4RF0A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p6522)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
318
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords ORF1ab protein
publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
total genus 78
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf0A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf0A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf0A03
4RNAA 4MM3B 5E6JA 4RF1A 4WURA 4OVZB 4REZA 3MJ5A 5KO3A 4PT5A 3MP2A 3E9SA 4M0WA 2FE8A 4OVZA 4R3DA 4OW0A 4RF0A 4P16A
chains in the Genus database with same CATH superfamily
3PT2B 4PS3A 4WJQA 4KV2A 4PDGA 4HLEA 5E6JA 3FRIA 3TIXA 2UUBM 2FYEA 1GJZA 4E74A 2PKOA 2WXNA 3U8EA 2QPAA 3I57A 1HEZE 3P5XA 3BOSA 3PLVA 5KPZA 3ZNHA 4D8BA 1NHGC 3T3OA 1AYWA 2N9PC 1QDTA 1FXTB 3M3JA 1TKEA 2Y0TA 1L0XB 4M02A 3KVWA 5ITXA 5CHFA 2JT4B 2BU3A 4L15A 2NQ8C 1KTKA 3GLIB 2AWTA 2Z0EB 3JSVA 1I4HA 3U6LA 3EFUA 4RNAA 4X6HA 4ZRIA 1K51A 2XU4A 3W30A 3NZSA 1GLOA 3Q3OC 2GI9A 1UNSA 1PVJA 2W55A 3DVGY 3APFA 4DWFA 1WGLA 2ON8A 4EZJA 5EE3A 3CMMB 3GLGA 1SXJB 2XZFA 4JLCA 4C80A 2JUOA 1G6JA 3H8CA 2LD9A 1QQRA 1IQPA 4RGNA 3U7DA 1IN8A 1ITOA 2Z4RA 3GLHA 3HGIA 1OQYA 3D8LA 4CIZA 3IOQA 3CF0A 3ECIA 4HJGE 1WI0A 2F4VM 4P1BC 1PM5A 3IFWB 2J7OA 2N9XA 1HE8A 3GQ3A 2OEDA 4BB9A 4YL8A 3CF6E 1IXRC 1BQIA 4KLBA 2VH1A 3GO8A 1MX0A 2WHIA 3BVGA 4QH6A 3SU8X 2Y5BB 1HR0M 2FQ9A 1MHWA 5F02A 2AS8A 4AKGA 2HCBA 1HNZM 5AEKB 4GIPA 1V33A 4TQ0A 1LV7A 3A1QB 2NBWB 1JRUA 2GBJA 1BVSA 1GJSA 2LVPC 4B0EA 5AUIA 4QRXA 3DBRI 4F8CB 2JVCA 1ACCA 4DV3M 3S3RA 1XCQL 1V5TA 1VQ1A 4YVAA 1JR3E 2IDYA 1U9VA 3DHHC 2PVOD 1MEMA 4FA6A 2C5RA 3GRYA 2MH7A 4HKQA 2JY5A 4AKHA 2CWBA 3HHZA 1ISNA 2WGSA 4WIPA 1NB5A 4IJFA 1XC8A 3ZUNA 1YJIA 2WYQA 4DV5M 1YE9A 1RFKA 2NBVB 4WWNA 5FTKA 2ZNVC 1SP4B 2DC8A 4G3OA 4LLGM 4NZLB 1Y56A 2KRUA 5D6JB 2KZRA 4YYUA 4YT0B 1V1OA 5GKNA 2R9FA 2V4IB 3M63B 1JWAD 3V60A 4GDLB 3RNEC 1WGYA 4PI3A 3WCQA 3WXEA 4JI0M 1CV8A 3DVNV 1SE4A 4DV0M 3F92A 2OZ2A 3PSEA 1Z6TA 2B1NA 3T3NA 1N62A 3HIZA 1MN3A 2KNVA 4GU2A 2OQ4A 1DGHB 3K9OA 1IY1A 3NS8A 1PJIA 4D8IA 1EO6A 2CHVA 3U6QA 4R7GA 5EXXA 1NPZA 3N20C 5KHQA 1WGGA 4IJEA 5FSWA 4B7FA 1UD7A 3IEJA 3ZCBB 3ZH9B 4DQOC 1KFUL 1DEUA 4IBJA 2IGHA 3NJTA 3DVGX 4E3CA 1CVZA 1ZPSA 4CO7A 1GECE 1PE6A 3PFIA 8PCHA 3HU1A 2KN4A 2LXCA 2K3UA 3N1YC 4B95A 3IG5A 4XUIA 1BUIC 4IW0A 4B7GA 2RKOA 4NC6A 2NBUA 4KZCA 3RNCC 2MP2A 4CDEB 1K82A 5BPVA 3GLIE 4JI5M 3H7PA 2INPE 2CHXA 1LFDA 1K3WA 2ONQA 2KXEA 4IIWA 2HTHA 3L13A 1SGHA 1V1PB 2DYMA 5ITUA 3R7RA 2LNHC 4DV4M 2GQFA 3GLFB 4C00A 2LVNC 3AOEA 4KODA 2YEPB 1V80A 3BINA 1MVKA 2WSEF 3K9PB 2W3SA 1V2YA 3A42A 3LQQA 1VZ6A 1YQBA 3OVXA 4FCTA 2KAJA 1G3IA 1WJ4A 2KDBA 3HVZA 4CGYB 2DZIA 4D2KA 3AU4A 3GE3C 2VIIA 3PNRA 1L4ZB 4LF7M 3HJ8A 3C9EA 4QRVA 1IBMM 4A8XC 4DR6M 3AE3B 2FCSA 1D5XC 2D3AA 3DZDA 3GZNI 3N1ZC 3UINB 3GE8C 4HRSA 5BMGA 4N4ZA 2P5TA 2R6FA 3I01M 3GQ5A 3B1LX 4KSKC 2GOWA 1QT9A 3FILB 1EWCA 3NOBA 1HQCA 3EECA 3TJPA 4ZHOA 1PPNA 3RD2A 4HDQA 1VR9A 7PCKA 1MG8A 3T15A 2ZPYA 4PYZA 2H1RA 4DV6M 4NXNM 4WQMA 1XCTL 2BQQA 4EFOA 5I4DA 2KNZA 2N1VA 2K6BA 1F52A 1HZ6A 1L6UA 4OVVA 2GRIA 3SC3A 2INNE 1ENFA 3KOYE 3RGPA 2NQAA 1FRDA 5H8YE 2MBOA 3FUXA 3QA8A 3KOWE 2D2QA 1FJGM 3DWGC 3BVZA 3KFUG 3LCVB 1G41A 2G6DA 4M8MA 1T0RC 4JI8M 3FUUA 4GC9A 4ZOHC 1H4RA 1Z59A 1NENB 4LDTD 2KJHB 2R18A 2BTEA 5L95C 1IXSB 1JWUD 3LVVA 3BBAA 2Q2EB 3W0FA 1ZDVA 4TV3A 2XN9C 3CWIA 2CHZA 1IM2A 2ZNVB 1KM7A 3O0UA 5ITXE 4WH4A 3QYBA 3SATA 3ZTDA 2F5SA 1STFE 4BOSA 1SE9A 2L52A 5K16A 3TEZA 4CISA 3HU3A 4G54A 1L2BA 1D5MC 2KWVB 4FD2A 3K2LA 2HD5A 4UN2B 5EQTA 2L8JA 2A4ZA 3GLGE 4JWSC 3KWZA 3AXCA 1WJ7A 4G3XB 4GUAA 1K53A 2RGHA 4DUYM 1Q3BA 2DAKA 2C7HA 5CTRC 1WX9A 4L6V6 1XLOA 2KYWA 3IG3A 2JY6B 1ZP0B 2IJ0A 1LTMA 1SJHD 4RY2A 2M5ZA 1C4AA 2JQFR 1EWOA 1WFYA 2GBMA 1UM8A 4B6WA 3VHTC 2EKKA 3TPZA 4ITQA 3Q8FA 1AU2A 3GRVA 3UF8A 1ZKHA 4NOOB 2W54A 1FNVA 5FTMA 1KFYB 4MACA 1NO1A 4NQKE 1PADA 4F1SA 3TSSA 4ZHPA 2BF8B 1WGKA 1WRDB 3VRBB 2DI0A 5DPSA 4ZDVA 3ZRCA 3GLFE 2F5PA 3DBHI 1F2RI 3ZYYX 1QANA 3J81S 1Q1OA 2A5UA 2B76B 3EHVA 3QAQA 4N59A 2FRQA 3T38A 1FIQA 1WX8A 2PADA 4FIPA 2FOIC 3P4PB 2HHHM 3Q69A 3TL5A 2KTRA 3NWLA 7CATA 2LGSA 3IUTA 2KO3A 3QJZA 2BNKA 3JW0X 3L28A 2GFOA 2DCDA 4BS6A 2X8XX 3VRAB 2DX5B 1QVRA 2R46A 2V3SA 2J0JA 1WHCA 4RM8A 1EWYC 3ERVA 1KYIA 4IUMB 2IPKD 3ZO5B 3VFKA 3LYYA 4GB9A 4KGSA 4L4UA 2UUCM 2LHCA 4CHTB 1E5WA 2GMIC 2MX2A 3J27B 5FR3A 1VEKA 4LF4M 4ITKA 4US9A 3PHXB 3NVWA 1OTRA 4S17A 3WIMA 4GIVA 3W1SA 4FWDA 3HU2A 1BGOA 2LTUA 1U9XA 1XLQA 5PADA 1J7CA 4FK5A 1JB0F 1NYQA 1IPGA 3P63A 2KDLA 3SAUA 2UXDM 1C79A 3FYCA 3V6EA 2IZVB 3TQSA 5GXGB 3SEBA 2LGIA 4BKTA 1OIZA 5BYRA 1FFVA 1YQ4B 2KC1A 3T1YM 2IO3B 1NY5A 2VQFM 3RZWC 1I42A 3APCA 3UMMA 3OAWA 3T6PA 3UI3A 3H7SA 1SSNA 1C3TA 1LXDA 2ZJDA 3AE4B 2D07B 4IM3A 1RU3A 2JZ1A 2L0TA 2ZM6M 2LGYA 2QJLA 4YSYB 2R4EA 1H8CA 4AKIA 4IDIA 4YWGG 2LFIA 1N6ZA 4NAWA 4PK1A 3KVFB 1TT5B 4AQ7A 4PD2A 1VDDA 1EF7A 2MW5A 3AULA 4Q8GA 3W67A 2AX5A 3Q3MC 3K1JA 1X1MA 1QOBA 1XMOM 1AWDA 3E1ZB 2FNAA 1YMHE 4MZSA 1I4GA 2DYBA 5D7GA 2DCCA 3FTEA 2KQ4X 1GPXA 2JU6X 5CHWA 3MHVC 3DF0A 3FD9A 1KF6B 2AYOA 1N34M 3FUTA 3I5JC 3VUWA 1R6BX 2VQEM 3P42A 4W9HA 1BY8A 4ZPXA 2EMTA 2C60A 1T0YA 1Z5BA 4WP2A 2QP9X 1QOFA 2G4DB 3B08A 5G2NA 1OIPA 3HHIA 3RN9C 4CDFB 2M4NA 4HCPB 2NCNA 2BGFA 3X23A 2DNAA 2JUJA 5IA7A 1K3XA 2SAKA 2ZCBA 2QENA 1PGYA 3FKEA 1NSFA 3AB5A 1P7EA 3AEGB 1WR1A 3HJQA 4XZXA 1MIRA 4I6PA 2M56B 5BO4B 2MQJA 1WF9A 4LRSA 3RNFC 2DCAA 1T43A 1PFDA 1WM2A 3R8BA 5ITYA 3W0LB 2FO5A 1ZXIA 2FBWB 2HWJA 2MSED 1J0GA 1I4PA 1DO0A 1U9QX 2B1MA 5AZGA 1AU4A 2K1FA 4YYVA 5FLXS 1SIFA 2NTTA 1T6BX 3DVNU 5KQDA 3KOXE 4OVZA 2C0YA 2NVUI 2P7UA 4KGRA 2VHFA 3AN1A 4DXAB 1THEA 3NHEA 1RLFA 4B7HA 3LMMA 2AHMA 4KLNA 4DR4M 1ET6A 3RGSA 1H6UA 1TDZA 2XBBC 3TWKA 2K6QA 2V0GA 4OZBA 4C56C 2CU3A 4KKIA 1WE7A 3Q8XA 2V6ZM 4GHAA 1PCIA 1HA5A 4NSRA 1JW9D 2WU5B 3P4SB 3DDCB 1MDWA 5KO3A 2QMTA 2JXNA 1WXSA 2MLBA 3VH3B 3VTVA 2MBQA 1M6DA 1YX6B 3U6OA 4LNOA 3ZRFA 5CHTA 4LTUA 3USVA 2YR0A 2XK5B 3Q3FA 2JXTA 2BB6A 4M9ZA 2XEPA 1TGUA 2GBNA 4JQWC 3SD5A 4IP3A 5DPWA 2DZOB 3FC4A 4JE3B 4W9CA 1EFUB 2MR9A 5EXPA 1X37A 2WSCF 3QC8B 2OHFA 2BKFA 1EWMA 2VDBB 2LGXA 3H89A 3DFZA 4GDKA 5D94A 1IGDA 2EELA 2JNHA 2LUEA 5H92C 2JA2A 3PRPB 1DOIA 1G8PA 4A6QA 1B1ZA 2J0KA 2KLGA 2ZCCA 3R66C 4I8OA 4LJ5A 4AI6A 3SFZA 2PVGC 2JRIB 3AEEB 2EKIA 1T0SC 5KPTA 2CB5A 1XXHA 3B7ZA 2H89B 2M1MA 3W68A 4MSQB 1TH4A 3MMPA 5G5HA 2X8AA 1WGDA 1CJLA 3V6CB 3ZNGC 1D0LA 3HHMA 1WGNA 4NSOB 1TGZB 2PMVA 3HWNA 4AXMA 1UGMA 1CPJA 1WZ0A 1DV0A 2K0PA 4JV5M 1XNRM 1AIPC 1FM0D 4MJSB 4B3SM 3N3KB 1UWXA 2DWNA 2RSUA 2RMMA 2WLBA 3AI8A 1TY0A 4LGMA 2N7EA 1V49A 1AU3A 3R2TA 4DMXA 3F75A 1LGRA 1LO5D 2L83A 2I7NA 1PGXA 2IO1B 1TDHA 3C58A 4AUQC 3H8HA 5KHOA 3A9JB 2Z0DB 1OFFA 2NQDB 5IN7A 3U8ZA 4HL4A 1PIPA 3E46A 2DHZA 4AG6A 1TLOA 3CTWB 2CHGA 1QAMA 3NZUA 4C7ZA 2JWSA 2KNAA 1QOAA 1L2NA 2L00B 3C3DA 2BKRB 3KW9A 1V6EA 3ZJUA 3B21A 1R2ZA 4FJCA 3VDUA 1WGHA 2FUG1 2K22A 2RD0A 3K8ZA 1KLVA 4BPVA 2AUXA 2JWZA 2L76A 3MC8A 4LJPB 2KD0A 3U30A 2G8EA 2LZ6A 3PVSA 4YYSA 2KK8A 3NRZA 1G59A 2VHSA 3WXGA 4LFAM 5JZEB 2KVRA 1GNUA 2WXRA 3D8BA 3OF9A 5EE0A 1IBKM 1JQPA 2OOBB 2BYEA 4IBKA 1E6EB 1OJLA 4IG7B 2KX0A 3DBLI 4DHJB 1G71A 3B79A 4A9AA 1V5OA 3RULA 2HKJA 3MHZA 4ZRPA 5TSSA 5EE1A 2WXHA 1FFUA 4EZLA 4RH6A 2R6NA 5EP2A 3SAWA 4D8EA 3P5WA 3URYA 4LJ7A 3AE1B 1VRAB 3ENEA 3SFEB 1QOLA 3PREA 1J8CA 2FAZA 5DPRA 2XU3A 3DOAA 1F29A 3L16A 2R61A 5DCNA 3IT4B 4X66M 3L4PA 2GLSA 2G7YA 3EGRA 5LXHA 3U60A 1VZ8A 3AJIB 2LXAA 2NTSA 4EOYA 4MELA 3AU5A 3VKGA 3TEWA 4XGAB 4L23A 2AUZA 4BS5A 2WWZA 3U4EG 2MEKA 1PPOA 3BB7A 4YXDB 5E6NA 4PP1A 4LG2A 3T8MA 4EKUA 3CF2A 2G3QB 2M0XA 2MA9B 3BZDB 3KSEA 2NPTA 3BY4A 4MH8A 3B0AA 2FCNA 1GMYA 3AFHA 4LJ6A 2M60A 3J9CA 3IHPA 1HUCB 3ML9A 2D3GA 3PHWA 2LGDA 1YT7A 1QKZA 4ARCA 2MROB 1JQ4A 3WXFA 4II2B 2PW9A 2KTFA 4IWPA 2D7HA 4DR1M 2KVZA 3EUB2 3HK0A 1NJFA 4QOSA 2KWCA 2BB5A 1V8CA 4ZTBA 1E8ZA 4JX1C 3SARA 2KW0A 4M0DA 2UYZB 1DYQA 3IAM1 4G6ZA 4YY3M 4M01A 3A9KA 2K0BX 3B7QA 2FCMA 1AN8A 1OEYA 3E4RA 1C1YB 3IT6B 1KHPA 3A46A 2ZW0A 1ZMUA 1ET9A 1R4MI 3X0WA 3O1GA 2KDEB 3QJ3A 2CFOA 5DYIA 3KWBX 2LH0A 4KVGB 1KOTA 1MJDA 4LJAA 2VF7A 1Y8RC 5JH3A 1MI0A 4LRTA 1EIJA 1PUTA 4K81A 3HZJA 2N9LA 4KHPM 4YTMB 1SBBB 3B2GA 4X64M 1BMLC 4LNNA 2O2VA 1WXVA 2DJFB 1CSBB 1P3QQ 3AECB 1P98A 1TTNA 2ZAOA 4NXMM 3PDFA 1AIMA 1UKFA 2DWZB 4ANWA 3C0RA 3MC9A 1WYWB 3U52E 1WJUA 3C3EA 2V3PA 1Y8GA 4DR2M 4DR7M 2VZKD 4WAAA 2UZJA 1VEGA 1NI3A 4II3B 2O6VD 2DLBA 1EE8A 2E5LM 1TS2A 4KSLC 1ORYB 3WAMA 3ZUAA 3A45A 9PAPA 2ZTCA 1SIJA 3ZNHB 2OOAA 2IY1B 2LHDA 2HTME 3V62A 3S2AA 3L08A 4W9LA 3WHKA 1E9RA 2AQ3B 1CS8A 2L09A 3TMPA 3AOEC 1N63A 3B7NA 4Q7JA 1M4VA 3R9XB 4G4RA 1MFWA 1I94M 1YJJA 3JSVB 5IOIA 1C1KA 3DPDA 3SHGB 3VFDA 5EDSA 5IWAM 3KWVA 5CVOB 2ZVOA 4II7A 3VDZA 3B89A 4DV1M 2INDC 3KW6A 2D7GA 4OZAA 4LF5M 4FCWA 3TUOA 1HNWM 4JIOU 3ZQJA 3GLGB 4IBIA 5JH5C 3AEFB 4US8A 1E8XA 2HDEA 3PZ8A 4WQOB 1N77A 4BSQA 3AOGA 1JROA 4ANXA 4MH0E 3VUYA 2L4FA 2RRUA 4AZFA 2WXPA 3OF8A 1L8QA 2MJEA 3GLHB 2CJNA 3ZC7B 1T0QC 4B3MM 2QHOA 1Q39A 1XXHE 3GP1A 4I6NB 1GO5A 2RPVA 4W9JA 3KP0E 2HH5A 1NV8A 5T8IA 1HTOA 2Y21A 3U6SA 4WWMA 1KHQA 2XFSA 2WDTB 1L5PA 1KFXL 4HPLB 2JZPA 1E9MA 1QZMA 2DENA 4CYEA 1IP9A 2OULA 4IWOA 1OQRA 1QQWA 2V1CA 1ESFA 2K25A 5DYGA 3LJ3A 1IY2A 1J5EM 2DXIA 3I06A 2JZ0A 3DBRB 5LXIB 2AIMA 1D0KA 2G8JA 2Y0QA 1T3QA 3PZ7A 1IXZA 1HXYD 4JPSA 1VEJA 2MRPA 4I07A 4XK8F 2WBFX 2A5YB 2KKCA 2O01F 3KKUA 2E00A 2J0MA 3WA0A 3SYKA 2VH2A 4MEMA 1PXVA 3HKPA 1U9WA 3RVVA 1OAIA 1N33M 5DPTA 3RNVA 3VK8A 3P4QB 1IN6A 2L0FA 3TWMA 4QNRA 2R0IA 4DMYA 4A55A 3L29A 2KANA 1JR3D 2LVAA 1LM8B 3OJ4B 3M95A 3VVWB 3L54A 4LCDE 1N75A 2ATOA 6PADA 1OFIA 2B3TA 4FN2A 1TL9A 4BOSC 2DZLA 2J42A 3PHUA 4W5WA 3UQBA 4BOZA 1XLNA 3TCAA 2R45A 3U61A 3N1XC 5EGWA 2YJCA 2DWQA 2I38A 5CX3A 2XU5A 3PSEB 1TF0B 5BYSA 3JVZX 4HK2A 4DXFA 2F7DA 3GPYA 2KFKA 3K9OB 5HFYA 1WJNA 3NG0A 1TYGB 2L6OA 4HVBA 3Q2AC 4P7IA 2CEAA 2YFQA 2P86A 2WZJA 4HPMB 3KYDD 4HKZE 5EJCA 2CUZA 2LXEA 1L2CA 3AEDB 1N5WA 3VR8B 3VXWA 3HWSA 2UXBM 5LMUM 3QIJA 4LGYA 1OFHA 2F5QA 3FRHA 1T5XD 4DR3M 4PYUA 1Q5WB 4P6VF 4QAYA 4WAFA 2FUDA 4L16A 2JWUA 3FAHA 4F7ZA 5EP4A 1PJJA 1ZGUB 1C9FA 2YJ8A 2WU2B 4XYCA 1A5RA 2DNFA 1DGBA 1DGGA 4MGKE 1F2RC 1M94A 4G0NB 5BYQA 4N8WA 3HX3A 1I7HA 4RF1A 4G4QA 4B3TM 1J19A 2MP2B 4K1RB 2BWFA 2MJDA 2I2YA 3H7PB 4NJCA 2PREA 4LJ4A 3BC3A 4I5SA 5LMNM 1FEHA 4ZRKA 2C7MB 2RDHA 2DAGA 4RF0A 3VK7A 3I4YA 3AE6B 3U2SC 3H9DA 2KACA 2LJ5A 5E6OA 5BMHA 3O65A 4NNJB 1P0RA 3T9LA 3GLHE 3GRUA 2BDZA 5CHVA 2QBYA 5C3JB 4KZ0A 1QF6A 1E8YA 1IBLM 3PTFC 4DR5M 3ZDTA 1T6OA 1AECA 5EF4A 1SXJD 3GZNB 2V9HA 3QQ8B 2N7DA 3W1SC 4RFBA 3FTCA 4W9FA 1PJQA 4PT5A 1SJED 1DGJA 4NJ7A 1IN7A 1EM7A 3ZXRA 3K92A 1DGFA 4K7CA 4LJOB 1XQQA 4F2LA 1MEGA 3SBJA 1IGCA 1F4IA 1XKGA 2AL6A 2KFJA 3H4MA 2SEBD 1UH6A 3PRMA 4IM2A 3MTNA 3N3GA 2APLA 2EA0A 3I3TA 1Q02A 3L25A 1R5LA 1AYUA 4GXBA 1L6VA 1VCBA 2L2DA 3PBHA 2KN5A 1L0YB 1SXTA 3SHFA 2J4XA 4BBNF 1G4AE 4CDCB 1YN3A 4J3OD 4X62M 2L7IA 1ME4A 2KZSA 4ANRA 3PRZA 2ACTA 1R4NI 2VRRB 1NL6A 4JL9A 2KRKA 4I6LB 3F5VA 1L2DA 1WMHA 1E9SA 4A3PA 4I81A 1HNXM 1YIWA 1NLJA 3PZDA 1WR6E 3CGWA 4WWOA 4Q2JA 2WQYB 2IBIA 3BWKA 1EF5A 2ZTDA 2AL3A 2QC8A 4C4VA 2NQGA 2GB1A 3N32A 2OPFA 4G50A 4MM3A 2DZMA 1HQRD 4XZ4A 1D2NA 1ZXHA 2QILA 1IBXA 3OJ3A 5AZFA 5EP1A 2RPQA 4J6IA 4JI1M 1ROEA 2I1JA 2HD5B 4YTNB 5KQ8A 2PJHA 3Q6BA 2BDLA 3A4RA 1TZOA 3IG8A 4W4UA 2MBEA 3V76A 2FIFA 2WXJA 1GJTA 2K5PA 2O6VA 5ITRA 3VUXA 4XBOA 2BTWA 2DVWB 4W9EA 4B3RM 1AARA 2KWDA 4I05A 1EU3A 4QOZC 2XSZD 2GHUA 1QILA 3OVZA 1TY2A 4FHKA 4HXDA 4URKA 3KOZE 3U6DA 1RWSA 4JGHB 4HEOA 4N6EB 2WXLA 2DAIA 1V9JA 3HM3A 2PTLA 1UBIA 4GLSC 3U5ZA 3SR6A 1JWBD 2D3BA 3UQAA 3QYEA 2C9CA 2WSFF 1AW7A 2WP9B 2FTDA 5HG2A 1W5TA 4JI2M 2N9KA 4EIWA 3IV2A 1TKYA 4NY0A 3DBHB 1D6EC 3BVMA 2J53A 3W31A 3KSXA 2FCQA 3VR9B 3MJWA 1BP4A 1B9RA 3N4CA 1MS6A 1UFZA 1WXQA 1IN5A 2ZEQA 3KUCB 4WA6A 1TS4A 4LZJA 4B08A 2CV1A 3KLSX 5J94A 1FXIA 2V1YA 4RCOA 3ZXVA 4BVUC 4ANUA 1YNTE 2PE9A 1WX7A 2XNAC 2G45B 4RGOS 2KTRB 5TR5A 4AJWA 1PBHA 1E7PB 4TSSA 2L4EA 4OX9M 3Q8BA 2HE7A 2KC2A 4IOIE 2Z8YM 2AQ2B 4KIKA 4I04A 3RPFC 3GPPA 1YQ3B 1YN4A 3PVLA 3V61A 3K24A 3L0WB 1N78A 3TEXA 1IY0A 4MGHA 2UWQA 2PPHA 4Y28F 4ICUA 3CSTA 3NVZA 2J7NA 4W5BA 3SMPA 3I63C 1ZOYB 2K8CA 3P1MA 2DCBA 4OELA 1QAOA 4GRIA 3EFCA 2JQRB 5EZQA 5BR8M 1NDDA 3FUWA 4DK5A 4YV8A 2GNOA 1OTRB 3E56A 2WDRB 4LZZA 3GS2A 1S4VA 3U6MA 3BWUD 1WXAA 3HM6X 2DYOA 1S3SA 1JALA 2J5YA 4FADA 2XGNA 1OGWA 3LDZE 2HJ8A 4IBCA 3KYCD 3V6EB 1TJEA 3W2DA 1PGAA 4DBGA 1KJTA 4DV7M 1A70A 3ZNZB 4TMAB 3M62B 1XXGA 4JWUC 2DZNB 1PGBA 5F3WA 4LFCM 2JF5A 3PV1A 5KPRA 4MT5A 4JXJA 1JR3A 1KLUD 4X65M 4PDIA 3BXWA 2DZZA 3HD3A 2LVOA 1ZUD2 1J7BA 4XWWA 2XLJA 3FYDA 2ZBKB 2DZJA 4HEA1 1P3QU 1WM3A 5L8RF 4LF6M 2R2QA 3IECA 5DNYA 1QOGA 1CJEA 4K7WA 4NAWB 4W9KA 4WJPA 3RNBC 3KXEC 1Z5AA 3RNGC 4K3BA 2QNJA 1Q6KA 1J7KA 4G4NA 3GB1A 2KJRA 2UU7A 4K0KM 5HI1A 2YEPF 4M0WA 2LWPA 3DA1A 2MBBB 2R65A 1N32M 2AYOB 2C99A 5G5GA 3AM9A 2KDMA 2FNJB 8CATA 2DHRA 3KP1E 1UF0A 1VG5A 2C5LC 5E26A 1NEKB 3B74A 2WXMA 5C18A 3M0EA 3IMAA 1S3SG 4BOPA 3PNVA 3IAS1 1XHBA 5IREB 3M99A 5H37D 4ANVA 1VSNA 3PT2A 1WR1B 4LF8M 3HUIA 2Q5WD 2QIEB 4GMQA 3M7GA 1V86A 4S0RA 3NY5A 4R71A 4GHLA 2W3RA 3BOWA 2WXIA 1GC7A 1X9YA 1OQQA 4OVZB 1MU5A 3QAUA 2IYDB 5CVMA 5EE9A 2IO0B 1YZBA 3SHQA 3NHEB 2L3ZA 1FPYA 2BWEA 3GLIA 4DDGD 2EJSA 2LI5A 3Q3NC 1P1AA 4L78A 3NVYA 1F9JA 4L1BA 1MJGM 4CQNA 1IN4A 4CZWA 1VJKA 2MWSB 2IPPB 4LJ9A 1CQDA 3RFWA 4G4OA 5EXSA 3ZW3A 1SXJA 2BS3B 3L10B 4YYWA 3LVWA 1N36M 1Z5CA 1I4WA 2V1UA 1VZ7A 4XDDA 4GN1A 3W5UB 1WSPA 3OG5A 1FMAD 2K47A 1N61A 1A5TA 4RKXA 4NAMA 3ZNID 3HHYA 3IHPC 1XLPA 3B9JA 2LBCA 4PS8A 2QQ8A 1DOYA 4MSXA 4YYQA 4AWJA 1CK1A 4KDIC 1RRBA 1ZDXA 2CIOA 2C98A 3QX1A 4GDKB 4K3CA 4BKGA 2ARYA 1WJ6A 2UXCM 4TQ1A 2Y5BA 1MHXA 3OTOM 2C7NB 2L05A 3AEAB 1GG3A 1GVNA 2TSSA 3WANA 3A1QA 4BKSD 1QUSA 4GITA 3IFUA 4BFRA 1TKGA 1Q0WB 1XXHB 2ERCA 1PJTA 1NVID 1VJVA 2DZYA 3MP2A 3VTWA 2KHWB 4QHTA 2D3CA 4IBGA 1YD8U 2KDIA 4IKGA 2HHNA 4LDTB 2H88B 3I4VA 1GCBA 1PYWD 4EUTA 4GOCA 5JHAA 2KZUA 2L7RA 4QRGA 4OU7A 2QEJC 1CMXB 5FPWA 3J2PB 1NNUC 2FFJA 2C9WB 1FNWA 1QAQA 1Z2MA 5BMIA 2CP8A 2ASQA 1L7YA 2AU1A 1R7SA 5FK9C 1UELA 4LNIA 4B9KA 1RAXA 2IY0B 3A33B 2O6XA 4GH9A 2DC7A 3A98B 3M6AA 1E90A 4MZOA 1FH0A 4ZRQA 4GDLA 3RNAC 3WAPA 1JWSD 2QSFX 2XF3A 3PNYA 2CKHB 2H7JA 5IZ7D 3UJNA 4TUWA 3RVWA 4KO8A 4W9DA 1ZE3D 2XSZA 1DGHA 3ZJVA 4BLCA 2YJBA 1HTQA 3C19A 2JZZA 4MI7A 5AZHA 3HHWA 1YJ1A 1ME3A 4REZA 4AQYM 3NZ3A 2J52A 3AE2B 4GGQA 4FXCA 4IWQA 5JI2E 1EWLA 2FH0A 5ITTA 1FRRA 3SDLC 1VLBA 3H1UA 1TIFA 5D3IB 2H5XA 1YUBA 2ZPNA 1V34A 3UZUA 3DBLB 2MJ5B 2BWBA 2CS4A 1Q3CA 2DHYA 5EZSA 2LASA 2Y20A 4X6IA 1F77A 1TS5A 4KX6B 1QMYA 4GC5A 2D5GA 1C7YA 3TRKA 1IFYA 2CV0A 1OKSA 4LJ8A 3VKHA 1LQBA 4WJNA 3EA6A 2REXA 2JXXA 2KJ6A 2OJWA 3DOWA 3OLMD 3H6SA 1EUVB 3BYYB 3KUDB 2M19A 3H4JA 4AW4A 2UUAM 5AUKA 3OQCA 3GRRA 4NPNA 4X6JA 3ZLZA 1V1PA 1WE6A 3R7QA 5G55A 4HLQA 3GLFA 3PW3A 3MC0B 2CR5A 4A5UA 3CIRB 3K9PA 3VDPA 2QCZA 3U60B 2ICIA 2BS4B 1CZPA 3RT3B 2KQSA 1P9DU 4MDKE 4IC7B 3DHGC 4YTPB 2Y3AA 4LNFA 2PIAA 5JHBA 3IBEA 2KDFB 3QHTA 1STEA 5FKAC 4FVMA 3C8YA 2E3TA 2BYVE 4LF9M 1NY6A 1XEEA 3R2IA 1QDRA 3L2AA 3BK2A 2NPTB 3AE8B 3BY4B 1TS3A 4GSWA 2AVWA 3QCAA 2G4SA 3DHIC 4IBBA 4DHZE 1EWPA 4FLHA 3LCUA 3PHWB 2X4AA 1WH3A 1Q10A 4RMAA 1GC6A 3LFYA 4JN6A 2VF8A 2JPHA 3FILA 1XF5L 1D5ZC 2XEWA 2NS5A 3Q8AA 5E6PA 1GB1A 1NQCA 3W9CB 1JCKB 1RM6C 2QSDA 1SE2A 3HVDA 1ZQ9A 4BOUA 2CV2A 2FT2A 3A9KB 1GOZA 4MGZE 1R4MB 2KMMA 1NBFC 2LVPA 1WWTA 2J7QC 5JXVA 3BPMA 3ETRA 1JMLA 1KFVA 1PQSA 2Y5PA 4M00A 1XNQM 1E32A 4LFBM 5EP3A 4ZRJA 3PS6A 2AQ1B 2RGOA 3KSJA 3AE9B 1ZIVA 5D3DA 4PADA 4AOFA 1SNKA 3JAMS 1MPEA 2E02A 4P6EA 3I51A 2OJRA 2KEBA 1YLAA 1SE3A 2DAFA 1GABA 3W1YA 2BWES 1C78A 1K3BB 1IXSA 1CUKA 1V92A 2O2VB 4XC2A 4USAA 4GEWA 1QZEA 2WX0A 1XD3B 4M9XA 1TR8A 1I4QA 4LNKA 1C4PA 2YJ9A 3C0RB 5LLIA 5IT9S 1C77A 2RGFA 1CQVA 1DOXA 4XR7A 2PLPA 5HHDG 2MCNB 2V4LA 2W9NA 3P5UA 2DZKA 5C1ZA 1E10A 3KS4A 1SG9A 3RUIB 4KGTA 1F2BA 3Q14C 4F1IA 4TKNA 2EMSA 2IO2B 4MSMB 5IO9A 2WDVB 2BJWA 1EU4A 1E7VA 4WJOA 3TEYA 1SXJE 4Z6YA 4NL4H 1VDLA 4GKJM 2JYTA 1F2CA 4QBBA 3RYTA 4OVUA 2J7QA 4LCBA 1MG4A 2QDFA 2BPSA 2R2OA 4ASWC 2F1GA 3KH0A 4O1NA 2JY6A 3RCZA 3VQIA 5EXTA 1DKIA 2BBCA 2CU1A 4NRWA 3TMPB 3R8FA 4YSXB 3TE6A 1A6RA 4X57B 2KX3A 4UDUC 4YSZB 3I04M 2G1EA 1D4BA 1L1ZA 3EIHA 4CJ6A 5CHVC 2Z7JA 2F5OA 3GOEA 2ZVNA 1U4AA 4DHJD 2E6XA 2BYFA 1AYFA 4JI6M 4FJYA 4BBAA 2QHOB 4IBDA 1NYRA 2M0AA 4RGTA 2MJ3A 1YALA 2FRAA 2KA6B 4FHJA 3RZFA 1XMQM 4R3DA 2DWLA 1P7FA 2NMQA 4KKJA 2YVCA 4AS1A 1NI2A 2ZZPB 5FR6A 2R9MA 4KDLB 2RDBC 1FNUA 3A4SC 2LMCA 1Z5SB 1FXAA 3B2FA 2DENB 5HKHA 3ALBA 2BVCA 3N30A 4AXLA 3GP7A 4HWIB 2HWKA 4AG5A 1KRHA 4ARIA 2XU1A 5FTLA 4CDDB 3RI7C 3B9PA 4IUMA 2N35A 2F5NA 3Q8EA 3FUVA 1F1HA 1UGJA 2Y5CA 2N1WA 4BKSA 1BT0A 5L83A 3PHXA 2E03A 4PP2E 2YQZA 2YJ2A 2CE7A 4EE2A 2ACZB 2LVQA 3FTDA 1XT9B 3J7BA 2DJGB 1CB5A 2DKLA 2I7PA 3DQVA 3U6PA 1R4GA 2MHJA 1U5IA 2K9XA 2NQIA 4HJKA 4FJZA 1DF0A 4XGIA 2KMAA 1WZ3A 4I4LA 1YN5A 2MH8A 2KWUB 1POPA 3BCNA 3K9MA 1JRPA 3GPXA 3LW5F 1TH2A 2IGDA 3BPFA 2KXJA 4RGMA 1ZMVA 4FULA 2BT6A 2GBRA 3P2BA 3THGA 2LJIA 1GLNA 2J7QB 4DXGA 1ZMWA 4BOZB 3U61B 1WRIA 3L27A 2KQ7A 3RMKC 5JA7A 3NUHB 2NR2A 4Q8HA 2D11A 3ABVB 2R9NA 2N0SB 4OEMA 4A3OA 2Y6EA 4RM9A 1SF0A 2PE6B 4FW9A 3J80S 1HZ5A 2KFKB 1MHHE 2DOSA 5CVNB 4P1CC 4HPPA 4CHKA 3L26A 3U6CA 4W9IA 2EKEC 3QT4A 3HRDD 2M17A 3ZGZA 4ZYNA 3AKZA 1J7AA 1JQJC 1VD2A 3T1HM 3O13A 3OISA 4N79A 3MHSD 3WALA 1FNNA 2QZ4A 2K9DA 4JI7M 4M9SA 2C9OA 2PEAA 4GKKM 3H6NA 3U7ZA 1ICFA 4FCVA 1HQYE 5MPOA 3PO0A 3UK6A 2HJ1A 2V3NA 3K8UA 4N58A 3J7AS 2R4JA 2XFTA 5C2TB 3VAWA 2WX1A 3APDA 1XWIA 2JX5A 2KMCA 5IAAC 4HROA 1E0ZA 3MORA 3JR4A 4H2AA 1L4DB 4WW0A 1E8WA 3QWZB 5D2MB 4FWHA 3VH4B 1DO2A 3AH7A 3GPUA 2WXFA 2WDQB 3SFDB 3UIPB 4K7UA 3AMZA 4A20A 3DWMA 4E71A 5J17A 1Y08A 2CJOA 1C4CA 4BAXA 1WIVA 2EKFA 3CBJA 4HDOA 1N5XA 2K6DB 3TWLA 4AJYB 3MTVA 1RYJA 2DAEA 1YOVB 1NNJA 2YLMA 4D81A 3NVVA 4YYRA 3DCGA 3ZQ4A 1F0ZA 4DDID 3GCBA 1BXTA 2JP7A 5DFLA 3SMSA 3WAOA 4S12A 3IXSA 3O65B 1WXMA 2DC9A 3ONSA 2M8SA 4PCZA 1SEBD 2Z59B 2QBYB 2N9EB 3AEBB 1V81A 2MBHA 4XX5A 1WIAA 1AU0A 3HHAA 4TUUA 3Q3JA 1HT2E 4P17A 4FJVB 4ACFA 4M8NA 1FCLA 3KFQA 2MGWA 2JYEA 4IBEA 3U6EA 4JI3M 2PBHA 3WHLA 3LXSA 3UGBB 4LY6A 4BQVA 3HJSA 1D3ZA 2XK5A 3Q8GA 4HWYA 1YVBA 1W5SA 3FE3A 3BYTB 4K7SA 4L8RC 1R2YA 1FO4A 3FKYA 2PNSA 2R9CA 4BOQA 3HHXA 2O5RA 3PRMB 3CH2X 1GUAB 3MTNB 2JTCA 3I3TB 3Q8CA 4OW0A 4P6GA 4LK0M 2BJVA 2ZAMA 4GMVA 4FBJB 1XO3A 2LVOC 2DBYA 3PRPA 2LRWA 1HJPA 4Z8XA 4HCNB 2DWMA 3P4RB 3PPAA 4WURA 2WXOA 1ZV1A 5C23A 4QNMA 1QDQA 2JRIA 1R4NB 5FTNA 2FUHB 2QCUA 3EC8A 1YX5B 2X38A 3QARA 4OZCA 3JYUA 2GBKA 2HAKA 2AGAA 3E9SA 3SASA 1NB3A 1WMHB 4NQLB 2D10A 1VDVA 1GAQB 3IVFA 3V6CA 4XWTA 1N60A 2HXZA 2L1AA 2ZW1A 2OO9A 4W5CA 1C76A 2IBIB 3MFGA 4C4VB 1J09A 3JR5A 5IP4D 1UWMA 3ILKA 4MJSA 3W5VB 4MM3B 3NBIA 2LEKA 2JQGR 3N3KA 2N4FA 1IBXB 1JWMD 3BBZA 3BIID 4A3VB 4D82A 4AP4C 5C1BA 2KT7A 2LHEA 5JI3E 1OAOC 2XH9A 3PLUA 4MB7A 5ITQA 4JYAM 2E01A 1S1QB 2VZKB 4JI4M 3L17A 3R3MA 2IGGA 1KXRA 4L2YA 3A9JA 2DC6A 4FWGA 2O6VB 3P5VA 1ZCMA 1KH0A 2BTWB 5GMVA 2AEHA 4EZKA 2P0RA 1PJSA 4BBNC 1I4RA 2CHQA 4HXDB 2KHHA 2KNBA 3AE7B 3KX1A 3SYLA 5J18A 2DAJA 3V3XA 4DV2M 3U5ZB 3I9V1 2WS3B 2RR9A 3MP9A 1IWDA 2LRUA 1FCCC 3VLFB 3V05A 1TH3A 3DBSA 2OP3A 4WWPA 1TZ1A 5J2RA 3S3QA 3PXGA 5FTJA 1GB4A 5JZEA 1QUTA 1TTEA 3MHHA 2LUMA 2Z3XA 2EO2A 3TNXA 2CRUA 1GL7A 2OOBA 2G8LA 1K50A 3AI5A 1TBEA 3ZJTA 3CSFA 2N7JA 1WYGA 1L0VB 2WXGA 1SXJC 5A2QS 1PPDA 1PDXA 1GKIA 2CHWA 2C96A 1K52A 1UZXB 2X49A 1HT1E 3QWLA 3D6SA 3D32A 1QXPA 1IYFA 1ZW7A 3C9PA 3QK0A 3PGEA 1KLGD 4KIKB 4BZAA 4XDCA 1YK7A 2R9OA 4PS7A 4A90A 2INCC 2JY8A 5LNK1 1I35A 1IUEA 1UBQA 3KUZA 2Z8LA 3ZVVA 1KSFX 1FD6A 1ATKA 2BW2A 1E7UA 1O0EA 1SB3C 1AYVA 4D80A 2LWXA 4MGIE 2BYTA 1D0MA 2G5GX 3NBXX 1XB2B 1V97A 2D7EA 2KOXA 4RKUF 1EF1A 2K8BA 3NS1A 4MGYE 3QSDA 3ML8A 2YNMD 3H8BA 2W82A 2RDGA 1WGRA 3FTFA 4XE0A 2O25A 2G3QA 1NHWC 2R62A 2KLCA 2WXKA 1R7RA 2FS1A 3CBKA 4DBGB 4N9F4 3E21A 1PPPA 2FE8A 2I1KA 2BS2B 3KWLA 2JY7A 4P16A 3HY5A 4W9GA 1RFAA 4C7YA 2JRHA 3RE8A 2B3AA 3AL0C 4IM0A 1QLBB 1I4XA 2XZUA 3ZIMA 1L1TA 4QHSA 1NJGA 3BK1A 1GL6A 4B0MA 1OEYJ 3SAVA 3EIEA 1E94E 4ZYSA 1T3TA 2HL7A 4G11A 3AV0A 3CH3X 1F2AA 3GQ4A 3ZTCA 1NV9A 1YK8A 2Z4SA 4OHJA 3H7DA 4EEWA 2JZ3B 1K8RB 3RVXA 2UU9M 1UUPA 1NVMA 1QYRA 3AV8A 3KQ4A 4ICVA 4DHZB 4DUZM 3TL4X 3TBLD 1Y4HA 2WNMA 3MK6A 3KS8A 3UGJA 4YHHM 3N9YC 1ZAEA 4ZUXU 2R44A 4IBFA 2FIDA 2K8HA 4M0WB 3LB8C 2L32A 3UIOB 2ZANA 2JSVX 5IKCM 3MHSA 2DAMA 1YSYA 2LVQD 1CTEA 3MJ5A 2G9HD 5A24A 1AUAA 3KDSE 1WY8A 2Z84A 2EUCA 3LQRA 3VTUA 2AYNA 4KT0F 2WXQA 2K39A 2L7HA 3ZDMC 2LHGA 1PRBA 4NJ6A 1TU6A 3LXFA 3KW5B 3OWEB 4NRVA 3ZKJC 3RFZB 3AE5B
chains in the Genus database with same CATH topology
4PDGA 5E6JA 2UUBM 2PKOA 2WXNA 2QPAA 3I57A 1HEZE 3BOSA 3ZNHA 5KPZA 4D8BA 1NHGC 3T3OA 1TKEA 2Y0TA 1L0XB 3KVWA 5ITXA 2BU3A 4L15A 2NQ8C 1KTKA 3GLIB 1I4HA 3U6LA 4RNAA 1K51A 3W30A 1PVJA 2GI9A 1UNSA 2W55A 2ON8A 5EE3A 3GLGA 1SXJB 2XZFA 4C80A 1QQRA 1IQPA 4RGNA 1IN8A 2Z4RA 3GLHA 3HGIA 3D8LA 3CF0A 4HJGE 2F4VM 1PM5A 2J7OA 3GQ3A 2OEDA 4BB9A 3CF6E 1IXRC 3GO8A 1MX0A 3BVGA 1HR0M 4AKGA 2HCBA 1HNZM 4GIPA 4TQ0A 1LV7A 4B0EA 5AUIA 1ACCA 4DV3M 1XCQL 2IDYA 2PVOD 2C5RA 3GRYA 2MH7A 4HKQA 4AKHA 3HHZA 4WIPA 4IJFA 1XC8A 1YJIA 4DV5M 1YE9A 1RFKA 5FTKA 4LLGM 4NZLB 1Y56A 2KRUA 4YT0B 1V1OA 5GKNA 2V4IB 1JWAD 4GDLB 3WCQA 4JI0M 1SE4A 4DV0M 3PSEA 1Z6TA 3T3NA 1N62A 2OQ4A 1DGHB 1IY1A 1PJIA 4D8IA 2CHVA 3U6QA 4R7GA 5EXXA 4IJEA 5FSWA 4B7FA 3ZCBB 3ZH9B 4DQOC 4IBJA 2IGHA 1ZPSA 3PFIA 3HU1A 2KN4A 2K3UA 3IG5A 1BUIC 4B7GA 2RKOA 1K82A 5BPVA 4JI5M 2INPE 1K3WA 2ONQA 2KXEA 4IIWA 1V1PB 2DYMA 5ITUA 2LNHC 4DV4M 3GLFB 3AOEA 4KODA 2YEPB 1MVKA 2W3SA 3A42A 3LQQA 1VZ6A 4FCTA 2KAJA 1G3IA 3HVZA 4CGYB 4D2KA 2VIIA 1L4ZB 4LF7M 3HJ8A 1IBMM 4A8XC 4DR6M 3AE3B 1D5XC 3DZDA 4HRSA 5BMGA 2P5TA 3GQ5A 1QT9A 3FILB 1EWCA 1HQCA 4ZHOA 1VR9A 3T15A 2H1RA 4DV6M 4NXNM 4WQMA 1XCTL 5I4DA 1HZ6A 1L6UA 2GRIA 3SC3A 2INNE 1ENFA 3KOYE 3RGPA 1FRDA 5H8YE 3FUXA 3KOWE 1FJGM 3DWGC 3BVZA 3KFUG 1G41A 4JI8M 3FUUA 4GC9A 4ZOHC 1Z59A 1NENB 2R18A 2BTEA 1IXSB 1JWUD 3LVVA 3BBAA 2Q2EB 3W0FA 1ZDVA 2XN9C 3CWIA 1IM2A 5ITXE 4WH4A 3SATA 2F5SA 4BOSA 2L52A 3TEZA 3HU3A 4CISA 1L2BA 1D5MC 4FD2A 3K2LA 5EQTA 4JWSC 4GUAA 1K53A 2RGHA 4DUYM 1Q3BA 1XLOA 1ZP0B 2IJ0A 1SJHD 2M5ZA 1C4AA 1UM8A 4ITQA 3TPZA 3Q8FA 3GRVA 4NOOB 2W54A 1FNVA 5FTMA 1KFYB 4MACA 3TSSA 4ZHPA 1WGKA 3VRBB 2F5PA 1F2RI 3ZYYX 1QANA 3J81S 2B76B 4N59A 3T38A 1FIQA 2FOIC 3P4PB 2HHHM 3Q69A 3NWLA 7CATA 2BNKA 3L28A 3VRAB 1QVRA 2R46A 1EWYC 1KYIA 2IPKD 3LYYA 4KGSA 4L4UA 2UUCM 4CHTB 3J27B 5FR3A 4LF4M 4ITKA 4US9A 3NVWA 3W1SA 4FWDA 3HU2A 1XLQA 1J7CA 1NYQA 3P63A 2UXDM 3SAUA 1C79A 3FYCA 5GXGB 3TQSA 3SEBA 2LGIA 5BYRA 1FFVA 1YQ4B 3T1YM 1NY5A 2VQFM 3UMMA 3UI3A 1SSNA 3AE4B 2ZM6M 2QJLA 4YSYB 2R4EA 4AKIA 4IDIA 4YWGG 2LFIA 4AQ7A 4PD2A 1VDDA 2AX5A 3K1JA 1QOBA 1XMOM 1AWDA 2FNAA 1YMHE 1I4GA 5D7GA 3FTEA 2KQ4X 1GPXA 2JU6X 3MHVC 3FD9A 1KF6B 1N34M 3FUTA 1R6BX 2VQEM 3P42A 4ZPXA 1Z5BA 1QOFA 2QP9X 1K3XA 2SAKA 2QENA 3FKEA 1NSFA 3AB5A 1P7EA 3AEGB 3HJQA 4XZXA 2M56B 4LRSA 1PFDA 3R8BA 5ITYA 3W0LB 1ZXIA 2FBWB 1I4PA 1DO0A 5FLXS 2NTTA 1T6BX 5KQDA 3KOXE 4OVZA 4KGRA 3AN1A 4B7HA 3LMMA 2AHMA 4KLNA 4DR4M 1ET6A 3RGSA 1H6UA 1TDZA 3TWKA 2V0GA 4OZBA 4C56C 2CU3A 4KKIA 3Q8XA 2V6ZM 4GHAA 1HA5A 4NSRA 1JW9D 2WU5B 3P4SB 5KO3A 2QMTA 3U6OA 4LTUA 2YR0A 2JXTA 2BB6A 4M9ZA 2XEPA 1TGUA 4IP3A 2DZOB 3FC4A 4JE3B 5EXPA 1X37A 2OHFA 3DFZA 1IGDA 2EELA 5H92C 2JA2A 1DOIA 1G8PA 4A6QA 1B1ZA 4I8OA 4LJ5A 4AI6A 3SFZA 2PVGC 3AEEB 2EKIA 5KPTA 1XXHA 2H89B 1TH4A 5G5HA 2X8AA 4NSOB 2PMVA 2K0PA 4JV5M 1XNRM 1FM0D 4B3SM 1UWXA 2DWNA 2WLBA 2RMMA 1TY0A 4LGMA 3R2TA 1LO5D 2L83A 2I7NA 1PGXA 1TDHA 3C58A 3H8HA 1OFFA 4HL4A 4AG6A 3CTWB 2CHGA 1QAMA 4C7ZA 1QOAA 3ZJUA 3B21A 1R2ZA 3VDUA 2FUG1 2K22A 3K8ZA 3PVSA 3NRZA 1G59A 4LFAM 2WXRA 3D8BA 5EE0A 1IBKM 4IBKA 1E6EB 1OJLA 4A9AA 2HKJA 3MHZA 4ZRPA 5TSSA 5EE1A 2WXHA 1FFUA 4RH6A 5EP2A 3SAWA 4D8EA 3URYA 4LJ7A 3AE1B 1VRAB 3SFEB 3DOAA 2R61A 3IT4B 4X66M 3L4PA 3EGRA 3U60A 1VZ8A 3AJIB 2NTSA 3VKGA 3TEWA 4L23A 3U4EG 2MEKA 3BB7A 4YXDB 4LG2A 3CF2A 3BZDB 3BY4A 4MH8A 3AFHA 4LJ6A 2M60A 3J9CA 3PHWA 1QKZA 4ARCA 1JQ4A 2PW9A 2D7HA 4DR1M 3EUB2 1NJFA 4QOSA 2BB5A 1V8CA 4ZTBA 4JX1C 3SARA 2KW0A 4M0DA 1DYQA 3IAM1 4G6ZA 4YY3M 1AN8A 3E4RA 3IT6B 3A46A 2ZW0A 1ET9A 2CFOA 5DYIA 2LH0A 4LJAA 1MI0A 4LRTA 1PUTA 2N9LA 4KHPM 4YTMB 1SBBB 3B2GA 4X64M 1BMLC 3AECB 2ZAOA 4NXMM 1UKFA 2DWZB 3C0RA 3U52E 2V3PA 4DR2M 4DR7M 2VZKD 2UZJA 1NI3A 2DLBA 1EE8A 2E5LM 1TS2A 1ORYB 3A45A 1SIJA 2LHDA 2HTME 3WHKA 1E9RA 2AQ3B 2L09A 3TMPA 3AOEC 1N63A 1M4VA 4G4RA 3R9XB 1YJJA 1I94M 1C1KA 3SHGB 3VFDA 5IWAM 3KWVA 4II7A 4DV1M 3KW6A 2D7GA 4OZAA 4LF5M 4FCWA 3TUOA 1HNWM 3GLGB 4IBIA 3AEFB 4US8A 2HDEA 3PZ8A 1N77A 3AOGA 1JROA 4MH0E 2WXPA 4AZFA 1L8QA 2MJEA 3GLHB 2CJNA 3ZC7B 4B3MM 1Q39A 3GP1A 2RPVA 3KP0E 5T8IA 2Y21A 3U6SA 4WWMA 2XFSA 1L5PA 2JZPA 1E9MA 1QZMA 1OQRA 1QQWA 2V1CA 1ESFA 5DYGA 1IY2A 1J5EM 2DXIA 2Y0QA 1T3QA 3PZ7A 1IXZA 1HXYD 4JPSA 2A5YB 3SYKA 3HKPA 1N33M 3RNVA 3VK8A 3P4QB 1IN6A 3TWMA 4QNRA 4A55A 3L29A 1JR3D 1N75A 1OFIA 2J42A 3PHUA 4W5WA 4BOZA 1XLNA 2R45A 3U61A 2DWQA 2I38A 5BYSA 4DXFA 3GPYA 5HFYA 1TYGB 2L6OA 2CEAA 2YFQA 4HKZE 5EJCA 2CUZA 2LXEA 1L2CA 3AEDB 1N5WA 3VR8B 3HWSA 2UXBM 5LMUM 4LGYA 1OFHA 2F5QA 1T5XD 4DR3M 4P6VF 4WAFA 4L16A 2JWUA 3FAHA 5EP4A 1PJJA 1C9FA 2WU2B 1DGBA 1DGGA 4MGKE 1F2RC 5BYQA 1I7HA 4RF1A 4G4QA 4B3TM 2MJDA 2I2YA 4NJCA 4LJ4A 4I5SA 5LMNM 1FEHA 2RDHA 4RF0A 3VK7A 3I4YA 3AE6B 3U2SC 2KACA 5BMHA 3O65A 3GRUA 2QBYA 5C3JB 1QF6A 1IBLM 4DR5M 1SXJD 4RFBA 3FTCA 4PT5A 1SJED 1DGJA 1IN7A 1EM7A 3K92A 1DGFA 3SBJA 1IGCA 3H4MA 2SEBD 3PRMA 2EA0A 3L25A 1L6VA 1L0YB 1SXTA 3SHFA 2J4XA 1G4AE 1YN3A 4J3OD 4X62M 2L7IA 2KZSA 2KRKA 1L2DA 1E9SA 4I81A 1HNXM 4Q2JA 2WQYB 2GB1A 2OPFA 1HQRD 1D2NA 1ZXHA 2QILA 1IBXA 5EP1A 4JI1M 1ROEA 4YTNB 5KQ8A 1TZOA 3IG8A 2WXJA 2K5PA 5ITRA 4XBOA 2BTWA 2DVWB 4B3RM 2KWDA 1EU3A 4QOZC 2XSZD 1QILA 1TY2A 3KOZE 3U6DA 1RWSA 4N6EB 2WXLA 2PTLA 4GLSC 3U5ZA 3SR6A 1JWBD 2C9CA 1AW7A 2WP9B 5HG2A 1W5TA 4JI2M 2N9KA 4EIWA 1TKYA 1D6EC 3BVMA 2J53A 3W31A 3KSXA 3VR9B 1B9RA 1WXQA 1IN5A 1TS4A 4LZJA 4B08A 2CV1A 3KLSX 1FXIA 4RCOA 1YNTE 2XNAC 4RGOS 1E7PB 4TSSA 4OX9M 3Q8BA 4IOIE 2AQ2B 3RPFC 3GPPA 1YQ3B 1YN4A 1N78A 3TEXA 1IY0A 4MGHA 3NVZA 2J7NA 3SMPA 1ZOYB 3P1MA 1QAOA 4GRIA 2JQRB 5EZQA 5BR8M 3FUWA 3E56A 2WDRB 4LZZA 3GS2A 3U6MA 3BWUD 2DYOA 1S3SA 1JALA 2XGNA 4IBCA 1TJEA 3W2DA 1PGAA 4DV7M 1A70A 4TMAB 1XXGA 4JWUC 2DZNB 1PGBA 5F3WA 4LFCM 5KPRA 4MT5A 4JXJA 1JR3A 1KLUD 4X65M 4PDIA 1ZUD2 1J7BA 4XWWA 2XLJA 3FYDA 2ZBKB 4HEA1 4LF6M 1QOGA 5DNYA 4NAWB 1CJEA 3KXEC 1Z5AA 1J7KA 4G4NA 3GB1A 4K0KM 5HI1A 2YEPF 4M0WA 3DA1A 2R65A 1N32M 2C99A 5G5GA 3AM9A 2KDMA 8CATA 2DHRA 3KP1E 5E26A 1NEKB 2WXMA 5C18A 3M0EA 4BOPA 3PNVA 3IAS1 1XHBA 5IREB 5H37D 3PT2A 3HUIA 4LF8M 2Q5WD 2QIEB 4GMQA 3M7GA 4GHLA 2W3RA 2WXIA 1OQQA 4OVZB 1MU5A 3QAUA 5EE9A 1YZBA 3GLIA 4L78A 3NVYA 4L1BA 4CQNA 1IN4A 1VJKA 4LJ9A 3RFWA 4G4OA 5EXSA 1SXJA 2BS3B 3LVWA 1N36M 1Z5CA 1I4WA 2V1UA 1VZ7A 4XDDA 3W5UB 1WSPA 1FMAD 2K47A 1N61A 4RKXA 4NAMA 3HHYA 1DOYA 3B9JA 1XLPA 1CK1A 1ZDXA 2C98A 4GDKB 2UXCM 4TQ1A 1MHXA 3OTOM 3AEAB 1GVNA 2TSSA 4GITA 3IFUA 1TKGA 1XXHB 2ERCA 1NVID 3MP2A 4QHTA 4IBGA 4IKGA 2H88B 3I4VA 1PYWD 2KZUA 4OU7A 2QEJC 3J2PB 1NNUC 2FFJA 1FNWA 1QAQA 5BMIA 1R7SA 5FK9C 4GH9A 3A98B 3M6AA 4ZRQA 1JWSD 2XF3A 3PNYA 5IZ7D 3UJNA 4TUWA 4KO8A 1ZE3D 2XSZA 1DGHA 3ZJVA 4BLCA 4MI7A 3HHWA 4REZA 4AQYM 3NZ3A 2J52A 3AE2B 4FXCA 5JI2E 5ITTA 1FRRA 1VLBA 5D3IB 1YUBA 3UZUA 1Q3CA 5EZSA 2Y20A 1F77A 1TS5A 4KX6B 4GC5A 2D5GA 3TRKA 2CV0A 4LJ8A 3VKHA 3EA6A 3BYYB 2M19A 4AW4A 2UUAM 5AUKA 3OQCA 3GRRA 1V1PA 4HLQA 3GLFA 3MC0B 4A5UA 3CIRB 3VDPA 3U60B 2ICIA 2BS4B 1CZPA 4YTPB 2Y3AA 2PIAA 1STEA 5FKAC 4FVMA 3C8YA 2E3TA 4LF9M 1NY6A 1XEEA 3R2IA 3L2AA 3BK2A 3AE8B 1TS3A 4IBBA 2X4AA 1Q10A 4JN6A 3FILA 1XF5L 1D5ZC 3Q8AA 1GB1A 3W9CB 1JCKB 1RM6C 2QSDA 1SE2A 3HVDA 1ZQ9A 4BOUA 2CV2A 1GOZA 4MGZE 2KMMA 2J7QC 1WWTA 5JXVA 3ETRA 1JMLA 1KFVA 2Y5PA 1XNQM 1E32A 4LFBM 5EP3A 2AQ1B 2RGOA 3KSJA 3AE9B 5D3DA 3JAMS 1MPEA 3I51A 2KEBA 1SE3A 1C78A 4USAA 4M9XA 1I4QA 1C4PA 5IT9S 1C77A 1CQVA 1DOXA 2PLPA 5HHDG 1E10A 3KS4A 4KGTA 2WDVB 2BJWA 1EU4A 3TEYA 1SXJE 4Z6YA 4NL4H 4GKJM 2JYTA 2J7QA 4LCBA 4O1NA 3VQIA 5EXTA 1DKIA 2BBCA 4NRWA 4YSXB 3R8FA 3TE6A 4UDUC 4YSZB 2G1EA 1D4BA 1L1ZA 3EIHA 2Z7JA 2F5OA 2E6XA 1AYFA 4JI6M 4BBAA 4IBDA 1NYRA 2M0AA 4RGTA 2MJ3A 2KA6B 1XMQM 4R3DA 2DWLA 1P7FA 2NMQA 4KKJA 4AS1A 1FNUA 2LMCA 3B2FA 1FXAA 3GP7A 2HWKA 4AG5A 1KRHA 4ARIA 5FTLA 3B9PA 4IUMA 2F5NA 3Q8EA 3FUVA 1UGJA 2Y5CA 3PHXA 2YQZA 2CE7A 4EE2A 2ACZB 3FTDA 3J7BA 2I7PA 3U6PA 2K9XA 4XGIA 4I4LA 1YN5A 1JRPA 3GPXA 1TH2A 2IGDA 4RGMA 2BT6A 3THGA 2LJIA 1GLNA 4DXGA 3U61B 1WRIA 3L27A 3NUHB 3ABVB 2N0SB 1SF0A 4FW9A 3J80S 1HZ5A 2DOSA 1MHHE 3L26A 3U6CA 3HRDD 3ZGZA 3AKZA 1J7AA 1JQJC 3O13A 3T1HM 1FNNA 2QZ4A 4JI7M 4M9SA 2C9OA 3U7ZA 4GKKM 4FCVA 1HQYE 5MPOA 3PO0A 3UK6A 2V3NA 4N58A 3J7AS 2R4JA 2XFTA 5C2TB 1XWIA 2JX5A 4HROA 1E0ZA 3JR4A 4H2AA 1L4DB 4WW0A 4FWHA 1DO2A 3AH7A 3GPUA 2WXFA 2WDQB 3SFDB 3AMZA 3DWMA 2CJOA 1C4CA 1N5XA 3TWLA 3MTVA 1RYJA 1NNJA 4D81A 3NVVA 3ZQ4A 1F0ZA 1BXTA 3SMSA 4S12A 3IXSA 4PCZA 1SEBD 2QBYB 3AEBB 1HT2E 1FCLA 2JYEA 4IBEA 3U6EA 4JI3M 3WHLA 4LY6A 3HJSA 1W5SA 3BYTB 4L8RC 1R2YA 1FO4A 4BOQA 3HHXA 2O5RA 2JTCA 3Q8CA 4OW0A 4LK0M 2BJVA 2ZAMA 1XO3A 2DBYA 3PRPA 4Z8XA 2DWMA 3P4RB 4WURA 2WXOA 4QNMA 2JRIA 5FTNA 2QCUA 2X38A 4OZCA 2AGAA 3E9SA 3SASA 1VDVA 1GAQB 4XWTA 1N60A 2L1AA 2ZW1A 1C76A 3MFGA 1J09A 3JR5A 1UWMA 3ILKA 3W5VB 4MM3B 3NBIA 2LEKA 1IBXB 1JWMD 3BIID 4A3VB 4D82A 5C1BA 2LHEA 5JI3E 2XH9A 4MB7A 5ITQA 4JYAM 2VZKB 4JI4M 2IGGA 4L2YA 4FWGA 1KH0A 2BTWB 1I4RA 2CHQA 4HXDB 3AE7B 3SYLA 3V3XA 4DV2M 3U5ZB 3I9V1 2WS3B 3MP9A 1FCCC 3VLFB 3V05A 1TH3A 3PXGA 5FTJA 1GB4A 5JZEA 2LUMA 2Z3XA 2EO2A 1GL7A 1K50A 2G8LA 3ZJTA 2N7JA 1WYGA 1L0VB 2WXGA 1SXJC 5A2QS 1PDXA 1GKIA 2C96A 1K52A 2X49A 1HT1E 3QWLA 1KLGD 4XDCA 4A90A 5LNK1 1IUEA 2Z8LA 1KSFX 1FD6A 2BW2A 1SB3C 4D80A 2LWXA 4MGIE 2BYTA 2G5GX 1V97A 2D7EA 3NS1A 4MGYE 2YNMD 2W82A 2RDGA 3FTFA 4XE0A 1NHWC 2R62A 2WXKA 1R7RA 2FE8A 2BS2B 3KWLA 4P16A 4C7YA 3RE8A 3AL0C 1QLBB 1I4XA 2XZUA 1L1TA 4QHSA 1NJGA 3BK1A 1GL6A 4B0MA 3SAVA 3EIEA 1E94E 4ZYSA 1T3TA 2HL7A 3AV0A 3GQ4A 2Z4SA 4OHJA 2UU9M 1UUPA 1NVMA 1QYRA 3AV8A 3KQ4A 4DUZM 3TL4X 2WNMA 3MK6A 3KS8A 3UGJA 4YHHM 3N9YC 1ZAEA 4IBFA 3LB8C 2L32A 2ZANA 2JSVX 1YSYA 3MJ5A 2G9HD 3KDSE 2Z84A 2EUCA 3LQRA 2WXQA 2L7HA 3LXFA 3OWEB 4NRVA 3RFZB 3AE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNA A;  4MM3 B;  5E6J A;  4RF1 A;  4WUR A;  4OVZ B;  4REZ A;  3MJ5 A;  5KO3 A;  4PT5 A;  3MP2 A;  3E9S A;  4M0W A;  2FE8 A;  4OVZ A;  4R3D A;  4OW0 A;  4RF0 A;  4P16 A; 
#chains in the Genus database with same CATH topology
 3PT2 B;  4PS3 A;  4WJQ A;  4KV2 A;  4PDG A;  4HLE A;  5E6J A;  3FRI A;  3TIX A;  2UUB M;  2FYE A;  1GJZ A;  4E74 A;  2PKO A;  2WXN A;  3U8E A;  2QPA A;  3I57 A;  1HEZ E;  3P5X A;  3BOS A;  3PLV A;  5KPZ A;  3ZNH A;  4D8B A;  1NHG C;  3T3O A;  1AYW A;  2N9P C;  1QDT A;  1FXT B;  3M3J A;  1TKE A;  2Y0T A;  1L0X B;  4M02 A;  3KVW A;  5ITX A;  5CHF A;  2JT4 B;  2BU3 A;  4L15 A;  2NQ8 C;  1KTK A;  3GLI B;  2AWT A;  2Z0E B;  3JSV A;  1I4H A;  3U6L A;  3EFU A;  4RNA A;  4X6H A;  4ZRI A;  1K51 A;  2XU4 A;  3W30 A;  3NZS A;  1GLO A;  3Q3O C;  2GI9 A;  1UNS A;  1PVJ A;  2W55 A;  3DVG Y;  3APF A;  4DWF A;  1WGL A;  2ON8 A;  4EZJ A;  5EE3 A;  3CMM B;  3GLG A;  1SXJ B;  2XZF A;  4JLC A;  4C80 A;  2JUO A;  1G6J A;  3H8C A;  2LD9 A;  1QQR A;  1IQP A;  4RGN A;  3U7D A;  1IN8 A;  1ITO A;  2Z4R A;  3GLH A;  3HGI A;  1OQY A;  3D8L A;  4CIZ A;  3IOQ A;  3CF0 A;  3ECI A;  4HJG E;  1WI0 A;  2F4V M;  4P1B C;  1PM5 A;  3IFW B;  2J7O A;  2N9X A;  1HE8 A;  3GQ3 A;  2OED A;  4BB9 A;  4YL8 A;  3CF6 E;  1IXR C;  1BQI A;  4KLB A;  2VH1 A;  3GO8 A;  1MX0 A;  2WHI A;  3BVG A;  4QH6 A;  3SU8 X;  2Y5B B;  1HR0 M;  2FQ9 A;  1MHW A;  5F02 A;  2AS8 A;  4AKG A;  2HCB A;  1HNZ M;  5AEK B;  4GIP A;  1V33 A;  4TQ0 A;  1LV7 A;  3A1Q B;  2NBW B;  1JRU A;  2GBJ A;  1BVS A;  1GJS A;  2LVP C;  4B0E A;  5AUI A;  4QRX A;  3DBR I;  4F8C B;  2JVC A;  1ACC A;  4DV3 M;  3S3R A;  1XCQ L;  1V5T A;  1VQ1 A;  4YVA A;  1JR3 E;  2IDY A;  1U9V A;  3DHH C;  2PVO D;  1MEM A;  4FA6 A;  2C5R A;  3GRY A;  2MH7 A;  4HKQ A;  2JY5 A;  4AKH A;  2CWB A;  3HHZ A;  1ISN A;  2WGS A;  4WIP A;  1NB5 A;  4IJF A;  1XC8 A;  3ZUN A;  1YJI A;  2WYQ A;  4DV5 M;  1YE9 A;  1RFK A;  2NBV B;  4WWN A;  5FTK A;  2ZNV C;  1SP4 B;  2DC8 A;  4G3O A;  4LLG M;  4NZL B;  1Y56 A;  2KRU A;  5D6J B;  2KZR A;  4YYU A;  4YT0 B;  1V1O A;  5GKN A;  2R9F A;  2V4I B;  3M63 B;  1JWA D;  3V60 A;  4GDL B;  3RNE C;  1WGY A;  4PI3 A;  3WCQ A;  3WXE A;  4JI0 M;  1CV8 A;  3DVN V;  1SE4 A;  4DV0 M;  3F92 A;  2OZ2 A;  3PSE A;  1Z6T A;  2B1N A;  3T3N A;  1N62 A;  3HIZ A;  1MN3 A;  2KNV A;  4GU2 A;  2OQ4 A;  1DGH B;  3K9O A;  1IY1 A;  3NS8 A;  1PJI A;  4D8I A;  1EO6 A;  2CHV A;  3U6Q A;  4R7G A;  5EXX A;  1NPZ A;  3N20 C;  5KHQ A;  1WGG A;  4IJE A;  5FSW A;  4B7F A;  1UD7 A;  3IEJ A;  3ZCB B;  3ZH9 B;  4DQO C;  1KFU L;  1DEU A;  4IBJ A;  2IGH A;  3NJT A;  3DVG X;  4E3C A;  1CVZ A;  1ZPS A;  4CO7 A;  1GEC E;  1PE6 A;  3PFI A;  8PCH A;  3HU1 A;  2KN4 A;  2LXC A;  2K3U A;  3N1Y C;  4B95 A;  3IG5 A;  4XUI A;  1BUI C;  4IW0 A;  4B7G A;  2RKO A;  4NC6 A;  2NBU A;  4KZC A;  3RNC C;  2MP2 A;  4CDE B;  1K82 A;  5BPV A;  3GLI E;  4JI5 M;  3H7P A;  2INP E;  2CHX A;  1LFD A;  1K3W A;  2ONQ A;  2KXE A;  4IIW A;  2HTH A;  3L13 A;  1SGH A;  1V1P B;  2DYM A;  5ITU A;  3R7R A;  2LNH C;  4DV4 M;  2GQF A;  3GLF B;  4C00 A;  2LVN C;  3AOE A;  4KOD A;  2YEP B;  1V80 A;  3BIN A;  1MVK A;  2WSE F;  3K9P B;  2W3S A;  1V2Y A;  3A42 A;  3LQQ A;  1VZ6 A;  1YQB A;  3OVX A;  4FCT A;  2KAJ A;  1G3I A;  1WJ4 A;  2KDB A;  3HVZ A;  4CGY B;  2DZI A;  4D2K A;  3AU4 A;  3GE3 C;  2VII A;  3PNR A;  1L4Z B;  4LF7 M;  3HJ8 A;  3C9E A;  4QRV A;  1IBM M;  4A8X C;  4DR6 M;  3AE3 B;  2FCS A;  1D5X C;  2D3A A;  3DZD A;  3GZN I;  3N1Z C;  3UIN B;  3GE8 C;  4HRS A;  5BMG A;  4N4Z A;  2P5T A;  2R6F A;  3I01 M;  3GQ5 A;  3B1L X;  4KSK C;  2GOW A;  1QT9 A;  3FIL B;  1EWC A;  3NOB A;  1HQC A;  3EEC A;  3TJP A;  4ZHO A;  1PPN A;  3RD2 A;  4HDQ A;  1VR9 A;  7PCK A;  1MG8 A;  3T15 A;  2ZPY A;  4PYZ A;  2H1R A;  4DV6 M;  4NXN M;  4WQM A;  1XCT L;  2BQQ A;  4EFO A;  5I4D A;  2KNZ A;  2N1V A;  2K6B A;  1F52 A;  1HZ6 A;  1L6U A;  4OVV A;  2GRI A;  3SC3 A;  2INN E;  1ENF A;  3KOY E;  3RGP A;  2NQA A;  1FRD A;  5H8Y E;  2MBO A;  3FUX A;  3QA8 A;  3KOW E;  2D2Q A;  1FJG M;  3DWG C;  3BVZ A;  3KFU G;  3LCV B;  1G41 A;  2G6D A;  4M8M A;  1T0R C;  4JI8 M;  3FUU A;  4GC9 A;  4ZOH C;  1H4R A;  1Z59 A;  1NEN B;  4LDT D;  2KJH B;  2R18 A;  2BTE A;  5L95 C;  1IXS B;  1JWU D;  3LVV A;  3BBA A;  2Q2E B;  3W0F A;  1ZDV A;  4TV3 A;  2XN9 C;  3CWI A;  2CHZ A;  1IM2 A;  2ZNV B;  1KM7 A;  3O0U A;  5ITX E;  4WH4 A;  3QYB A;  3SAT A;  3ZTD A;  2F5S A;  1STF E;  4BOS A;  1SE9 A;  2L52 A;  5K16 A;  3TEZ A;  4CIS A;  3HU3 A;  4G54 A;  1L2B A;  1D5M C;  2KWV B;  4FD2 A;  3K2L A;  2HD5 A;  4UN2 B;  5EQT A;  2L8J A;  2A4Z A;  3GLG E;  4JWS C;  3KWZ A;  3AXC A;  1WJ7 A;  4G3X B;  4GUA A;  1K53 A;  2RGH A;  4DUY M;  1Q3B A;  2DAK A;  2C7H A;  5CTR C;  1WX9 A;  4L6V 6;  1XLO A;  2KYW A;  3IG3 A;  2JY6 B;  1ZP0 B;  2IJ0 A;  1LTM A;  1SJH D;  4RY2 A;  2M5Z A;  1C4A A;  2JQF R;  1EWO A;  1WFY A;  2GBM A;  1UM8 A;  4B6W A;  3VHT C;  2EKK A;  3TPZ A;  4ITQ A;  3Q8F A;  1AU2 A;  3GRV A;  3UF8 A;  1ZKH A;  4NOO B;  2W54 A;  1FNV A;  5FTM A;  1KFY B;  4MAC A;  1NO1 A;  4NQK E;  1PAD A;  4F1S A;  3TSS A;  4ZHP A;  2BF8 B;  1WGK A;  1WRD B;  3VRB B;  2DI0 A;  5DPS A;  4ZDV A;  3ZRC A;  3GLF E;  2F5P A;  3DBH I;  1F2R I;  3ZYY X;  1QAN A;  3J81 S;  1Q1O A;  2A5U A;  2B76 B;  3EHV A;  3QAQ A;  4N59 A;  2FRQ A;  3T38 A;  1FIQ A;  1WX8 A;  2PAD A;  4FIP A;  2FOI C;  3P4P B;  2HHH M;  3Q69 A;  3TL5 A;  2KTR A;  3NWL A;  7CAT A;  2LGS A;  3IUT A;  2KO3 A;  3QJZ A;  2BNK A;  3JW0 X;  3L28 A;  2GFO A;  2DCD A;  4BS6 A;  2X8X X;  3VRA B;  2DX5 B;  1QVR A;  2R46 A;  2V3S A;  2J0J A;  1WHC A;  4RM8 A;  1EWY C;  3ERV A;  1KYI A;  4IUM B;  2IPK D;  3ZO5 B;  3VFK A;  3LYY A;  4GB9 A;  4KGS A;  4L4U A;  2UUC M;  2LHC A;  4CHT B;  1E5W A;  2GMI C;  2MX2 A;  3J27 B;  5FR3 A;  1VEK A;  4LF4 M;  4ITK A;  4US9 A;  3PHX B;  3NVW A;  1OTR A;  4S17 A;  3WIM A;  4GIV A;  3W1S A;  4FWD A;  3HU2 A;  1BGO A;  2LTU A;  1U9X A;  1XLQ A;  5PAD A;  1J7C A;  4FK5 A;  1JB0 F;  1NYQ A;  1IPG A;  3P63 A;  2KDL A;  3SAU A;  2UXD M;  1C79 A;  3FYC A;  3V6E A;  2IZV B;  3TQS A;  5GXG B;  3SEB A;  2LGI A;  4BKT A;  1OIZ A;  5BYR A;  1FFV A;  1YQ4 B;  2KC1 A;  3T1Y M;  2IO3 B;  1NY5 A;  2VQF M;  3RZW C;  1I42 A;  3APC A;  3UMM A;  3OAW A;  3T6P A;  3UI3 A;  3H7S A;  1SSN A;  1C3T A;  1LXD A;  2ZJD A;  3AE4 B;  2D07 B;  4IM3 A;  1RU3 A;  2JZ1 A;  2L0T A;  2ZM6 M;  2LGY A;  2QJL A;  4YSY B;  2R4E A;  1H8C A;  4AKI A;  4IDI A;  4YWG G;  2LFI A;  1N6Z A;  4NAW A;  4PK1 A;  3KVF B;  1TT5 B;  4AQ7 A;  4PD2 A;  1VDD A;  1EF7 A;  2MW5 A;  3AUL A;  4Q8G A;  3W67 A;  2AX5 A;  3Q3M C;  3K1J A;  1X1M A;  1QOB A;  1XMO M;  1AWD A;  3E1Z B;  2FNA A;  1YMH E;  4MZS A;  1I4G A;  2DYB A;  5D7G A;  2DCC A;  3FTE A;  2KQ4 X;  1GPX A;  2JU6 X;  5CHW A;  3MHV C;  3DF0 A;  3FD9 A;  1KF6 B;  2AYO A;  1N34 M;  3FUT A;  3I5J C;  3VUW A;  1R6B X;  2VQE M;  3P42 A;  4W9H A;  1BY8 A;  4ZPX A;  2EMT A;  2C60 A;  1T0Y A;  1Z5B A;  4WP2 A;  2QP9 X;  1QOF A;  2G4D B;  3B08 A;  5G2N A;  1OIP A;  3HHI A;  3RN9 C;  4CDF B;  2M4N A;  4HCP B;  2NCN A;  2BGF A;  3X23 A;  2DNA A;  2JUJ A;  5IA7 A;  1K3X A;  2SAK A;  2ZCB A;  2QEN A;  1PGY A;  3FKE A;  1NSF A;  3AB5 A;  1P7E A;  3AEG B;  1WR1 A;  3HJQ A;  4XZX A;  1MIR A;  4I6P A;  2M56 B;  5BO4 B;  2MQJ A;  1WF9 A;  4LRS A;  3RNF C;  2DCA A;  1T43 A;  1PFD A;  1WM2 A;  3R8B A;  5ITY A;  3W0L B;  2FO5 A;  1ZXI A;  2FBW B;  2HWJ A;  2MSE D;  1J0G A;  1I4P A;  1DO0 A;  1U9Q X;  2B1M A;  5AZG A;  1AU4 A;  2K1F A;  4YYV A;  5FLX S;  1SIF A;  2NTT A;  1T6B X;  3DVN U;  5KQD A;  3KOX E;  4OVZ A;  2C0Y A;  2NVU I;  2P7U A;  4KGR A;  2VHF A;  3AN1 A;  4DXA B;  1THE A;  3NHE A;  1RLF A;  4B7H A;  3LMM A;  2AHM A;  4KLN A;  4DR4 M;  1ET6 A;  3RGS A;  1H6U A;  1TDZ A;  2XBB C;  3TWK A;  2K6Q A;  2V0G A;  4OZB A;  4C56 C;  2CU3 A;  4KKI A;  1WE7 A;  3Q8X A;  2V6Z M;  4GHA A;  1PCI A;  1HA5 A;  4NSR A;  1JW9 D;  2WU5 B;  3P4S B;  3DDC B;  1MDW A;  5KO3 A;  2QMT A;  2JXN A;  1WXS A;  2MLB A;  3VH3 B;  3VTV A;  2MBQ A;  1M6D A;  1YX6 B;  3U6O A;  4LNO A;  3ZRF A;  5CHT A;  4LTU A;  3USV A;  2YR0 A;  2XK5 B;  3Q3F A;  2JXT A;  2BB6 A;  4M9Z A;  2XEP A;  1TGU A;  2GBN A;  4JQW C;  3SD5 A;  4IP3 A;  5DPW A;  2DZO B;  3FC4 A;  4JE3 B;  4W9C A;  1EFU B;  2MR9 A;  5EXP A;  1X37 A;  2WSC F;  3QC8 B;  2OHF A;  2BKF A;  1EWM A;  2VDB B;  2LGX A;  3H89 A;  3DFZ A;  4GDK A;  5D94 A;  1IGD A;  2EEL A;  2JNH A;  2LUE A;  5H92 C;  2JA2 A;  3PRP B;  1DOI A;  1G8P A;  4A6Q A;  1B1Z A;  2J0K A;  2KLG A;  2ZCC A;  3R66 C;  4I8O A;  4LJ5 A;  4AI6 A;  3SFZ A;  2PVG C;  2JRI B;  3AEE B;  2EKI A;  1T0S C;  5KPT A;  2CB5 A;  1XXH A;  3B7Z A;  2H89 B;  2M1M A;  3W68 A;  4MSQ B;  1TH4 A;  3MMP A;  5G5H A;  2X8A A;  1WGD A;  1CJL A;  3V6C B;  3ZNG C;  1D0L A;  3HHM A;  1WGN A;  4NSO B;  1TGZ B;  2PMV A;  3HWN A;  4AXM A;  1UGM A;  1CPJ A;  1WZ0 A;  1DV0 A;  2K0P A;  4JV5 M;  1XNR M;  1AIP C;  1FM0 D;  4MJS B;  4B3S M;  3N3K B;  1UWX A;  2DWN A;  2RSU A;  2RMM A;  2WLB A;  3AI8 A;  1TY0 A;  4LGM A;  2N7E A;  1V49 A;  1AU3 A;  3R2T A;  4DMX A;  3F75 A;  1LGR A;  1LO5 D;  2L83 A;  2I7N A;  1PGX A;  2IO1 B;  1TDH A;  3C58 A;  4AUQ C;  3H8H A;  5KHO A;  3A9J B;  2Z0D B;  1OFF A;  2NQD B;  5IN7 A;  3U8Z A;  4HL4 A;  1PIP A;  3E46 A;  2DHZ A;  4AG6 A;  1TLO A;  3CTW B;  2CHG A;  1QAM A;  3NZU A;  4C7Z A;  2JWS A;  2KNA A;  1QOA A;  1L2N A;  2L00 B;  3C3D A;  2BKR B;  3KW9 A;  1V6E A;  3ZJU A;  3B21 A;  1R2Z A;  4FJC A;  3VDU A;  1WGH A;  2FUG 1;  2K22 A;  2RD0 A;  3K8Z A;  1KLV A;  4BPV A;  2AUX A;  2JWZ A;  2L76 A;  3MC8 A;  4LJP B;  2KD0 A;  3U30 A;  2G8E A;  2LZ6 A;  3PVS A;  4YYS A;  2KK8 A;  3NRZ A;  1G59 A;  2VHS A;  3WXG A;  4LFA M;  5JZE B;  2KVR A;  1GNU A;  2WXR A;  3D8B A;  3OF9 A;  5EE0 A;  1IBK M;  1JQP A;  2OOB B;  2BYE A;  4IBK A;  1E6E B;  1OJL A;  4IG7 B;  2KX0 A;  3DBL I;  4DHJ B;  1G71 A;  3B79 A;  4A9A A;  1V5O A;  3RUL A;  2HKJ A;  3MHZ A;  4ZRP A;  5TSS A;  5EE1 A;  2WXH A;  1FFU A;  4EZL A;  4RH6 A;  2R6N A;  5EP2 A;  3SAW A;  4D8E A;  3P5W A;  3URY A;  4LJ7 A;  3AE1 B;  1VRA B;  3ENE A;  3SFE B;  1QOL A;  3PRE A;  1J8C A;  2FAZ A;  5DPR A;  2XU3 A;  3DOA A;  1F29 A;  3L16 A;  2R61 A;  5DCN A;  3IT4 B;  4X66 M;  3L4P A;  2GLS A;  2G7Y A;  3EGR A;  5LXH A;  3U60 A;  1VZ8 A;  3AJI B;  2LXA A;  2NTS A;  4EOY A;  4MEL A;  3AU5 A;  3VKG A;  3TEW A;  4XGA B;  4L23 A;  2AUZ A;  4BS5 A;  2WWZ A;  3U4E G;  2MEK A;  1PPO A;  3BB7 A;  4YXD B;  5E6N A;  4PP1 A;  4LG2 A;  3T8M A;  4EKU A;  3CF2 A;  2G3Q B;  2M0X A;  2MA9 B;  3BZD B;  3KSE A;  2NPT A;  3BY4 A;  4MH8 A;  3B0A A;  2FCN A;  1GMY A;  3AFH A;  4LJ6 A;  2M60 A;  3J9C A;  3IHP A;  1HUC B;  3ML9 A;  2D3G A;  3PHW A;  2LGD A;  1YT7 A;  1QKZ A;  4ARC A;  2MRO B;  1JQ4 A;  3WXF A;  4II2 B;  2PW9 A;  2KTF A;  4IWP A;  2D7H A;  4DR1 M;  2KVZ A;  3EUB 2;  3HK0 A;  1NJF A;  4QOS A;  2KWC A;  2BB5 A;  1V8C A;  4ZTB A;  1E8Z A;  4JX1 C;  3SAR A;  2KW0 A;  4M0D A;  2UYZ B;  1DYQ A;  3IAM 1;  4G6Z A;  4YY3 M;  4M01 A;  3A9K A;  2K0B X;  3B7Q A;  2FCM A;  1AN8 A;  1OEY A;  3E4R A;  1C1Y B;  3IT6 B;  1KHP A;  3A46 A;  2ZW0 A;  1ZMU A;  1ET9 A;  1R4M I;  3X0W A;  3O1G A;  2KDE B;  3QJ3 A;  2CFO A;  5DYI A;  3KWB X;  2LH0 A;  4KVG B;  1KOT A;  1MJD A;  4LJA A;  2VF7 A;  1Y8R C;  5JH3 A;  1MI0 A;  4LRT A;  1EIJ A;  1PUT A;  4K81 A;  3HZJ A;  2N9L A;  4KHP M;  4YTM B;  1SBB B;  3B2G A;  4X64 M;  1BML C;  4LNN A;  2O2V A;  1WXV A;  2DJF B;  1CSB B;  1P3Q Q;  3AEC B;  1P98 A;  1TTN A;  2ZAO A;  4NXM M;  3PDF A;  1AIM A;  1UKF A;  2DWZ B;  4ANW A;  3C0R A;  3MC9 A;  1WYW B;  3U52 E;  1WJU A;  3C3E A;  2V3P A;  1Y8G A;  4DR2 M;  4DR7 M;  2VZK D;  4WAA A;  2UZJ A;  1VEG A;  1NI3 A;  4II3 B;  2O6V D;  2DLB A;  1EE8 A;  2E5L M;  1TS2 A;  4KSL C;  1ORY B;  3WAM A;  3ZUA A;  3A45 A;  9PAP A;  2ZTC A;  1SIJ A;  3ZNH B;  2OOA A;  2IY1 B;  2LHD A;  2HTM E;  3V62 A;  3S2A A;  3L08 A;  4W9L A;  3WHK A;  1E9R A;  2AQ3 B;  1CS8 A;  2L09 A;  3TMP A;  3AOE C;  1N63 A;  3B7N A;  4Q7J A;  1M4V A;  3R9X B;  4G4R A;  1MFW A;  1I94 M;  1YJJ A;  3JSV B;  5IOI A;  1C1K A;  3DPD A;  3SHG B;  3VFD A;  5EDS A;  5IWA M;  3KWV A;  5CVO B;  2ZVO A;  4II7 A;  3VDZ A;  3B89 A;  4DV1 M;  2IND C;  3KW6 A;  2D7G A;  4OZA A;  4LF5 M;  4FCW A;  3TUO A;  1HNW M;  4JIO U;  3ZQJ A;  3GLG B;  4IBI A;  5JH5 C;  3AEF B;  4US8 A;  1E8X A;  2HDE A;  3PZ8 A;  4WQO B;  1N77 A;  4BSQ A;  3AOG A;  1JRO A;  4ANX A;  4MH0 E;  3VUY A;  2L4F A;  2RRU A;  4AZF A;  2WXP A;  3OF8 A;  1L8Q A;  2MJE A;  3GLH B;  2CJN A;  3ZC7 B;  1T0Q C;  4B3M M;  2QHO A;  1Q39 A;  1XXH E;  3GP1 A;  4I6N B;  1GO5 A;  2RPV A;  4W9J A;  3KP0 E;  2HH5 A;  1NV8 A;  5T8I A;  1HTO A;  2Y21 A;  3U6S A;  4WWM A;  1KHQ A;  2XFS A;  2WDT B;  1L5P A;  1KFX L;  4HPL B;  2JZP A;  1E9M A;  1QZM A;  2DEN A;  4CYE A;  1IP9 A;  2OUL A;  4IWO A;  1OQR A;  1QQW A;  2V1C A;  1ESF A;  2K25 A;  5DYG A;  3LJ3 A;  1IY2 A;  1J5E M;  2DXI A;  3I06 A;  2JZ0 A;  3DBR B;  5LXI B;  2AIM A;  1D0K A;  2G8J A;  2Y0Q A;  1T3Q A;  3PZ7 A;  1IXZ A;  1HXY D;  4JPS A;  1VEJ A;  2MRP A;  4I07 A;  4XK8 F;  2WBF X;  2A5Y B;  2KKC A;  2O01 F;  3KKU A;  2E00 A;  2J0M A;  3WA0 A;  3SYK A;  2VH2 A;  4MEM A;  1PXV A;  3HKP A;  1U9W A;  3RVV A;  1OAI A;  1N33 M;  5DPT A;  3RNV A;  3VK8 A;  3P4Q B;  1IN6 A;  2L0F A;  3TWM A;  4QNR A;  2R0I A;  4DMY A;  4A55 A;  3L29 A;  2KAN A;  1JR3 D;  2LVA A;  1LM8 B;  3OJ4 B;  3M95 A;  3VVW B;  3L54 A;  4LCD E;  1N75 A;  2ATO A;  6PAD A;  1OFI A;  2B3T A;  4FN2 A;  1TL9 A;  4BOS C;  2DZL A;  2J42 A;  3PHU A;  4W5W A;  3UQB A;  4BOZ A;  1XLN A;  3TCA A;  2R45 A;  3U61 A;  3N1X C;  5EGW A;  2YJC A;  2DWQ A;  2I38 A;  5CX3 A;  2XU5 A;  3PSE B;  1TF0 B;  5BYS A;  3JVZ X;  4HK2 A;  4DXF A;  2F7D A;  3GPY A;  2KFK A;  3K9O B;  5HFY A;  1WJN A;  3NG0 A;  1TYG B;  2L6O A;  4HVB A;  3Q2A C;  4P7I A;  2CEA A;  2YFQ A;  2P86 A;  2WZJ A;  4HPM B;  3KYD D;  4HKZ E;  5EJC A;  2CUZ A;  2LXE A;  1L2C A;  3AED B;  1N5W A;  3VR8 B;  3VXW A;  3HWS A;  2UXB M;  5LMU M;  3QIJ A;  4LGY A;  1OFH A;  2F5Q A;  3FRH A;  1T5X D;  4DR3 M;  4PYU A;  1Q5W B;  4P6V F;  4QAY A;  4WAF A;  2FUD A;  4L16 A;  2JWU A;  3FAH A;  4F7Z A;  5EP4 A;  1PJJ A;  1ZGU B;  1C9F A;  2YJ8 A;  2WU2 B;  4XYC A;  1A5R A;  2DNF A;  1DGB A;  1DGG A;  4MGK E;  1F2R C;  1M94 A;  4G0N B;  5BYQ A;  4N8W A;  3HX3 A;  1I7H A;  4RF1 A;  4G4Q A;  4B3T M;  1J19 A;  2MP2 B;  4K1R B;  2BWF A;  2MJD A;  2I2Y A;  3H7P B;  4NJC A;  2PRE A;  4LJ4 A;  3BC3 A;  4I5S A;  5LMN M;  1FEH A;  4ZRK A;  2C7M B;  2RDH A;  2DAG A;  4RF0 A;  3VK7 A;  3I4Y A;  3AE6 B;  3U2S C;  3H9D A;  2KAC A;  2LJ5 A;  5E6O A;  5BMH A;  3O65 A;  4NNJ B;  1P0R A;  3T9L A;  3GLH E;  3GRU A;  2BDZ A;  5CHV A;  2QBY A;  5C3J B;  4KZ0 A;  1QF6 A;  1E8Y A;  1IBL M;  3PTF C;  4DR5 M;  3ZDT A;  1T6O A;  1AEC A;  5EF4 A;  1SXJ D;  3GZN B;  2V9H A;  3QQ8 B;  2N7D A;  3W1S C;  4RFB A;  3FTC A;  4W9F A;  1PJQ A;  4PT5 A;  1SJE D;  1DGJ A;  4NJ7 A;  1IN7 A;  1EM7 A;  3ZXR A;  3K92 A;  1DGF A;  4K7C A;  4LJO B;  1XQQ A;  4F2L A;  1MEG A;  3SBJ A;  1IGC A;  1F4I A;  1XKG A;  2AL6 A;  2KFJ A;  3H4M A;  2SEB D;  1UH6 A;  3PRM A;  4IM2 A;  3MTN A;  3N3G A;  2APL A;  2EA0 A;  3I3T A;  1Q02 A;  3L25 A;  1R5L A;  1AYU A;  4GXB A;  1L6V A;  1VCB A;  2L2D A;  3PBH A;  2KN5 A;  1L0Y B;  1SXT A;  3SHF A;  2J4X A;  4BBN F;  1G4A E;  4CDC B;  1YN3 A;  4J3O D;  4X62 M;  2L7I A;  1ME4 A;  2KZS A;  4ANR A;  3PRZ A;  2ACT A;  1R4N I;  2VRR B;  1NL6 A;  4JL9 A;  2KRK A;  4I6L B;  3F5V A;  1L2D A;  1WMH A;  1E9S A;  4A3P A;  4I81 A;  1HNX M;  1YIW A;  1NLJ A;  3PZD A;  1WR6 E;  3CGW A;  4WWO A;  4Q2J A;  2WQY B;  2IBI A;  3BWK A;  1EF5 A;  2ZTD A;  2AL3 A;  2QC8 A;  4C4V A;  2NQG A;  2GB1 A;  3N32 A;  2OPF A;  4G50 A;  4MM3 A;  2DZM A;  1HQR D;  4XZ4 A;  1D2N A;  1ZXH A;  2QIL A;  1IBX A;  3OJ3 A;  5AZF A;  5EP1 A;  2RPQ A;  4J6I A;  4JI1 M;  1ROE A;  2I1J A;  2HD5 B;  4YTN B;  5KQ8 A;  2PJH A;  3Q6B A;  2BDL A;  3A4R A;  1TZO A;  3IG8 A;  4W4U A;  2MBE A;  3V76 A;  2FIF A;  2WXJ A;  1GJT A;  2K5P A;  2O6V A;  5ITR A;  3VUX A;  4XBO A;  2BTW A;  2DVW B;  4W9E A;  4B3R M;  1AAR A;  2KWD A;  4I05 A;  1EU3 A;  4QOZ C;  2XSZ D;  2GHU A;  1QIL A;  3OVZ A;  1TY2 A;  4FHK A;  4HXD A;  4URK A;  3KOZ E;  3U6D A;  1RWS A;  4JGH B;  4HEO A;  4N6E B;  2WXL A;  2DAI A;  1V9J A;  3HM3 A;  2PTL A;  1UBI A;  4GLS C;  3U5Z A;  3SR6 A;  1JWB D;  2D3B A;  3UQA A;  3QYE A;  2C9C A;  2WSF F;  1AW7 A;  2WP9 B;  2FTD A;  5HG2 A;  1W5T A;  4JI2 M;  2N9K A;  4EIW A;  3IV2 A;  1TKY A;  4NY0 A;  3DBH B;  1D6E C;  3BVM A;  2J53 A;  3W31 A;  3KSX A;  2FCQ A;  3VR9 B;  3MJW A;  1BP4 A;  1B9R A;  3N4C A;  1MS6 A;  1UFZ A;  1WXQ A;  1IN5 A;  2ZEQ A;  3KUC B;  4WA6 A;  1TS4 A;  4LZJ A;  4B08 A;  2CV1 A;  3KLS X;  5J94 A;  1FXI A;  2V1Y A;  4RCO A;  3ZXV A;  4BVU C;  4ANU A;  1YNT E;  2PE9 A;  1WX7 A;  2XNA C;  2G45 B;  4RGO S;  2KTR B;  5TR5 A;  4AJW A;  1PBH A;  1E7P B;  4TSS A;  2L4E A;  4OX9 M;  3Q8B A;  2HE7 A;  2KC2 A;  4IOI E;  2Z8Y M;  2AQ2 B;  4KIK A;  4I04 A;  3RPF C;  3GPP A;  1YQ3 B;  1YN4 A;  3PVL A;  3V61 A;  3K24 A;  3L0W B;  1N78 A;  3TEX A;  1IY0 A;  4MGH A;  2UWQ A;  2PPH A;  4Y28 F;  4ICU A;  3CST A;  3NVZ A;  2J7N A;  4W5B A;  3SMP A;  3I63 C;  1ZOY B;  2K8C A;  3P1M A;  2DCB A;  4OEL A;  1QAO A;  4GRI A;  3EFC A;  2JQR B;  5EZQ A;  5BR8 M;  1NDD A;  3FUW A;  4DK5 A;  4YV8 A;  2GNO A;  1OTR B;  3E56 A;  2WDR B;  4LZZ A;  3GS2 A;  1S4V A;  3U6M A;  3BWU D;  1WXA A;  3HM6 X;  2DYO A;  1S3S A;  1JAL A;  2J5Y A;  4FAD A;  2XGN A;  1OGW A;  3LDZ E;  2HJ8 A;  4IBC A;  3KYC D;  3V6E B;  1TJE A;  3W2D A;  1PGA A;  4DBG A;  1KJT A;  4DV7 M;  1A70 A;  3ZNZ B;  4TMA B;  3M62 B;  1XXG A;  4JWU C;  2DZN B;  1PGB A;  5F3W A;  4LFC M;  2JF5 A;  3PV1 A;  5KPR A;  4MT5 A;  4JXJ A;  1JR3 A;  1KLU D;  4X65 M;  4PDI A;  3BXW A;  2DZZ A;  3HD3 A;  2LVO A;  1ZUD 2;  1J7B A;  4XWW A;  2XLJ A;  3FYD A;  2ZBK B;  2DZJ A;  4HEA 1;  1P3Q U;  1WM3 A;  5L8R F;  4LF6 M;  2R2Q A;  3IEC A;  5DNY A;  1QOG A;  1CJE A;  4K7W A;  4NAW B;  4W9K A;  4WJP A;  3RNB C;  3KXE C;  1Z5A A;  3RNG C;  4K3B A;  2QNJ A;  1Q6K A;  1J7K A;  4G4N A;  3GB1 A;  2KJR A;  2UU7 A;  4K0K M;  5HI1 A;  2YEP F;  4M0W A;  2LWP A;  3DA1 A;  2MBB B;  2R65 A;  1N32 M;  2AYO B;  2C99 A;  5G5G A;  3AM9 A;  2KDM A;  2FNJ B;  8CAT A;  2DHR A;  3KP1 E;  1UF0 A;  1VG5 A;  2C5L C;  5E26 A;  1NEK B;  3B74 A;  2WXM A;  5C18 A;  3M0E A;  3IMA A;  1S3S G;  4BOP A;  3PNV A;  3IAS 1;  1XHB A;  5IRE B;  3M99 A;  5H37 D;  4ANV A;  1VSN A;  3PT2 A;  1WR1 B;  4LF8 M;  3HUI A;  2Q5W D;  2QIE B;  4GMQ A;  3M7G A;  1V86 A;  4S0R A;  3NY5 A;  4R71 A;  4GHL A;  2W3R A;  3BOW A;  2WXI A;  1GC7 A;  1X9Y A;  1OQQ A;  4OVZ B;  1MU5 A;  3QAU A;  2IYD B;  5CVM A;  5EE9 A;  2IO0 B;  1YZB A;  3SHQ A;  3NHE B;  2L3Z A;  1FPY A;  2BWE A;  3GLI A;  4DDG D;  2EJS A;  2LI5 A;  3Q3N C;  1P1A A;  4L78 A;  3NVY A;  1F9J A;  4L1B A;  1MJG M;  4CQN A;  1IN4 A;  4CZW A;  1VJK A;  2MWS B;  2IPP B;  4LJ9 A;  1CQD A;  3RFW A;  4G4O A;  5EXS A;  3ZW3 A;  1SXJ A;  2BS3 B;  3L10 B;  4YYW A;  3LVW A;  1N36 M;  1Z5C A;  1I4W A;  2V1U A;  1VZ7 A;  4XDD A;  4GN1 A;  3W5U B;  1WSP A;  3OG5 A;  1FMA D;  2K47 A;  1N61 A;  1A5T A;  4RKX A;  4NAM A;  3ZNI D;  3HHY A;  3IHP C;  1XLP A;  3B9J A;  2LBC A;  4PS8 A;  2QQ8 A;  1DOY A;  4MSX A;  4YYQ A;  4AWJ A;  1CK1 A;  4KDI C;  1RRB A;  1ZDX A;  2CIO A;  2C98 A;  3QX1 A;  4GDK B;  4K3C A;  4BKG A;  2ARY A;  1WJ6 A;  2UXC M;  4TQ1 A;  2Y5B A;  1MHX A;  3OTO M;  2C7N B;  2L05 A;  3AEA B;  1GG3 A;  1GVN A;  2TSS A;  3WAN A;  3A1Q A;  4BKS D;  1QUS A;  4GIT A;  3IFU A;  4BFR A;  1TKG A;  1Q0W B;  1XXH B;  2ERC A;  1PJT A;  1NVI D;  1VJV A;  2DZY A;  3MP2 A;  3VTW A;  2KHW B;  4QHT A;  2D3C A;  4IBG A;  1YD8 U;  2KDI A;  4IKG A;  2HHN A;  4LDT B;  2H88 B;  3I4V A;  1GCB A;  1PYW D;  4EUT A;  4GOC A;  5JHA A;  2KZU A;  2L7R A;  4QRG A;  4OU7 A;  2QEJ C;  1CMX B;  5FPW A;  3J2P B;  1NNU C;  2FFJ A;  2C9W B;  1FNW A;  1QAQ A;  1Z2M A;  5BMI A;  2CP8 A;  2ASQ A;  1L7Y A;  2AU1 A;  1R7S A;  5FK9 C;  1UEL A;  4LNI A;  4B9K A;  1RAX A;  2IY0 B;  3A33 B;  2O6X A;  4GH9 A;  2DC7 A;  3A98 B;  3M6A A;  1E90 A;  4MZO A;  1FH0 A;  4ZRQ A;  4GDL A;  3RNA C;  3WAP A;  1JWS D;  2QSF X;  2XF3 A;  3PNY A;  2CKH B;  2H7J A;  5IZ7 D;  3UJN A;  4TUW A;  3RVW A;  4KO8 A;  4W9D A;  1ZE3 D;  2XSZ A;  1DGH A;  3ZJV A;  4BLC A;  2YJB A;  1HTQ A;  3C19 A;  2JZZ A;  4MI7 A;  5AZH A;  3HHW A;  1YJ1 A;  1ME3 A;  4REZ A;  4AQY M;  3NZ3 A;  2J52 A;  3AE2 B;  4GGQ A;  4FXC A;  4IWQ A;  5JI2 E;  1EWL A;  2FH0 A;  5ITT A;  1FRR A;  3SDL C;  1VLB A;  3H1U A;  1TIF A;  5D3I B;  2H5X A;  1YUB A;  2ZPN A;  1V34 A;  3UZU A;  3DBL B;  2MJ5 B;  2BWB A;  2CS4 A;  1Q3C A;  2DHY A;  5EZS A;  2LAS A;  2Y20 A;  4X6I A;  1F77 A;  1TS5 A;  4KX6 B;  1QMY A;  4GC5 A;  2D5G A;  1C7Y A;  3TRK A;  1IFY A;  2CV0 A;  1OKS A;  4LJ8 A;  3VKH A;  1LQB A;  4WJN A;  3EA6 A;  2REX A;  2JXX A;  2KJ6 A;  2OJW A;  3DOW A;  3OLM D;  3H6S A;  1EUV B;  3BYY B;  3KUD B;  2M19 A;  3H4J A;  4AW4 A;  2UUA M;  5AUK A;  3OQC A;  3GRR A;  4NPN A;  4X6J A;  3ZLZ A;  1V1P A;  1WE6 A;  3R7Q A;  5G55 A;  4HLQ A;  3GLF A;  3PW3 A;  3MC0 B;  2CR5 A;  4A5U A;  3CIR B;  3K9P A;  3VDP A;  2QCZ A;  3U60 B;  2ICI A;  2BS4 B;  1CZP A;  3RT3 B;  2KQS A;  1P9D U;  4MDK E;  4IC7 B;  3DHG C;  4YTP B;  2Y3A A;  4LNF A;  2PIA A;  5JHB A;  3IBE A;  2KDF B;  3QHT A;  1STE A;  5FKA C;  4FVM A;  3C8Y A;  2E3T A;  2BYV E;  4LF9 M;  1NY6 A;  1XEE A;  3R2I A;  1QDR A;  3L2A A;  3BK2 A;  2NPT B;  3AE8 B;  3BY4 B;  1TS3 A;  4GSW A;  2AVW A;  3QCA A;  2G4S A;  3DHI C;  4IBB A;  4DHZ E;  1EWP A;  4FLH A;  3LCU A;  3PHW B;  2X4A A;  1WH3 A;  1Q10 A;  4RMA A;  1GC6 A;  3LFY A;  4JN6 A;  2VF8 A;  2JPH A;  3FIL A;  1XF5 L;  1D5Z C;  2XEW A;  2NS5 A;  3Q8A A;  5E6P A;  1GB1 A;  1NQC A;  3W9C B;  1JCK B;  1RM6 C;  2QSD A;  1SE2 A;  3HVD A;  1ZQ9 A;  4BOU A;  2CV2 A;  2FT2 A;  3A9K B;  1GOZ A;  4MGZ E;  1R4M B;  2KMM A;  1NBF C;  2LVP A;  1WWT A;  2J7Q C;  5JXV A;  3BPM A;  3ETR A;  1JML A;  1KFV A;  1PQS A;  2Y5P A;  4M00 A;  1XNQ M;  1E32 A;  4LFB M;  5EP3 A;  4ZRJ A;  3PS6 A;  2AQ1 B;  2RGO A;  3KSJ A;  3AE9 B;  1ZIV A;  5D3D A;  4PAD A;  4AOF A;  1SNK A;  3JAM S;  1MPE A;  2E02 A;  4P6E A;  3I51 A;  2OJR A;  2KEB A;  1YLA A;  1SE3 A;  2DAF A;  1GAB A;  3W1Y A;  2BWE S;  1C78 A;  1K3B B;  1IXS A;  1CUK A;  1V92 A;  2O2V B;  4XC2 A;  4USA A;  4GEW A;  1QZE A;  2WX0 A;  1XD3 B;  4M9X A;  1TR8 A;  1I4Q A;  4LNK A;  1C4P A;  2YJ9 A;  3C0R B;  5LLI A;  5IT9 S;  1C77 A;  2RGF A;  1CQV A;  1DOX A;  4XR7 A;  2PLP A;  5HHD G;  2MCN B;  2V4L A;  2W9N A;  3P5U A;  2DZK A;  5C1Z A;  1E10 A;  3KS4 A;  1SG9 A;  3RUI B;  4KGT A;  1F2B A;  3Q14 C;  4F1I A;  4TKN A;  2EMS A;  2IO2 B;  4MSM B;  5IO9 A;  2WDV B;  2BJW A;  1EU4 A;  1E7V A;  4WJO A;  3TEY A;  1SXJ E;  4Z6Y A;  4NL4 H;  1VDL A;  4GKJ M;  2JYT A;  1F2C A;  4QBB A;  3RYT A;  4OVU A;  2J7Q A;  4LCB A;  1MG4 A;  2QDF A;  2BPS A;  2R2O A;  4ASW C;  2F1G A;  3KH0 A;  4O1N A;  2JY6 A;  3RCZ A;  3VQI A;  5EXT A;  1DKI A;  2BBC A;  2CU1 A;  4NRW A;  3TMP B;  3R8F A;  4YSX B;  3TE6 A;  1A6R A;  4X57 B;  2KX3 A;  4UDU C;  4YSZ B;  3I04 M;  2G1E A;  1D4B A;  1L1Z A;  3EIH A;  4CJ6 A;  5CHV C;  2Z7J A;  2F5O A;  3GOE A;  2ZVN A;  1U4A A;  4DHJ D;  2E6X A;  2BYF A;  1AYF A;  4JI6 M;  4FJY A;  4BBA A;  2QHO B;  4IBD A;  1NYR A;  2M0A A;  4RGT A;  2MJ3 A;  1YAL A;  2FRA A;  2KA6 B;  4FHJ A;  3RZF A;  1XMQ M;  4R3D A;  2DWL A;  1P7F A;  2NMQ A;  4KKJ A;  2YVC A;  4AS1 A;  1NI2 A;  2ZZP B;  5FR6 A;  2R9M A;  4KDL B;  2RDB C;  1FNU A;  3A4S C;  2LMC A;  1Z5S B;  1FXA A;  3B2F A;  2DEN B;  5HKH A;  3ALB A;  2BVC A;  3N30 A;  4AXL A;  3GP7 A;  4HWI B;  2HWK A;  4AG5 A;  1KRH A;  4ARI A;  2XU1 A;  5FTL A;  4CDD B;  3RI7 C;  3B9P A;  4IUM A;  2N35 A;  2F5N A;  3Q8E A;  3FUV A;  1F1H A;  1UGJ A;  2Y5C A;  2N1W A;  4BKS A;  1BT0 A;  5L83 A;  3PHX A;  2E03 A;  4PP2 E;  2YQZ A;  2YJ2 A;  2CE7 A;  4EE2 A;  2ACZ B;  2LVQ A;  3FTD A;  1XT9 B;  3J7B A;  2DJG B;  1CB5 A;  2DKL A;  2I7P A;  3DQV A;  3U6P A;  1R4G A;  2MHJ A;  1U5I A;  2K9X A;  2NQI A;  4HJK A;  4FJZ A;  1DF0 A;  4XGI A;  2KMA A;  1WZ3 A;  4I4L A;  1YN5 A;  2MH8 A;  2KWU B;  1POP A;  3BCN A;  3K9M A;  1JRP A;  3GPX A;  3LW5 F;  1TH2 A;  2IGD A;  3BPF A;  2KXJ A;  4RGM A;  1ZMV A;  4FUL A;  2BT6 A;  2GBR A;  3P2B A;  3THG A;  2LJI A;  1GLN A;  2J7Q B;  4DXG A;  1ZMW A;  4BOZ B;  3U61 B;  1WRI A;  3L27 A;  2KQ7 A;  3RMK C;  5JA7 A;  3NUH B;  2NR2 A;  4Q8H A;  2D11 A;  3ABV B;  2R9N A;  2N0S B;  4OEM A;  4A3O A;  2Y6E A;  4RM9 A;  1SF0 A;  2PE6 B;  4FW9 A;  3J80 S;  1HZ5 A;  2KFK B;  1MHH E;  2DOS A;  5CVN B;  4P1C C;  4HPP A;  4CHK A;  3L26 A;  3U6C A;  4W9I A;  2EKE C;  3QT4 A;  3HRD D;  2M17 A;  3ZGZ A;  4ZYN A;  3AKZ A;  1J7A A;  1JQJ C;  1VD2 A;  3T1H M;  3O13 A;  3OIS A;  4N79 A;  3MHS D;  3WAL A;  1FNN A;  2QZ4 A;  2K9D A;  4JI7 M;  4M9S A;  2C9O A;  2PEA A;  4GKK M;  3H6N A;  3U7Z A;  1ICF A;  4FCV A;  1HQY E;  5MPO A;  3PO0 A;  3UK6 A;  2HJ1 A;  2V3N A;  3K8U A;  4N58 A;  3J7A S;  2R4J A;  2XFT A;  5C2T B;  3VAW A;  2WX1 A;  3APD A;  1XWI A;  2JX5 A;  2KMC A;  5IAA C;  4HRO A;  1E0Z A;  3MOR A;  3JR4 A;  4H2A A;  1L4D B;  4WW0 A;  1E8W A;  3QWZ B;  5D2M B;  4FWH A;  3VH4 B;  1DO2 A;  3AH7 A;  3GPU A;  2WXF A;  2WDQ B;  3SFD B;  3UIP B;  4K7U A;  3AMZ A;  4A20 A;  3DWM A;  4E71 A;  5J17 A;  1Y08 A;  2CJO A;  1C4C A;  4BAX A;  1WIV A;  2EKF A;  3CBJ A;  4HDO A;  1N5X A;  2K6D B;  3TWL A;  4AJY B;  3MTV A;  1RYJ A;  2DAE A;  1YOV B;  1NNJ A;  2YLM A;  4D81 A;  3NVV A;  4YYR A;  3DCG A;  3ZQ4 A;  1F0Z A;  4DDI D;  3GCB A;  1BXT A;  2JP7 A;  5DFL A;  3SMS A;  3WAO A;  4S12 A;  3IXS A;  3O65 B;  1WXM A;  2DC9 A;  3ONS A;  2M8S A;  4PCZ A;  1SEB D;  2Z59 B;  2QBY B;  2N9E B;  3AEB B;  1V81 A;  2MBH A;  4XX5 A;  1WIA A;  1AU0 A;  3HHA A;  4TUU A;  3Q3J A;  1HT2 E;  4P17 A;  4FJV B;  4ACF A;  4M8N A;  1FCL A;  3KFQ A;  2MGW A;  2JYE A;  4IBE A;  3U6E A;  4JI3 M;  2PBH A;  3WHL A;  3LXS A;  3UGB B;  4LY6 A;  4BQV A;  3HJS A;  1D3Z A;  2XK5 A;  3Q8G A;  4HWY A;  1YVB A;  1W5S A;  3FE3 A;  3BYT B;  4K7S A;  4L8R C;  1R2Y A;  1FO4 A;  3FKY A;  2PNS A;  2R9C A;  4BOQ A;  3HHX A;  2O5R A;  3PRM B;  3CH2 X;  1GUA B;  3MTN B;  2JTC A;  3I3T B;  3Q8C A;  4OW0 A;  4P6G A;  4LK0 M;  2BJV A;  2ZAM A;  4GMV A;  4FBJ B;  1XO3 A;  2LVO C;  2DBY A;  3PRP A;  2LRW A;  1HJP A;  4Z8X A;  4HCN B;  2DWM A;  3P4R B;  3PPA A;  4WUR A;  2WXO A;  1ZV1 A;  5C23 A;  4QNM A;  1QDQ A;  2JRI A;  1R4N B;  5FTN A;  2FUH B;  2QCU A;  3EC8 A;  1YX5 B;  2X38 A;  3QAR A;  4OZC A;  3JYU A;  2GBK A;  2HAK A;  2AGA A;  3E9S A;  3SAS A;  1NB3 A;  1WMH B;  4NQL B;  2D10 A;  1VDV A;  1GAQ B;  3IVF A;  3V6C A;  4XWT A;  1N60 A;  2HXZ A;  2L1A A;  2ZW1 A;  2OO9 A;  4W5C A;  1C76 A;  2IBI B;  3MFG A;  4C4V B;  1J09 A;  3JR5 A;  5IP4 D;  1UWM A;  3ILK A;  4MJS A;  3W5V B;  4MM3 B;  3NBI A;  2LEK A;  2JQG R;  3N3K A;  2N4F A;  1IBX B;  1JWM D;  3BBZ A;  3BII D;  4A3V B;  4D82 A;  4AP4 C;  5C1B A;  2KT7 A;  2LHE A;  5JI3 E;  1OAO C;  2XH9 A;  3PLU A;  4MB7 A;  5ITQ A;  4JYA M;  2E01 A;  1S1Q B;  2VZK B;  4JI4 M;  3L17 A;  3R3M A;  2IGG A;  1KXR A;  4L2Y A;  3A9J A;  2DC6 A;  4FWG A;  2O6V B;  3P5V A;  1ZCM A;  1KH0 A;  2BTW B;  5GMV A;  2AEH A;  4EZK A;  2P0R A;  1PJS A;  4BBN C;  1I4R A;  2CHQ A;  4HXD B;  2KHH A;  2KNB A;  3AE7 B;  3KX1 A;  3SYL A;  5J18 A;  2DAJ A;  3V3X A;  4DV2 M;  3U5Z B;  3I9V 1;  2WS3 B;  2RR9 A;  3MP9 A;  1IWD A;  2LRU A;  1FCC C;  3VLF B;  3V05 A;  1TH3 A;  3DBS A;  2OP3 A;  4WWP A;  1TZ1 A;  5J2R A;  3S3Q A;  3PXG A;  5FTJ A;  1GB4 A;  5JZE A;  1QUT A;  1TTE A;  3MHH A;  2LUM A;  2Z3X A;  2EO2 A;  3TNX A;  2CRU A;  1GL7 A;  2OOB A;  2G8L A;  1K50 A;  3AI5 A;  1TBE A;  3ZJT A;  3CSF A;  2N7J A;  1WYG A;  1L0V B;  2WXG A;  1SXJ C;  5A2Q S;  1PPD A;  1PDX A;  1GKI A;  2CHW A;  2C96 A;  1K52 A;  1UZX B;  2X49 A;  1HT1 E;  3QWL A;  3D6S A;  3D32 A;  1QXP A;  1IYF A;  1ZW7 A;  3C9P A;  3QK0 A;  3PGE A;  1KLG D;  4KIK B;  4BZA A;  4XDC A;  1YK7 A;  2R9O A;  4PS7 A;  4A90 A;  2INC C;  2JY8 A;  5LNK 1;  1I35 A;  1IUE A;  1UBQ A;  3KUZ A;  2Z8L A;  3ZVV A;  1KSF X;  1FD6 A;  1ATK A;  2BW2 A;  1E7U A;  1O0E A;  1SB3 C;  1AYV A;  4D80 A;  2LWX A;  4MGI E;  2BYT A;  1D0M A;  2G5G X;  3NBX X;  1XB2 B;  1V97 A;  2D7E A;  2KOX A;  4RKU F;  1EF1 A;  2K8B A;  3NS1 A;  4MGY E;  3QSD A;  3ML8 A;  2YNM D;  3H8B A;  2W82 A;  2RDG A;  1WGR A;  3FTF A;  4XE0 A;  2O25 A;  2G3Q A;  1NHW C;  2R62 A;  2KLC A;  2WXK A;  1R7R A;  2FS1 A;  3CBK A;  4DBG B;  4N9F 4;  3E21 A;  1PPP A;  2FE8 A;  2I1K A;  2BS2 B;  3KWL A;  2JY7 A;  4P16 A;  3HY5 A;  4W9G A;  1RFA A;  4C7Y A;  2JRH A;  3RE8 A;  2B3A A;  3AL0 C;  4IM0 A;  1QLB B;  1I4X A;  2XZU A;  3ZIM A;  1L1T A;  4QHS A;  1NJG A;  3BK1 A;  1GL6 A;  4B0M A;  1OEY J;  3SAV A;  3EIE A;  1E94 E;  4ZYS A;  1T3T A;  2HL7 A;  4G11 A;  3AV0 A;  3CH3 X;  1F2A A;  3GQ4 A;  3ZTC A;  1NV9 A;  1YK8 A;  2Z4S A;  4OHJ A;  3H7D A;  4EEW A;  2JZ3 B;  1K8R B;  3RVX A;  2UU9 M;  1UUP A;  1NVM A;  1QYR A;  3AV8 A;  3KQ4 A;  4ICV A;  4DHZ B;  4DUZ M;  3TL4 X;  3TBL D;  1Y4H A;  2WNM A;  3MK6 A;  3KS8 A;  3UGJ A;  4YHH M;  3N9Y C;  1ZAE A;  4ZUX U;  2R44 A;  4IBF A;  2FID A;  2K8H A;  4M0W B;  3LB8 C;  2L32 A;  3UIO B;  2ZAN A;  2JSV X;  5IKC M;  3MHS A;  2DAM A;  1YSY A;  2LVQ D;  1CTE A;  3MJ5 A;  2G9H D;  5A24 A;  1AUA A;  3KDS E;  1WY8 A;  2Z84 A;  2EUC A;  3LQR A;  3VTU A;  2AYN A;  4KT0 F;  2WXQ A;  2K39 A;  2L7H A;  3ZDM C;  2LHG A;  1PRB A;  4NJ6 A;  1TU6 A;  3LXF A;  3KW5 B;  3OWE B;  4NRV A;  3ZKJ C;  3RFZ B;  3AE5 B; 
#chains in the Genus database with same CATH homology
 4PDG A;  5E6J A;  2UUB M;  2PKO A;  2WXN A;  2QPA A;  3I57 A;  1HEZ E;  3BOS A;  3ZNH A;  5KPZ A;  4D8B A;  1NHG C;  3T3O A;  1TKE A;  2Y0T A;  1L0X B;  3KVW A;  5ITX A;  2BU3 A;  4L15 A;  2NQ8 C;  1KTK A;  3GLI B;  1I4H A;  3U6L A;  4RNA A;  1K51 A;  3W30 A;  1PVJ A;  2GI9 A;  1UNS A;  2W55 A;  2ON8 A;  5EE3 A;  3GLG A;  1SXJ B;  2XZF A;  4C80 A;  1QQR A;  1IQP A;  4RGN A;  1IN8 A;  2Z4R A;  3GLH A;  3HGI A;  3D8L A;  3CF0 A;  4HJG E;  2F4V M;  1PM5 A;  2J7O A;  3GQ3 A;  2OED A;  4BB9 A;  3CF6 E;  1IXR C;  3GO8 A;  1MX0 A;  3BVG A;  1HR0 M;  4AKG A;  2HCB A;  1HNZ M;  4GIP A;  4TQ0 A;  1LV7 A;  4B0E A;  5AUI A;  1ACC A;  4DV3 M;  1XCQ L;  2IDY A;  2PVO D;  2C5R A;  3GRY A;  2MH7 A;  4HKQ A;  4AKH A;  3HHZ A;  4WIP A;  4IJF A;  1XC8 A;  1YJI A;  4DV5 M;  1YE9 A;  1RFK A;  5FTK A;  4LLG M;  4NZL B;  1Y56 A;  2KRU A;  4YT0 B;  1V1O A;  5GKN A;  2V4I B;  1JWA D;  4GDL B;  3WCQ A;  4JI0 M;  1SE4 A;  4DV0 M;  3PSE A;  1Z6T A;  3T3N A;  1N62 A;  2OQ4 A;  1DGH B;  1IY1 A;  1PJI A;  4D8I A;  2CHV A;  3U6Q A;  4R7G A;  5EXX A;  4IJE A;  5FSW A;  4B7F A;  3ZCB B;  3ZH9 B;  4DQO C;  4IBJ A;  2IGH A;  1ZPS A;  3PFI A;  3HU1 A;  2KN4 A;  2K3U A;  3IG5 A;  1BUI C;  4B7G A;  2RKO A;  1K82 A;  5BPV A;  4JI5 M;  2INP E;  1K3W A;  2ONQ A;  2KXE A;  4IIW A;  1V1P B;  2DYM A;  5ITU A;  2LNH C;  4DV4 M;  3GLF B;  3AOE A;  4KOD A;  2YEP B;  1MVK A;  2W3S A;  3A42 A;  3LQQ A;  1VZ6 A;  4FCT A;  2KAJ A;  1G3I A;  3HVZ A;  4CGY B;  4D2K A;  2VII A;  1L4Z B;  4LF7 M;  3HJ8 A;  1IBM M;  4A8X C;  4DR6 M;  3AE3 B;  1D5X C;  3DZD A;  4HRS A;  5BMG A;  2P5T A;  3GQ5 A;  1QT9 A;  3FIL B;  1EWC A;  1HQC A;  4ZHO A;  1VR9 A;  3T15 A;  2H1R A;  4DV6 M;  4NXN M;  4WQM A;  1XCT L;  5I4D A;  1HZ6 A;  1L6U A;  2GRI A;  3SC3 A;  2INN E;  1ENF A;  3KOY E;  3RGP A;  1FRD A;  5H8Y E;  3FUX A;  3KOW E;  1FJG M;  3DWG C;  3BVZ A;  3KFU G;  1G41 A;  4JI8 M;  3FUU A;  4GC9 A;  4ZOH C;  1Z59 A;  1NEN B;  2R18 A;  2BTE A;  1IXS B;  1JWU D;  3LVV A;  3BBA A;  2Q2E B;  3W0F A;  1ZDV A;  2XN9 C;  3CWI A;  1IM2 A;  5ITX E;  4WH4 A;  3SAT A;  2F5S A;  4BOS A;  2L52 A;  3TEZ A;  3HU3 A;  4CIS A;  1L2B A;  1D5M C;  4FD2 A;  3K2L A;  5EQT A;  4JWS C;  4GUA A;  1K53 A;  2RGH A;  4DUY M;  1Q3B A;  1XLO A;  1ZP0 B;  2IJ0 A;  1SJH D;  2M5Z A;  1C4A A;  1UM8 A;  4ITQ A;  3TPZ A;  3Q8F A;  3GRV A;  4NOO B;  2W54 A;  1FNV A;  5FTM A;  1KFY B;  4MAC A;  3TSS A;  4ZHP A;  1WGK A;  3VRB B;  2F5P A;  1F2R I;  3ZYY X;  1QAN A;  3J81 S;  2B76 B;  4N59 A;  3T38 A;  1FIQ A;  2FOI C;  3P4P B;  2HHH M;  3Q69 A;  3NWL A;  7CAT A;  2BNK A;  3L28 A;  3VRA B;  1QVR A;  2R46 A;  1EWY C;  1KYI A;  2IPK D;  3LYY A;  4KGS A;  4L4U A;  2UUC M;  4CHT B;  3J27 B;  5FR3 A;  4LF4 M;  4ITK A;  4US9 A;  3NVW A;  3W1S A;  4FWD A;  3HU2 A;  1XLQ A;  1J7C A;  1NYQ A;  3P63 A;  2UXD M;  3SAU A;  1C79 A;  3FYC A;  5GXG B;  3TQS A;  3SEB A;  2LGI A;  5BYR A;  1FFV A;  1YQ4 B;  3T1Y M;  1NY5 A;  2VQF M;  3UMM A;  3UI3 A;  1SSN A;  3AE4 B;  2ZM6 M;  2QJL A;  4YSY B;  2R4E A;  4AKI A;  4IDI A;  4YWG G;  2LFI A;  4AQ7 A;  4PD2 A;  1VDD A;  2AX5 A;  3K1J A;  1QOB A;  1XMO M;  1AWD A;  2FNA A;  1YMH E;  1I4G A;  5D7G A;  3FTE A;  2KQ4 X;  1GPX A;  2JU6 X;  3MHV C;  3FD9 A;  1KF6 B;  1N34 M;  3FUT A;  1R6B X;  2VQE M;  3P42 A;  4ZPX A;  1Z5B A;  1QOF A;  2QP9 X;  1K3X A;  2SAK A;  2QEN A;  3FKE A;  1NSF A;  3AB5 A;  1P7E A;  3AEG B;  3HJQ A;  4XZX A;  2M56 B;  4LRS A;  1PFD A;  3R8B A;  5ITY A;  3W0L B;  1ZXI A;  2FBW B;  1I4P A;  1DO0 A;  5FLX S;  2NTT A;  1T6B X;  5KQD A;  3KOX E;  4OVZ A;  4KGR A;  3AN1 A;  4B7H A;  3LMM A;  2AHM A;  4KLN A;  4DR4 M;  1ET6 A;  3RGS A;  1H6U A;  1TDZ A;  3TWK A;  2V0G A;  4OZB A;  4C56 C;  2CU3 A;  4KKI A;  3Q8X A;  2V6Z M;  4GHA A;  1HA5 A;  4NSR A;  1JW9 D;  2WU5 B;  3P4S B;  5KO3 A;  2QMT A;  3U6O A;  4LTU A;  2YR0 A;  2JXT A;  2BB6 A;  4M9Z A;  2XEP A;  1TGU A;  4IP3 A;  2DZO B;  3FC4 A;  4JE3 B;  5EXP A;  1X37 A;  2OHF A;  3DFZ A;  1IGD A;  2EEL A;  5H92 C;  2JA2 A;  1DOI A;  1G8P A;  4A6Q A;  1B1Z A;  4I8O A;  4LJ5 A;  4AI6 A;  3SFZ A;  2PVG C;  3AEE B;  2EKI A;  5KPT A;  1XXH A;  2H89 B;  1TH4 A;  5G5H A;  2X8A A;  4NSO B;  2PMV A;  2K0P A;  4JV5 M;  1XNR M;  1FM0 D;  4B3S M;  1UWX A;  2DWN A;  2WLB A;  2RMM A;  1TY0 A;  4LGM A;  3R2T A;  1LO5 D;  2L83 A;  2I7N A;  1PGX A;  1TDH A;  3C58 A;  3H8H A;  1OFF A;  4HL4 A;  4AG6 A;  3CTW B;  2CHG A;  1QAM A;  4C7Z A;  1QOA A;  3ZJU A;  3B21 A;  1R2Z A;  3VDU A;  2FUG 1;  2K22 A;  3K8Z A;  3PVS A;  3NRZ A;  1G59 A;  4LFA M;  2WXR A;  3D8B A;  5EE0 A;  1IBK M;  4IBK A;  1E6E B;  1OJL A;  4A9A A;  2HKJ A;  3MHZ A;  4ZRP A;  5TSS A;  5EE1 A;  2WXH A;  1FFU A;  4RH6 A;  5EP2 A;  3SAW A;  4D8E A;  3URY A;  4LJ7 A;  3AE1 B;  1VRA B;  3SFE B;  3DOA A;  2R61 A;  3IT4 B;  4X66 M;  3L4P A;  3EGR A;  3U60 A;  1VZ8 A;  3AJI B;  2NTS A;  3VKG A;  3TEW A;  4L23 A;  3U4E G;  2MEK A;  3BB7 A;  4YXD B;  4LG2 A;  3CF2 A;  3BZD B;  3BY4 A;  4MH8 A;  3AFH A;  4LJ6 A;  2M60 A;  3J9C A;  3PHW A;  1QKZ A;  4ARC A;  1JQ4 A;  2PW9 A;  2D7H A;  4DR1 M;  3EUB 2;  1NJF A;  4QOS A;  2BB5 A;  1V8C A;  4ZTB A;  4JX1 C;  3SAR A;  2KW0 A;  4M0D A;  1DYQ A;  3IAM 1;  4G6Z A;  4YY3 M;  1AN8 A;  3E4R A;  3IT6 B;  3A46 A;  2ZW0 A;  1ET9 A;  2CFO A;  5DYI A;  2LH0 A;  4LJA A;  1MI0 A;  4LRT A;  1PUT A;  2N9L A;  4KHP M;  4YTM B;  1SBB B;  3B2G A;  4X64 M;  1BML C;  3AEC B;  2ZAO A;  4NXM M;  1UKF A;  2DWZ B;  3C0R A;  3U52 E;  2V3P A;  4DR2 M;  4DR7 M;  2VZK D;  2UZJ A;  1NI3 A;  2DLB A;  1EE8 A;  2E5L M;  1TS2 A;  1ORY B;  3A45 A;  1SIJ A;  2LHD A;  2HTM E;  3WHK A;  1E9R A;  2AQ3 B;  2L09 A;  3TMP A;  3AOE C;  1N63 A;  1M4V A;  4G4R A;  3R9X B;  1YJJ A;  1I94 M;  1C1K A;  3SHG B;  3VFD A;  5IWA M;  3KWV A;  4II7 A;  4DV1 M;  3KW6 A;  2D7G A;  4OZA A;  4LF5 M;  4FCW A;  3TUO A;  1HNW M;  3GLG B;  4IBI A;  3AEF B;  4US8 A;  2HDE A;  3PZ8 A;  1N77 A;  3AOG A;  1JRO A;  4MH0 E;  2WXP A;  4AZF A;  1L8Q A;  2MJE A;  3GLH B;  2CJN A;  3ZC7 B;  4B3M M;  1Q39 A;  3GP1 A;  2RPV A;  3KP0 E;  5T8I A;  2Y21 A;  3U6S A;  4WWM A;  2XFS A;  1L5P A;  2JZP A;  1E9M A;  1QZM A;  1OQR A;  1QQW A;  2V1C A;  1ESF A;  5DYG A;  1IY2 A;  1J5E M;  2DXI A;  2Y0Q A;  1T3Q A;  3PZ7 A;  1IXZ A;  1HXY D;  4JPS A;  2A5Y B;  3SYK A;  3HKP A;  1N33 M;  3RNV A;  3VK8 A;  3P4Q B;  1IN6 A;  3TWM A;  4QNR A;  4A55 A;  3L29 A;  1JR3 D;  1N75 A;  1OFI A;  2J42 A;  3PHU A;  4W5W A;  4BOZ A;  1XLN A;  2R45 A;  3U61 A;  2DWQ A;  2I38 A;  5BYS A;  4DXF A;  3GPY A;  5HFY A;  1TYG B;  2L6O A;  2CEA A;  2YFQ A;  4HKZ E;  5EJC A;  2CUZ A;  2LXE A;  1L2C A;  3AED B;  1N5W A;  3VR8 B;  3HWS A;  2UXB M;  5LMU M;  4LGY A;  1OFH A;  2F5Q A;  1T5X D;  4DR3 M;  4P6V F;  4WAF A;  4L16 A;  2JWU A;  3FAH A;  5EP4 A;  1PJJ A;  1C9F A;  2WU2 B;  1DGB A;  1DGG A;  4MGK E;  1F2R C;  5BYQ A;  1I7H A;  4RF1 A;  4G4Q A;  4B3T M;  2MJD A;  2I2Y A;  4NJC A;  4LJ4 A;  4I5S A;  5LMN M;  1FEH A;  2RDH A;  4RF0 A;  3VK7 A;  3I4Y A;  3AE6 B;  3U2S C;  2KAC A;  5BMH A;  3O65 A;  3GRU A;  2QBY A;  5C3J B;  1QF6 A;  1IBL M;  4DR5 M;  1SXJ D;  4RFB A;  3FTC A;  4PT5 A;  1SJE D;  1DGJ A;  1IN7 A;  1EM7 A;  3K92 A;  1DGF A;  3SBJ A;  1IGC A;  3H4M A;  2SEB D;  3PRM A;  2EA0 A;  3L25 A;  1L6V A;  1L0Y B;  1SXT A;  3SHF A;  2J4X A;  1G4A E;  1YN3 A;  4J3O D;  4X62 M;  2L7I A;  2KZS A;  2KRK A;  1L2D A;  1E9S A;  4I81 A;  1HNX M;  4Q2J A;  2WQY B;  2GB1 A;  2OPF A;  1HQR D;  1D2N A;  1ZXH A;  2QIL A;  1IBX A;  5EP1 A;  4JI1 M;  1ROE A;  4YTN B;  5KQ8 A;  1TZO A;  3IG8 A;  2WXJ A;  2K5P A;  5ITR A;  4XBO A;  2BTW A;  2DVW B;  4B3R M;  2KWD A;  1EU3 A;  4QOZ C;  2XSZ D;  1QIL A;  1TY2 A;  3KOZ E;  3U6D A;  1RWS A;  4N6E B;  2WXL A;  2PTL A;  4GLS C;  3U5Z A;  3SR6 A;  1JWB D;  2C9C A;  1AW7 A;  2WP9 B;  5HG2 A;  1W5T A;  4JI2 M;  2N9K A;  4EIW A;  1TKY A;  1D6E C;  3BVM A;  2J53 A;  3W31 A;  3KSX A;  3VR9 B;  1B9R A;  1WXQ A;  1IN5 A;  1TS4 A;  4LZJ A;  4B08 A;  2CV1 A;  3KLS X;  1FXI A;  4RCO A;  1YNT E;  2XNA C;  4RGO S;  1E7P B;  4TSS A;  4OX9 M;  3Q8B A;  4IOI E;  2AQ2 B;  3RPF C;  3GPP A;  1YQ3 B;  1YN4 A;  1N78 A;  3TEX A;  1IY0 A;  4MGH A;  3NVZ A;  2J7N A;  3SMP A;  1ZOY B;  3P1M A;  1QAO A;  4GRI A;  2JQR B;  5EZQ A;  5BR8 M;  3FUW A;  3E56 A;  2WDR B;  4LZZ A;  3GS2 A;  3U6M A;  3BWU D;  2DYO A;  1S3S A;  1JAL A;  2XGN A;  4IBC A;  1TJE A;  3W2D A;  1PGA A;  4DV7 M;  1A70 A;  4TMA B;  1XXG A;  4JWU C;  2DZN B;  1PGB A;  5F3W A;  4LFC M;  5KPR A;  4MT5 A;  4JXJ A;  1JR3 A;  1KLU D;  4X65 M;  4PDI A;  1ZUD 2;  1J7B A;  4XWW A;  2XLJ A;  3FYD A;  2ZBK B;  4HEA 1;  4LF6 M;  1QOG A;  5DNY A;  4NAW B;  1CJE A;  3KXE C;  1Z5A A;  1J7K A;  4G4N A;  3GB1 A;  4K0K M;  5HI1 A;  2YEP F;  4M0W A;  3DA1 A;  2R65 A;  1N32 M;  2C99 A;  5G5G A;  3AM9 A;  2KDM A;  8CAT A;  2DHR A;  3KP1 E;  5E26 A;  1NEK B;  2WXM A;  5C18 A;  3M0E A;  4BOP A;  3PNV A;  3IAS 1;  1XHB A;  5IRE B;  5H37 D;  3PT2 A;  3HUI A;  4LF8 M;  2Q5W D;  2QIE B;  4GMQ A;  3M7G A;  4GHL A;  2W3R A;  2WXI A;  1OQQ A;  4OVZ B;  1MU5 A;  3QAU A;  5EE9 A;  1YZB A;  3GLI A;  4L78 A;  3NVY A;  4L1B A;  4CQN A;  1IN4 A;  1VJK A;  4LJ9 A;  3RFW A;  4G4O A;  5EXS A;  1SXJ A;  2BS3 B;  3LVW A;  1N36 M;  1Z5C A;  1I4W A;  2V1U A;  1VZ7 A;  4XDD A;  3W5U B;  1WSP A;  1FMA D;  2K47 A;  1N61 A;  4RKX A;  4NAM A;  3HHY A;  1DOY A;  3B9J A;  1XLP A;  1CK1 A;  1ZDX A;  2C98 A;  4GDK B;  2UXC M;  4TQ1 A;  1MHX A;  3OTO M;  3AEA B;  1GVN A;  2TSS A;  4GIT A;  3IFU A;  1TKG A;  1XXH B;  2ERC A;  1NVI D;  3MP2 A;  4QHT A;  4IBG A;  4IKG A;  2H88 B;  3I4V A;  1PYW D;  2KZU A;  4OU7 A;  2QEJ C;  3J2P B;  1NNU C;  2FFJ A;  1FNW A;  1QAQ A;  5BMI A;  1R7S A;  5FK9 C;  4GH9 A;  3A98 B;  3M6A A;  4ZRQ A;  1JWS D;  2XF3 A;  3PNY A;  5IZ7 D;  3UJN A;  4TUW A;  4KO8 A;  1ZE3 D;  2XSZ A;  1DGH A;  3ZJV A;  4BLC A;  4MI7 A;  3HHW A;  4REZ A;  4AQY M;  3NZ3 A;  2J52 A;  3AE2 B;  4FXC A;  5JI2 E;  5ITT A;  1FRR A;  1VLB A;  5D3I B;  1YUB A;  3UZU A;  1Q3C A;  5EZS A;  2Y20 A;  1F77 A;  1TS5 A;  4KX6 B;  4GC5 A;  2D5G A;  3TRK A;  2CV0 A;  4LJ8 A;  3VKH A;  3EA6 A;  3BYY B;  2M19 A;  4AW4 A;  2UUA M;  5AUK A;  3OQC A;  3GRR A;  1V1P A;  4HLQ A;  3GLF A;  3MC0 B;  4A5U A;  3CIR B;  3VDP A;  3U60 B;  2ICI A;  2BS4 B;  1CZP A;  4YTP B;  2Y3A A;  2PIA A;  1STE A;  5FKA C;  4FVM A;  3C8Y A;  2E3T A;  4LF9 M;  1NY6 A;  1XEE A;  3R2I A;  3L2A A;  3BK2 A;  3AE8 B;  1TS3 A;  4IBB A;  2X4A A;  1Q10 A;  4JN6 A;  3FIL A;  1XF5 L;  1D5Z C;  3Q8A A;  1GB1 A;  3W9C B;  1JCK B;  1RM6 C;  2QSD A;  1SE2 A;  3HVD A;  1ZQ9 A;  4BOU A;  2CV2 A;  1GOZ A;  4MGZ E;  2KMM A;  2J7Q C;  1WWT A;  5JXV A;  3ETR A;  1JML A;  1KFV A;  2Y5P A;  1XNQ M;  1E32 A;  4LFB M;  5EP3 A;  2AQ1 B;  2RGO A;  3KSJ A;  3AE9 B;  5D3D A;  3JAM S;  1MPE A;  3I51 A;  2KEB A;  1SE3 A;  1C78 A;  4USA A;  4M9X A;  1I4Q A;  1C4P A;  5IT9 S;  1C77 A;  1CQV A;  1DOX A;  2PLP A;  5HHD G;  1E10 A;  3KS4 A;  4KGT A;  2WDV B;  2BJW A;  1EU4 A;  3TEY A;  1SXJ E;  4Z6Y A;  4NL4 H;  4GKJ M;  2JYT A;  2J7Q A;  4LCB A;  4O1N A;  3VQI A;  5EXT A;  1DKI A;  2BBC A;  4NRW A;  4YSX B;  3R8F A;  3TE6 A;  4UDU C;  4YSZ B;  2G1E A;  1D4B A;  1L1Z A;  3EIH A;  2Z7J A;  2F5O A;  2E6X A;  1AYF A;  4JI6 M;  4BBA A;  4IBD A;  1NYR A;  2M0A A;  4RGT A;  2MJ3 A;  2KA6 B;  1XMQ M;  4R3D A;  2DWL A;  1P7F A;  2NMQ A;  4KKJ A;  4AS1 A;  1FNU A;  2LMC A;  3B2F A;  1FXA A;  3GP7 A;  2HWK A;  4AG5 A;  1KRH A;  4ARI A;  5FTL A;  3B9P A;  4IUM A;  2F5N A;  3Q8E A;  3FUV A;  1UGJ A;  2Y5C A;  3PHX A;  2YQZ A;  2CE7 A;  4EE2 A;  2ACZ B;  3FTD A;  3J7B A;  2I7P A;  3U6P A;  2K9X A;  4XGI A;  4I4L A;  1YN5 A;  1JRP A;  3GPX A;  1TH2 A;  2IGD A;  4RGM A;  2BT6 A;  3THG A;  2LJI A;  1GLN A;  4DXG A;  3U61 B;  1WRI A;  3L27 A;  3NUH B;  3ABV B;  2N0S B;  1SF0 A;  4FW9 A;  3J80 S;  1HZ5 A;  2DOS A;  1MHH E;  3L26 A;  3U6C A;  3HRD D;  3ZGZ A;  3AKZ A;  1J7A A;  1JQJ C;  3O13 A;  3T1H M;  1FNN A;  2QZ4 A;  4JI7 M;  4M9S A;  2C9O A;  3U7Z A;  4GKK M;  4FCV A;  1HQY E;  5MPO A;  3PO0 A;  3UK6 A;  2V3N A;  4N58 A;  3J7A S;  2R4J A;  2XFT A;  5C2T B;  1XWI A;  2JX5 A;  4HRO A;  1E0Z A;  3JR4 A;  4H2A A;  1L4D B;  4WW0 A;  4FWH A;  1DO2 A;  3AH7 A;  3GPU A;  2WXF A;  2WDQ B;  3SFD B;  3AMZ A;  3DWM A;  2CJO A;  1C4C A;  1N5X A;  3TWL A;  3MTV A;  1RYJ A;  1NNJ A;  4D81 A;  3NVV A;  3ZQ4 A;  1F0Z A;  1BXT A;  3SMS A;  4S12 A;  3IXS A;  4PCZ A;  1SEB D;  2QBY B;  3AEB B;  1HT2 E;  1FCL A;  2JYE A;  4IBE A;  3U6E A;  4JI3 M;  3WHL A;  4LY6 A;  3HJS A;  1W5S A;  3BYT B;  4L8R C;  1R2Y A;  1FO4 A;  4BOQ A;  3HHX A;  2O5R A;  2JTC A;  3Q8C A;  4OW0 A;  4LK0 M;  2BJV A;  2ZAM A;  1XO3 A;  2DBY A;  3PRP A;  4Z8X A;  2DWM A;  3P4R B;  4WUR A;  2WXO A;  4QNM A;  2JRI A;  5FTN A;  2QCU A;  2X38 A;  4OZC A;  2AGA A;  3E9S A;  3SAS A;  1VDV A;  1GAQ B;  4XWT A;  1N60 A;  2L1A A;  2ZW1 A;  1C76 A;  3MFG A;  1J09 A;  3JR5 A;  1UWM A;  3ILK A;  3W5V B;  4MM3 B;  3NBI A;  2LEK A;  1IBX B;  1JWM D;  3BII D;  4A3V B;  4D82 A;  5C1B A;  2LHE A;  5JI3 E;  2XH9 A;  4MB7 A;  5ITQ A;  4JYA M;  2VZK B;  4JI4 M;  2IGG A;  4L2Y A;  4FWG A;  1KH0 A;  2BTW B;  1I4R A;  2CHQ A;  4HXD B;  3AE7 B;  3SYL A;  3V3X A;  4DV2 M;  3U5Z B;  3I9V 1;  2WS3 B;  3MP9 A;  1FCC C;  3VLF B;  3V05 A;  1TH3 A;  3PXG A;  5FTJ A;  1GB4 A;  5JZE A;  2LUM A;  2Z3X A;  2EO2 A;  1GL7 A;  1K50 A;  2G8L A;  3ZJT A;  2N7J A;  1WYG A;  1L0V B;  2WXG A;  1SXJ C;  5A2Q S;  1PDX A;  1GKI A;  2C96 A;  1K52 A;  2X49 A;  1HT1 E;  3QWL A;  1KLG D;  4XDC A;  4A90 A;  5LNK 1;  1IUE A;  2Z8L A;  1KSF X;  1FD6 A;  2BW2 A;  1SB3 C;  4D80 A;  2LWX A;  4MGI E;  2BYT A;  2G5G X;  1V97 A;  2D7E A;  3NS1 A;  4MGY E;  2YNM D;  2W82 A;  2RDG A;  3FTF A;  4XE0 A;  1NHW C;  2R62 A;  2WXK A;  1R7R A;  2FE8 A;  2BS2 B;  3KWL A;  4P16 A;  4C7Y A;  3RE8 A;  3AL0 C;  1QLB B;  1I4X A;  2XZU A;  1L1T A;  4QHS A;  1NJG A;  3BK1 A;  1GL6 A;  4B0M A;  3SAV A;  3EIE A;  1E94 E;  4ZYS A;  1T3T A;  2HL7 A;  3AV0 A;  3GQ4 A;  2Z4S A;  4OHJ A;  2UU9 M;  1UUP A;  1NVM A;  1QYR A;  3AV8 A;  3KQ4 A;  4DUZ M;  3TL4 X;  2WNM A;  3MK6 A;  3KS8 A;  3UGJ A;  4YHH M;  3N9Y C;  1ZAE A;  4IBF A;  3LB8 C;  2L32 A;  2ZAN A;  2JSV X;  1YSY A;  3MJ5 A;  2G9H D;  3KDS E;  2Z84 A;  2EUC A;  3LQR A;  2WXQ A;  2L7H A;  3LXF A;  3OWE B;  4NRV A;  3RFZ B;  3AE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...