1Y56 A;  4BB9 A;  3J7A S;  1IN7 A;  4M0W A;  2Z3X A;  1HEZ E;  3Q8E A;  4I4L A;  3KDS E;  3ZCB B;  2WXJ A;  2AGA A;  2X8A A;  1STE A;  4OZB A;  1CK1 A;  4CIS A;  4XDD A;  4HKZ E;  4LZZ A;  2YNM D;  1SEB D;  4AKG A;  4AKH A;  1JWU D;  1VZ6 A;  5C2T B;  3RFZ B;  1QYR A;  2BS4 B;  3HVZ A;  1R7S A;  3P4P B;  4IBC A;  1MHH E;  2IGH A;  5D3I B;  1P7E A;  5G5G A;  4B3T M;  4B7G A;  4JYA M;  3SAW A;  3BVZ A;  1XCQ L;  3E9S A;  2KZU A;  1AN8 A;  2F5S A;  5EE3 A;  5BYS A;  4TQ1 A;  3WHK A;  1E10 A;  4GKK M;  4OU7 A;  4RGM A;  1ZAE A;  2HTM E;  1JWA D;  2KQ4 X;  3OWE B;  2Y0Q A;  5FKA C;  3AE8 B;  2RPV A;  3EUB 2;  3NZ3 A;  3PHX A;  4JI4 M;  3U6Q A;  1YJJ A;  3AMZ A;  3M7G A;  4IBB A;  2WXH A;  2BW2 A;  5TSS A;  4IBJ A;  2Y20 A;  4L23 A;  2F4V M;  2M5Z A;  5LMN M;  4AQY M;  3GP7 A;  4DV1 M;  2J53 A;  2JX5 A;  4Q2J A;  2I2Y A;  2V6Z M;  2CV0 A;  3P4R B;  5EQT A;  4O1N A;  5DYG A;  3BYY B;  4G4R A;  1HXY D;  5GXG B;  8CAT A;  4M9S A;  2ZM6 M;  2MJD A;  4XDC A;  3AEA B;  3AB5 A;  2Z4S A;  5KO3 A;  2JZP A;  3BVM A;  4GLS C;  1TS2 A;  5JI2 E;  2IGG A;  1I4R A;  2UUB M;  1JRP A;  5KQD A;  2RDG A;  3BWU D;  3GS2 A;  3KS4 A;  2MEK A;  1YQ3 B;  3ZC7 B;  5D3D A;  1DGH A;  3GLH A;  3EIE A;  3PVS A;  2C96 A;  1L4D B;  3MHV C;  3SAU A;  2WDV B;  4LJ6 A;  1N62 A;  3AE7 B;  1J7A A;  4X62 M;  3R8F A;  2WU5 B;  3U6O A;  3J27 B;  1N63 A;  2JA2 A;  3FIL B;  1MI0 A;  1XEE A;  3VLF B;  4WWM A;  2YEP F;  4LF7 M;  1C4A A;  2WXI A;  4TQ0 A;  3SHF A;  5EE9 A;  1YN5 A;  1QKZ A;  4ZRP A;  3VDU A;  2NMQ A;  1PGX A;  3VR8 B;  2R18 A;  3SYK A;  3GLG B;  2R46 A;  2DVW B;  4KKJ A;  4RGO S;  3EA6 A;  4ARI A;  1HZ6 A;  4LJ7 A;  4B7F A;  3FC4 A;  3W0F A;  4NJC A;  4QOZ C;  4YXD B;  1SXJ C;  2DXI A;  4PDG A;  1J7K A;  3J80 S;  2DZO B;  2ON8 A;  3CTW B;  1FFU A;  3HKP A;  2CHG A;  3LYY A;  1IXZ A;  1NVI D;  4A55 A;  2JYE A;  3AE5 B;  5IWA M;  2X49 A;  4FCW A;  1I4P A;  3C0R A;  4FVM A;  4XWT A;  4JPS A;  4XE0 A;  4D8E A;  1J09 A;  4G4Q A;  1CJE A;  2CJN A;  1CQV A;  2QEJ C;  2XF3 A;  1IN6 A;  2XSZ A;  2KAC A;  2XLJ A;  3KSX A;  3TEY A;  2P5T A;  3BOS A;  2VQE M;  1TDZ A;  2WXF A;  2CHV A;  1RWS A;  3B21 A;  1OFI A;  4A9A A;  2WDR B;  4WAF A;  1UGJ A;  2E5L M;  1I4Q A;  1HNX M;  2AX5 A;  4MT5 A;  5IT9 S;  4CHT B;  4XGI A;  4LF4 M;  3K92 A;  4FWD A;  2XZU A;  2O5R A;  3U60 B;  4LK0 M;  2DYO A;  3ETR A;  2N7J A;  1HT1 E;  4AS1 A;  1XHB A;  2ZW0 A;  4DXF A;  3MTV A;  3TEX A;  5EP2 A;  3HHZ A;  3VKG A;  1TYG B;  1N61 A;  5G5H A;  2PVO D;  1YMH E;  2L7I A;  3MFG A;  4GIP A;  2W82 A;  4DR7 M;  1NI3 A;  2LMC A;  1FO4 A;  3NVY A;  2L83 A;  2M56 B;  3IT4 B;  4TUW A;  3CF6 E;  2H1R A;  1K3W A;  3GPY A;  1JW9 D;  1XMO M;  3VFD A;  1T3Q A;  1JCK B;  3U6D A;  3ZJU A;  4LLG M;  1VDD A;  3PNY A;  1WSP A;  4L2Y A;  1QQW A;  4L8R C;  1NNU C;  3K1J A;  1N32 M;  1SXJ B;  2V4I B;  1NYQ A;  1GL6 A;  4M0D A;  1QAO A;  4DV3 M;  4B3M M;  3HGI A;  2E3T A;  1DYQ A;  2J42 A;  3SR6 A;  3KSJ A;  2UUA M;  3FUX A;  3AN1 A;  4TMA B;  3UMM A;  4ITQ A;  3P63 A;  1TDH A;  4JWU C;  3I57 A;  4X64 M;  2QIE B;  4LF6 M;  2L7H A;  3FUU A;  2J52 A;  4ZOH C;  3AOE A;  1YE9 A;  3U52 E;  4GUA A;  2QBY B;  4N59 A;  3I9V 1;  3KFU G;  3LVW A;  1E9R A;  1IXS B;  4HL4 A;  3EIH A;  2W54 A;  3MHZ A;  3R8B A;  1PFD A;  4GRI A;  3FTC A;  1GKI A;  3C8Y A;  2K22 A;  4KX6 B;  2D7E A;  4II7 A;  4B3S M;  4YTN B;  2CV2 A;  2GI9 A;  3GRV A;  2FBW B;  1G3I A;  4FXC A;  2WP9 B;  3SBJ A;  1QOB A;  1YN3 A;  4Z8X A;  1JR3 A;  5ITQ A;  4GH9 A;  3TRK A;  4LTU A;  4TSS A;  3THG A;  1ZE3 D;  3AM9 A;  1PUT A;  4BOU A;  3GP1 A;  4I8O A;  2N9L A;  3SAT A;  1FCL A;  4L78 A;  5DYI A;  4RFB A;  5FTJ A;  2DZN B;  3NBI A;  2QSD A;  1JAL A;  3AED B;  1T6B X;  4K0K M;  1D5X C;  3IXS A;  4LFA M;  2QJL A;  1GLN A;  3TEZ A;  1XWI A;  3W5V B;  4LCB A;  1FMA D;  3P4Q B;  2ZAO A;  7CAT A;  5BYR A;  2K3U A;  1TY2 A;  2WDQ B;  4DV6 M;  4WQM A;  2CUZ A;  3TPZ A;  3B9J A;  4YHH M;  2DLB A;  3BK1 A;  3UGJ A;  5IRE B;  2BNK A;  2PTL A;  1XNR M;  4CGY B;  4MGY E;  4QNR A;  3W1S A;  4LY6 A;  1KLG D;  4D81 A;  3Q69 A;  3J9C A;  1BML C;  1HQY E;  2PW9 A;  1L4Z B;  1C4P A;  2JQR B;  4DR4 M;  4ARC A;  3I4V A;  4FCT A;  4IBG A;  1MHX A;  4GMQ A;  3T1Y M;  2JSV X;  1JQJ C;  1NVM A;  1FNU A;  1TH3 A;  1JQ4 A;  3GQ5 A;  2EO2 A;  3GLF A;  3LMM A;  2R61 A;  5HHD G;  1SE4 A;  2Z4R A;  5EP4 A;  1A70 A;  3SFE B;  1ACC A;  2UXC M;  4OZC A;  5EP3 A;  3B2G A;  4PCZ A;  2LUM A;  3AJI B;  3VRA B;  1TS3 A;  1HNW M;  4B08 A;  2PKO A;  5C18 A;  4YY3 M;  4AQ7 A;  4M9X A;  5AUK A;  4DV2 M;  3AE6 B;  1DOX A;  4LRS A;  1XMQ M;  2UXB M;  3P4S B;  5BMI A;  4YSZ B;  2ZAM A;  3VK7 A;  1KYI A;  4YTM B;  4MH8 A;  3TWL A;  2V3P A;  3JAM S;  4YSX B;  1I4G A;  2BJV A;  1IM2 A;  1N5X A;  4LFC M;  4GHL A;  5JXV A;  3KWV A;  2H88 B;  1C1K A;  2WXQ A;  1WYG A;  4LJ9 A;  3VRB B;  1TKY A;  4ZRQ A;  4B0E A;  2L09 A;  4NL4 H;  2KN4 A;  3R2I A;  1AWD A;  2N0S B;  3MP2 A;  4A6Q A;  2LH0 A;  2Y5P A;  2LGI A;  2WS3 B;  1TKG A;  3NWL A;  1PYW D;  1F2R C;  2AQ1 B;  4MGI E;  2K5P A;  1TS4 A;  1EE8 A;  1SE3 A;  1TJE A;  2KXE A;  1NJF A;  4AZF A;  2NQ8 C;  1Z5B A;  1WRI A;  4L15 A;  3VK8 A;  3LQQ A;  2L32 A;  2FFJ A;  2FUG 1;  3AEF B;  4AKI A;  3ZJT A;  2AQ3 B;  5BPV A;  2J7Q A;  2LEK A;  5LNK 1;  2D5G A;  1XC8 A;  5H37 D;  1XLN A;  1ROE A;  1XXH A;  3GLH B;  3U6S A;  1OFF A;  3DFZ A;  3PNV A;  2WLB A;  1QVR A;  2NTS A;  4GC5 A;  5JI3 E;  1PDX A;  1OJL A;  2JXT A;  4ZHP A;  4D8B A;  3PRP A;  3BZD B;  1DGG A;  4JI8 M;  4MI7 A;  5IZ7 D;  2C9O A;  2QZ4 A;  1JWS D;  3HJS A;  4LGM A;  4B7H A;  3GQ4 A;  1TH4 A;  1VRA B;  1DOI A;  1KF6 B;  1N77 A;  1NEK B;  1D4B A;  3L4P A;  2D7H A;  2CE7 A;  1KSF X;  4KGT A;  4LF9 M;  3T3N A;  4REZ A;  3UI3 A;  2SEB D;  4A90 A;  2OPF A;  1FD6 A;  1XNQ M;  4H2A A;  4C7Y A;  1ZUD 2;  5C3J B;  2WXR A;  4NAM A;  1L0Y B;  3QWL A;  1Z5C A;  4N6E B;  3HVD A;  3D8L A;  1V97 A;  1FCC C;  1KFY B;  4DV4 M;  3KOZ E;  4MGH A;  1IY0 A;  2G1E A;  2ACZ B;  2BTE A;  4X65 M;  3AV8 A;  1SJE D;  2DHR A;  2LHD A;  4X66 M;  3AFH A;  1C76 A;  3E4R A;  3TWM A;  2J4X A;  4RKX A;  2WXO A;  2EA0 A;  1AW7 A;  3FAH A;  1M4V A;  3NVV A;  1OQQ A;  3MC0 B;  1ZDV A;  3D8B A;  1E94 E;  5BYQ A;  3KP1 E;  4ZHO A;  4LG2 A;  2JWU A;  4P16 A;  1G4A E;  2LWX A;  3M0E A;  1FM0 D;  1VLB A;  3KXE C;  5FR3 A;  3FUT A;  4I5S A;  3Q8X A;  4DR3 M;  5T8I A;  5EXT A;  1ZDX A;  1EWC A;  3J2P B;  1JRO A;  3RE8 A;  2BJW A;  2G5G X;  1K53 A;  1L8Q A;  3JR4 A;  3NRZ A;  1XXH B;  1ORY B;  4BLC A;  4LFB M;  3UJN A;  3GB1 A;  4J3O D;  3GRR A;  4DV7 M;  3A45 A;  3Q8B A;  3U61 B;  1R6B X;  5E6J A;  1GPX A;  4A8X C;  3BY4 A;  2XFT A;  2RMM A;  1EM7 A;  2Z8L A;  1QLB B;  2R45 A;  2UZJ A;  1L2B A;  4CQN A;  4JWS C;  1L6V A;  1EU3 A;  1UM8 A;  2R4E A;  4XBO A;  1I94 M;  1TZO A;  3L29 A;  3VQI A;  3OTO M;  1E7P B;  5A2Q S;  3I51 A;  2BB6 A;  3SFZ A;  3B9P A;  4QNM A;  1QAN A;  3W9C B;  4LJ5 A;  2DYM A;  5HFY A;  2CFO A;  3MJ5 A;  1E6E B;  2RKO A;  5JZE A;  2OED A;  3IG5 A;  1SSN A;  3ZNH A;  1DKI A;  1GAQ B;  3UZU A;  2CEA A;  1S3S A;  2Y3A A;  3HU2 A;  3J7B A;  1OQR A;  1L0X B;  2FOI C;  2TSS A;  3URY A;  3ZGZ A;  2QMT A;  1V8C A;  2XZF A;  2RDH A;  4R3D A;  2KA6 B;  4P6V F;  2V0G A;  1N60 A;  2R65 A;  3H4M A;  4JI6 M;  1EU4 A;  4MH0 E;  1L5P A;  1IN5 A;  1PM5 A;  3TQS A;  5MPO A;  1FNN A;  4JI0 M;  1SIJ A;  3HU1 A;  5BR8 M;  1D6E C;  2CHQ A;  3GO8 A;  1BXT A;  1SXJ D;  2L1A A;  3SAV A;  1DGF A;  1W5S A;  5H92 C;  1H6U A;  1IBX B;  3GPU A;  2VII A;  2B76 B;  1VZ8 A;  1JWB D;  1T5X D;  1V1O A;  5EJC A;  4GKJ M;  5LMU M;  2HWK A;  1IN8 A;  1JWM D;  2WXP A;  3AOG A;  1I4H A;  1IY1 A;  2KW0 A;  3TSS A;  1L1T A;  3AKZ A;  2DBY A;  2W55 A;  1JR3 D;  1IGC A;  2PLP A;  4ZPX A;  3GPX A;  4Z6Y A;  1SBB B;  3LB8 C;  2KEB A;  1L1Z A;  1IBL M;  3O65 A;  5AUI A;  4PDI A;  2HHH M;  2SAK A;  1XCT L;  5ITR A;  3U61 A;  2V1C A;  4IBF A;  3FD9 A;  1SXT A;  4RGT A;  1K3X A;  1DGB A;  4G4O A;  1ESF A;  4ZYS A;  4HXD B;  1ENF A;  4DQO C;  1UWX A;  4LRT A;  3KP0 E;  4DUZ M;  2GB1 A;  1TH2 A;  3PHW A;  1HZ5 A;  1TKE A;  1LO5 D;  3GLI B;  4DR1 M;  4MB7 A;  4RF0 A;  2I38 A;  3SMP A;  2JRI A;  1YN4 A;  3LQR A;  4JI3 M;  3IAS 1;  1F2R I;  1QOA A;  1E9M A;  4GDK B;  3Q8A A;  1FRR A;  3SC3 A;  3B2F A;  2DWN A;  4US9 A;  1Q3B A;  3C58 A;  1N78 A;  1KTK A;  1LV7 A;  2I7P A;  5BMG A;  1ZXI A;  4QHT A;  5DNY A;  4DV0 M;  4HLQ A;  3PZ8 A;  1UWM A;  1ZOY B;  5F3W A;  2JYT A;  3KVW A;  2MJ3 A;  4NSR A;  4DXG A;  4FCV A;  1L2C A;  1YSY A;  4WUR A;  1ZQ9 A;  2DWL A;  1L6U A;  2UUC M;  3U6M A;  1C4C A;  3PZ7 A;  5EE0 A;  3ZQ4 A;  1Q3C A;  2F5O A;  3PFI A;  4JI5 M;  2JU6 X;  1K52 A;  1SB3 C;  4JI1 M;  2N9K A;  4DR2 M;  1VJK A;  4MGZ E;  1GB4 A;  4BOS A;  2JTC A;  2UXD M;  1SJH D;  4N58 A;  3UK6 A;  2EEL A;  4YSY B;  1XLQ A;  2Q2E B;  1G8P A;  1J7B A;  2V3N A;  2BS3 B;  3H8H A;  1R7R A;  2PIA A;  4NSO B;  5ITX E;  2GRI A;  2QPA A;  4MAC A;  5FTK A;  1V1P B;  2WXN A;  1K50 A;  4XWW A;  4MGK E;  2XGN A;  2G9H D;  1MX0 A;  4RF1 A;  3SHG B;  3T1H M;  3AEG B;  4BOZ A;  3FTF A;  4JI7 M;  4WW0 A;  1R2Y A;  1YQ4 B;  2CJO A;  5I4D A;  1N33 M;  2OHF A;  4OHJ A;  4W5W A;  5EP1 A;  1DGJ A;  4HRS A;  3VR9 B;  2Y5C A;  2ZAN A;  4IIW A;  5FTN A;  4OVZ A;  4GDL B;  3LXF A;  3L2A A;  3T38 A;  1NYR A;  3V3X A;  4M9Z A;  2Q5W D;  2V1U A;  1E0Z A;  5KPR A;  1QOF A;  1IUE A;  1SXJ E;  3GLI A;  3AEE B;  3W5U B;  2UU9 M;  1WWT A;  1QOG A;  5KQ8 A;  1RM6 C;  1ET9 A;  1I4X A;  2LXE A;  3ZYY X;  4LF8 M;  4FW9 A;  4DR5 M;  5C1B A;  4G4N A;  1FJG M;  3FKE A;  4A3V B;  1OFH A;  2K9X A;  2VQF M;  4JX1 C;  3BII D;  2BB5 A;  2YQZ A;  4PD2 A;  4LF5 M;  2KAJ A;  2M19 A;  2PVG C;  2Z84 A;  3L25 A;  2WXL A;  1QIL A;  4IP3 A;  2HKJ A;  3PHU A;  4FD2 A;  1N36 M;  2RGH A;  1KH0 A;  1ZP0 B;  5EE1 A;  1PJJ A;  2BTW A;  4YT0 B;  5FLX S;  1XLP A;  2A5Y B;  1D5M C;  4JXJ A;  3N9Y C;  1G41 A;  5H8Y E;  3IAM 1;  1K51 A;  2WNM A;  4AG5 A;  2IJ0 A;  2Y21 A;  4IKG A;  1B9R A;  3AE2 B;  1FXI A;  4D80 A;  2K47 A;  2ERC A;  3ZJV A;  3I4Y A;  4XZX A;  3RGS A;  2LJI A;  5D7G A;  3KLS X;  2LNH C;  3P42 A;  3W30 A;  4DUY M;  3CF2 A;  3KW6 A;  3PSE A;  1V1P A;  4NAW B;  2QP9 X;  4EE2 A;  4US8 A;  1YZB A;  3TUO A;  4KGS A;  3DWM A;  1HNZ M;  1E32 A;  3VDP A;  4HRO A;  1FNV A;  3U6C A;  3U5Z A;  3MP9 A;  3JR5 A;  1P7F A;  3DZD A;  1ZPS A;  1Z5A A;  2XEP A;  1D5Z C;  1MVK A;  3AOE C;  3IG8 A;  3W31 A;  4JI2 M;  1XLO A;  2YEP B;  2LHE A;  3KOX E;  3L28 A;  3CF0 A;  1YNT E;  4OVZ B;  3PT2 A;  3AE4 B;  2R62 A;  2C5R A;  1F0Z A;  3TWK A;  1X37 A;  1JML A;  3AE1 B;  1IBX A;  3PXG A;  2L6O A;  4BOP A;  3J81 S;  2D7G A;  3V05 A;  1C9F A;  2XFS A;  3U4E G;  4C56 C;  4NRW A;  2IGD A;  1IBK M;  2QIL A;  3SAR A;  4D2K A;  4IBK A;  5GKN A;  1HA5 A;  1E9S A;  3RPF C;  1FNW A;  3O13 A;  1KLU D;  2DOS A;  3GPP A;  5EXS A;  2WXK A;  3L26 A;  2KRU A;  4LJ4 A;  3HWS A;  1DOY A;  1XO3 A;  2KDM A;  2C9C A;  2E6X A;  3MK6 A;  2L52 A;  3Q8F A;  1NY5 A;  2PMV A;  3FTD A;  2XN9 C;  3OQC A;  2HL7 A;  4KKI A;  1WGK A;  2EKI A;  3NUH B;  3HRD D;  2ONQ A;  1DO2 A;  1T3T A;  3SEB A;  4USA A;  5FTL A;  1C77 A;  3GRY A;  4IBD A;  2OQ4 A;  4AI6 A;  1QAQ A;  2VZK D;  4NOO B;  1Q39 A;  4LJ8 A;  2HDE A;  1SF0 A;  4KOD A;  3P1M A;  4IOI E;  2W3R A;  4NXM M;  4MM3 B;  2WU2 B;  1G59 A;  4IUM A;  2F5N A;  2INP E;  3AE3 B;  1FEH A;  1IY2 A;  1PGB A;  3FUV A;  3QAU A;  5ITT A;  4C80 A;  2MH7 A;  1DO0 A;  5KPT A;  1D2N A;  3FTE A;  1I7H A;  1C78 A;  3TE6 A;  5KPZ A;  2RGO A;  2QBY A;  3U5Z B;  2NTT A;  2KWD A;  3HU3 A;  2QEN A;  4QOS A;  2Y0T A;  2ZW1 A;  1PGA A;  3EGR A;  1QF6 A;  3GLG A;  1Z6T A;  2J7O A;  4OZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...