4RF0A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p6522)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
318
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Protein binding
molecule keywords ORF1ab protein
total genus 78
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf0A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf0A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf0A03
2FE8A 4REZA 3E9SA 4RF1A 4OVZA 4WURA 4R3DA 5KO3A 3MP2A 4OVZB 4PT5A 4MM3B 4OW0A 4P16A 3MJ5A 4RF0A 4RNAA 5E6JA 4M0WA
chains in the Genus database with same CATH superfamily
2AQ1B 1OTRA 1THEA 3SAVA 2BJVA 4XZXA 3R9XB 2IPKD 5FR6A 1NLJA 2R9NA 2LJIA 1PFDA 1GC6A 2BQQA 5HHDG 3NVVA 2WXOA 1XD3B 2P0RA 3AV0A 3VRBB 2LTUA 1AN8A 2HHNA 1Z5CA 2FUG1 1R4MI 2AL3A 4FJCA 3OJ4B 1E94E 1K51A 4WP2A 2QENA 1IN8A 3RNVA 2K9DA 3PVSA 2KVZA 4BLCA 2D10A 3U4EG 1R6BX 4IC7B 1BT0A 4DV4M 3AE1B 2ZEQA 3VUWA 3KKUA 2GBRA 3GB1A 1WE6A 4BKGA 3KVWA 5ITXA 2JUOA 3DVGX 3PS6A 1Y8RC 3LXSA 4X66M 1N5XA 4KSLC 2DNFA 2HJ1A 3P2BA 4I4LA 4RKXA 1C77A 4W4UA 4HPPA 4ZDVA 1IYFA 1AU2A 1P3QQ 1YE9A 4DBGB 4WJPA 1OKSA 2XFTA 3BB7A 3J81S 3UMMA 3B2FA 1J8CA 2LGIA 4M8NA 1SXJC 3QCAA 2LXCA 1ZDVA 2C0YA 3NRZA 2KHHA 3HM6X 4GIVA 1SG9A 5KPTA 2RPQA 1QAMA 2K3UA 4CZWA 2KMCA 2KYWA 3B7ZA 1PUTA 2KO3A 3U6PA 3CF0A 2MP2A 3IVFA 2DYMA 3SR6A 4WJNA 1DF0A 1V86A 1TS2A 3AEBB 3OF9A 2VZKD 1GKIA 1J09A 4GHAA 2NCNA 4XWTA 2FT2A 4GOCA 2LHCA 1TS4A 1EU3A 2WU2B 1XMQM 2DWMA 1V9JA 4BS5A 1PDXA 4IBFA 2YNMD 2CKHB 3LQQA 3RFZB 4HPMB 1EO6A 4NOOB 2JZZA 4ASWC 1N33M 2WXGA 2RSUA 3H7SA 1YUBA 2N7JA 3ZNZB 4RY2A 3IG5A 3VXWA 3WXFA 2HWJA 3AOGA 1M6DA 1E9RA 1TDHA 2D7GA 1GL7A 2EMSA 2LRUA 3Q3FA 5H92C 1R4NI 2ACTA 1GJSA 1FCLA 1L2BA 1QAQA 3SMPA 1JROA 2G3QB 2L0TA 3GE8C 2BTWA 3SASA 3N3KB 4QOSA 3BVZA 4HL4A 4YWGG 2DC7A 4CJ6A 2LHGA 1J7KA 2DWNA 3AE9B 3TCAA 4ARIA 2MBEA 4LNNA 4PI3A 1XNQM 4JI0M 2DX5B 1S3SG 2IPPB 2BNKA 3F92A 3M0EA 1SJED 3GLIA 4YYVA 1G59A 2K1FA 4AZFA 2WP9B 2A5UA 3ZUNA 3WANA 1IP9A 2MJ5B 2ERCA 2J53A 2FO5A 2L83A 4C80A 1OQRA 2JWSA 1IXZA 1JRPA 4M9ZA 4BOPA 1GJTA 2KFJA 4MH8A 2KLCA 2HWKA 3EECA 1E8YA 2NBWB 1XKGA 4L78A 1FRDA 3J7BA 3HM3A 4NZLB 4ANWA 4ITQA 5LNK1 5KQDA 4DMXA 3KWBX 1JQPA 3P5XA 3LB8C 1MEMA 2MLBA 3UK6A 4KIKA 3H89A 1IWDA 2WXIA 4B6WA 4C00A 4USAA 5BYQA 1GLOA 3RNAC 4JYAM 3NVZA 3FTFA 2CWBA 1SF0A 1DEUA 2M5ZA 3USVA 1QDQA 1SIJA 3HD3A 2XN9C 3DQVA 2X8XX 1Z5SB 4MT5A 4E74A 3DBSA 2JXTA 2RGFA 4A5UA 3N32A 3DCGA 2IGDA 2M8SA 2RDBC 3KX1A 2KNZA 1A5TA 2GI9A 4PCZA 4NPNA 4DMYA 3NZUA 5JZEB 2SEBD 5T8IA 1YZBA 3NHEA 4BPVA 1WGYA 2C60A 5EGWA 2C9WB 4TUUA 3A46A 2O6XA 2V4LA 1HE8A 1V81A 2LVAA 2D3AA 2WX1A 3NOBA 5AUIA 4LZZA 3ZCBB 4PD2A 1LM8B 4HDQA 1B1ZA 1YX5B 4MH0E 4B0EA 5C1ZA 3M99A 5E6JA 1TS3A 2QEJC 3Q8GA 2I1KA 5MPOA 3PZDA 3SMSA 5IWAM 3GP7A 2R65A 5JHAA 1KFYB 2EJSA 1CQDA 3NS1A 3LW5F 1ZIVA 1JWMD 3FUUA 3GZNI 2CHVA 3JSVA 2JWUA 2UXCM 1E10A 2JUJA 2DZKA 5LLIA 3FILA 3QK0A 3T3NA 1HR0M 4G3XB 2J42A 3WHLA 1DV0A 4NJCA 3A1QB 4J3OD 3RPFC 2MH8A 4GC9A 3U61A 1YD8U 1GMYA 4WIPA 4J6IA 8PCHA 1DOXA 2K5PA 4NRWA 2G1EA 3K24A 3KSEA 3V6CB 4ARCA 1ACCA 2MBQA 4AJWA 5KPZA 5DPTA 2KKCA 4ANVA 2GNOA 2UXDM 2LNHC 3IXSA 2CV1A 1HNWM 3H7PB 4Q8GA 1H6UA 4LNKA 3P4RB 2NTSA 4LTUA 2ON8A 1IBMM 4ZRJA 2KQ4X 1D6EC 2ZCCA 1X1MA 4K7WA 3L26A 2JVCA 4I8OA 3HHYA 2O5RA 1JWUD 2V1CA 1GAQB 1RRBA 2DHZA 5BMGA 4XR7A 3AH7A 3SDLC 4MSMB 1CS8A 4II3B 1NY6A 1UBIA 3AE2B 4JI7M 5IA7A 4ZRPA 2BYTA 1C9FA 4NY0A 1MPEA 3MJWA 2WNMA 2DAMA 2LASA 2NBUA 2WDTB 2FH0A 1XF5L 1KH0A 1R7RA 2JZ0A 2IO2B 2INCC 3BYYB 1XXGA 1FFUA 2G4SA 1R4NB 2JRHA 3E1ZB 5BPVA 1YN5A 3APDA 9PAPA 2P7UA 2M56B 2BBCA 3DHIC 2EA0A 5A2QS 3KW6A 2LVPC 5DYIA 2QCZA 3DBHB 1GL6A 3EIHA 1HXYD 3HVDA 3AI8A 2QIEB 1VZ7A 1T6BX 2LUEA 3FRIA 2ARYA 2WYQA 2VZKB 3IV2A 2R9OA 2BWBA 3MK6A 1VSNA 3ZC7B 3ZH9B 1NV9A 3P4SB 1E90A 1XLQA 3K92A 4KIKB 4JPSA 1CZPA 1UFZA 1HEZE 4L6V6 1CTEA 4RMAA 3APCA 4MGKE 1TYGB 3ZO5B 3C58A 4L8RC 2L2DA 1FNWA 2BTEA 4I07A 1MN3A 3KVFB 5KQ8A 1Q0WB 2WSCF 4LNOA 2Z0EB 3M95A 1PRBA 4LNIA 1WZ0A 4XDDA 2WXFA 2NVUI 2H88B 2KJRA 1T0QC 3IT4B 2O01F 5EP1A 5EP3A 3AI5A 3CSTA 5AUKA 4AWJA 1GCBA 4GMQA 3FUTA 4TQ1A 2BB5A 3NZ3A 4IW0A 4DUYM 4OW0A 1PPPA 5DFLA 3AB5A 3AOEA 1L6VA 4DV1M 1I4GA 2Z4SA 1QDRA 2VF7A 2KXJA 3HY5A 5FK9C 4P6EA 2BJWA 1ZMWA 4A55A 1AYFA 2KACA 1SE2A 3P4PB 3MC0B 4KX6B 2WBFX 1ZAEA 3ZVVA 3GLHE 4QRXA 3W9CB 2Y6EA 3P42A 3CF6E 4M01A 4RH6A 2IZVB 2W9NA 2XK5B 2E01A 1SEBD 1OAIA 3GP1A 3P5VA 3TJPA 3PNYA 4B7HA 1JR3E 1DGHA 3NBXX 5FKAC 2KEBA 1TY2A 2J7QC 1Q39A 1EWOA 4DV5M 3H8BA 4AW4A 1E5WA 3B9JA 5JHBA 3AEAB 2JTCA 2ASQA 4NNJB 1D0KA 2CFOA 4L16A 4R71A 2LI5A 3KP0E 2I1JA 2K47A 2DENA 4DUZM 4KKIA 3FTDA 3KWZA 1WXVA 2REXA 2FFJA 1RM6C 4LFCM 2LGSA 1GPXA 1N75A 1VRAB 3KWLA 4N9F4 1QOGA 1HT2E 2FRAA 1EUVB 4FN2A 3H7PA 3QJ3A 2W82A 2YJBA 2QHOB 1D3ZA 2AVWA 2V1YA 5LXIB 4KODA 4YTNB 1TL9A 4YSXB 2L05A 3P1MA 4K3BA 2L3ZA 1FD6A 2VQEM 2AQ3B 3N3GA 3GPYA 3R3MA 1DGBA 2BS3B 3W5VB 2XNAC 4W9KA 2ONQA 1QQWA 2J7OA 1QANA 2C5RA 5HG2A 1DKIA 4BOSC 3QAUA 2VDBB 4AG6A 4BBNC 4BAXA 1POPA 4IM2A 3VUYA 4IM0A 4B0MA 4BOZB 2JF5A 4DV3M 4HLEA 4CHKA 1K53A 3ENEA 4A9AA 4HLQA 1RYJA 4RF1A 3RNCC 4FULA 3D8LA 1FRRA 2L76A 2PJHA 3GOEA 4M9SA 1VZ8A 2GMIC 4AXLA 2FS1A 3MMPA 1VDDA 3SATA 4PDIA 3RGPA 4Y28F 4IUMA 2LGXA 2XEWA 3BXWA 3SFDB 1NSFA 3LJ3A 2H5XA 2BYFA 2ICIA 5D94A 2IJ0A 1GVNA 2CJOA 1F2RC 4K7UA 2JT4B 3J27B 1Y56A 3GLIE 3SAWA 1OQQA 5ITTA 4KKJA 3X0WA 2JQGR 1MHHE 3CH3X 2K8BA 1VDLA 2VH2A 5EZQA 2EKEC 4UDUC 4EEWA 4YT0B 1V34A 2KWVB 2UYZB 3S3RA 3FUXA 2J7QA 4GB9A 2PVGC 3AE4B 3PT2A 4IP3A 1XXHE 2D7HA 3ZNID 3MFGA 4AKGA 1EE8A 4X6IA 4HCPB 2BT6A 5D2MB 5DPWA 2N9PC 4RM9A 3UGJA 1KFXL 1ZV1A 4W5CA 4KLNA 1WI0A 3NVWA 3TWMA 1PPNA 4FCTA 4I05A 2JU6X 2M19A 1DO2A 3ZJVA 1J0GA 3PO0A 1Q3BA 3GPUA 3NY5A 5BR8M 1PVJA 2MBOA 2PTLA 3WHKA 3BK1A 2P86A 1Z5AA 1PM5A 2LUMA 1YMHE 4ZUXU 1D0LA 4FWGA 3K9PB 1F52A 2ZPNA 2AQ2B 3W67A 3O65A 2CU1A 2GB1A 2KQ7A 3I5JC 4YL8A 3N1YC 1WZ3A 2KN4A 4HEOA 1WX7A 1Z5BA 3SC3A 4HJGE 5HKHA 4DV0M 2ZBKB 1I4XA 2FIFA 4KGSA 2F5NA 2DXIA 1XLOA 2JXXA 3SAUA 3NVYA 1Y4HA 1FNVA 1GOZA 2N7EA 1WGDA 3L08A 4IWQA 5CHVC 5BYSA 4MSXA 4P1CC 4YYQA 4K7CA 2KA6B 3VQIA 2JP7A 3HRDD 5DPSA 5TSSA 2QCUA 2IO0B 3SFZA 1Z59A 1IBXA 4NSRA 4ICVA 1OFIA 3QA8A 5JZEA 3QIJA 3DBLB 3K1JA 3HKPA 4GSWA 1CJLA 2G7YA 3HVZA 2KK8A 2FCQA 4NRVA 3IOQA 1XXHA 2FCMA 1FM0D 5EP4A 4LF4M 1SXJD 4HWYA 4S12A 2BB6A 1LV7A 2UWQA 3DBLI 3PREA 3UJNA 4JI2M 4MB7A 4M0WA 1VDVA 1TZ1A 3PRPB 1NYRA 3E46A 2KMAA 1N32M 4AI6A 2NMQA 3FKYA 4MI7A 4D8IA 1E8ZA 3PRPA 2IO1B 5EE1A 2PADA 2CHZA 1RU3A 2PE6B 5CHFA 3TL5A 2FIDA 4DQOC 3O13A 1IGDA 2JRIB 3U60A 3NBIA 3GLFB 3VDPA 2MBBB 1QKZA 3CBKA 2C7MB 4GEWA 2PBHA 4DXFA 1BP4A 2D3GA 3U7ZA 1ITOA 1KRHA 2K39A 3TMPA 2RRUA 1P9DU 2VF8A 3HGIA 1U5IA 2Y0QA 1GJZA 1E7VA 2MX2A 3QQ8B 5IT9S 4AJYB 2Y21A 1PJJA 4LJ6A 2NPTA 3PZ8A 3RVVA 2GBJA 2GQFA 1D5ZC 1ESFA 4P6VF 3U6DA 1YK7A 4KO8A 4DR4M 3OLMD 1UKFA 1N5WA 2FNJB 2PW9A 4BB9A 3I4VA 1NEKB 3VK8A 4G4NA 2ZAMA 4I81A 1ZQ9A 1NPZA 1NHWC 1JWBD 2YVCA 4KZCA 4FADA 1ZOYB 3FC4A 4MGZE 4E3CA 3NWLA 3FD9A 3BCNA 2L7HA 3Q14C 2I2YA 3W1SA 5EE0A 1QVRA 2UUBM 2C9OA 2CUZA 2XFSA 3RNBC 5I4DA 2G3QA 4N58A 3Q8XA 5AZHA 1UBQA 2NTTA 3C19A 4F1SA 1L4DB 3HJ8A 1EIJA 1P3QU 1ROEA 2DYBA 4LF6M 2WS3B 1V1PB 3CMMB 2PKOA 3QT4A 4EZLA 2Z4RA 5EE9A 2G4DB 3U30A 2JNHA 1MJGM 1CPJA 1WRDB 3I04M 3LVVA 4Z6YA 3U60B 4AP4C 1L7YA 3VAWA 3UQBA 3C8YA 1E0ZA 2WXJA 2M0AA 3AV8A 3ZXVA 2WXKA 3FUVA 1JR3A 4OVUA 3KLSX 3WXGA 4B3TM 3TQSA 2OQ4A 2CJNA 1J7AA 4F8CB 4NXNM 1TDZA 1RAXA 2L7IA 4M9XA 1EWLA 7PCKA 3ALBA 4MM3A 3RT3B 3L17A 4WA6A 3R8BA 4LDTB 4US8A 1JQJC 5GKNA 3PHXB 4L2YA 4ZYSA 3C0RA 2RMMA 3FRHA 3FUWA 4FCVA 3KH0A 2N0SB 4RKUF 1EU4A 2OHFA 1T3TA 4B3SM 3OVXA 5FPWA 3KUDB 3GLGA 4OVVA 3QX1A 4G4OA 1UZXB 2KWUB 2KVRA 1XQQA 3TE6A 1NB3A 3X23A 2EKIA 3HK0A 2LJ5A 3ZYYX 1VQ1A 2CS4A 2A5YB 2WDQB 2AYOA 4LJ7A 3ZW3A 2WZJA 1F2RI 1AIPC 1WYWB 2D07B 1NDDA 2BS2B 3BK2A 2XGNA 1D2NA 1ORYB 2QSFX 1WJ4A 3MC9A 1XB2B 1LO5D 1HUCB 1WR1B 2J4XA 2V4IB 4MACA 3EFUA 2LEKA 1GUAB 1ZXIA 4XE0A 2BF8B 2DC6A 3HJQA 2DYOA 3AMZA 1K82A 2IY0B 4A6QA 5F3WA 3DF0A 2CV0A 3GLGB 1SJHD 5JH3A 1VEGA 2DENB 4DDID 2AHMA 1MG4A 1Q5WB 5D3DA 1EF7A 1AIMA 5F02A 3ZNHA 3L10B 3R7RA 1T6OA 1J19A 4OVZA 3PT2B 2J7QB 3MHVC 3UF8A 3TEZA 5FLXS 2KX3A 4JXJA 1FO4A 4GIPA 3A45A 4MDKE 2M17A 4QAYA 2N7DA 1UWMA 1CB5A 2EELA 1PADA 4LGYA 3BBAA 3PNVA 2PIAA 3ZQJA 4FJVB 1ATKA 1YVBA 3W31A 3Q8EA 1ENFA 1D0MA 3ZNGC 5KPRA 3T38A 2WDVB 1FJGM 4PP2E 4DR7M 2XH9A 4GH9A 2OJWA 1FMAD 1OJLA 4DR1M 1R5LA 2ZANA 4GN1A 1E32A 1T5XD 1F2AA 2JXNA 2B3TA 4K1RB 2KTRB 3K9MA 1KLUD 3PLVA 3FYDA 2IGHA 4JE3B 4AKIA 4XBOA 2BGFA 2F5SA 1U9WA 2YJCA 4JI6M 1QYRA 4IWPA 4QNRA 4GDKA 4N59A 1IBLM 3A4RA 2EKKA 2KOXA 1VR9A 1ZMVA 2O6VA 2JZ1A 4NXMM 1IXRC 1SXTA 3SHQA 2EO2A 3U8EA 2ZW1A 4D8BA 2VHFA 2KWCA 5EQTA 3LCUA 3U2SC 4ZRQA 2X4AA 4B9KA 3N30A 5D6JB 1NV8A 2KJHB 4DHJD 7CATA 4MGIE 2HDEA 4IBDA 1RFKA 4KSKC 2RKOA 3KYDD 4GC5A 4MJSB 5LXHA 2DJGB 3GLGE 4NL4H 1E9MA 2HD5B 4FJYA 2KRKA 1WXMA 4FLHA 1I4RA 1A5RA 4W9CA 2BTWB 5HI1A 3KUCB 4L1BA 3FYCA 2ZNVC 2NPTB 2DC8A 1P7FA 2CE7A 3PSEB 5GXGB 4LJ8A 1L4ZB 3VR9B 3MHHA 3J80S 4LG2A 6PADA 3J7AS 1N6ZA 2W55A 1WIAA 2WDRB 3NZSA 2G45B 4JWSC 2AWTA 4KVGB 2XF3A 1FPYA 3A42A 2Y20A 2MJEA 1ZMUA 1ET9A 1F1HA 2BWES 2GLSA 3TRKA 3B21A 3VH4B 2M60A 2K25A 3JAMS 3VK7A 2N9KA 3UIPB 1K3WA 4KHPM 2HHHM 1L1ZA 4XC2A 2CRUA 1C7YA 1WJNA 2J52A 2DAIA 2Z7JA 4GITA 2INNE 2LVOA 4FBJB 1TKGA 5JXVA 1QOLA 4ANUA 4OZCA 3EFCA 1QF6A 4GKKM 4L15A 4HK2A 4G54A 3DVNV 1SXJA 2DI0A 2K22A 5FTNA 5LMNM 1TH4A 2FNAA 3GS2A 1R4MB 2XSZD 3J9CA 2WSEF 2DHYA 5EXSA 2XU3A 4NJ6A 2YQZA 3WAPA 2L1AA 3VR8B 3KOZE 2DCCA 1PGYA 2QJLA 3GQ3A 2YFQA 2R61A 3N9YC 4E71A 4H2AA 5K16A 5FTJA 1J7BA 1ME3A 2AL6A 3NS8A 2LWXA 1TKEA 3FTEA 1T3QA 4W5WA 1QUSA 4JI3M 4LCDE 4LK0M 2XEPA 3HHMA 2NS5A 2QHOA 3PHWA 2X8AA 3AEEB 1JMLA 2XU1A 1NNUC 2KWDA 3E56A 4RNAA 3V6EA 2FE8A 1X9YA 5IAAC 1Y08A 2HTHA 3FILB 4LJOB 1ME4A 1WY8A 3V6EB 3VDUA 3K2LA 3LVWA 3Q3JA 4RM8A 2LVOC 3QSDA 3JYUA 3ZDMC 2Q2EB 1NQCA 1MU5A 4L4UA 3PV1A 3C9PA 2ACZB 5H37D 4PS7A 4PP1A 2PNSA 2N35A 3CSFA 5IOIA 1WRIA 5CHVA 4CHTB 1I94M 1WIVA 3KP1E 1OFFA 5CX3A 5L83A 4DK5A 3Q3MC 1WX9A 1DGGA 1M4VA 1IPGA 1SSNA 2PPHA 2WXRA 3M3JA 4Q8HA 4QHTA 3EUB2 2HAKA 1S4VA 2ATOA 4M0DA 4GGQA 4KLBA 3VH3B 3WA0A 1JWAD 2KJ6A 3VKGA 1K52A 1P1AA 3HU2A 2XK5A 5IZ7D 3NHEB 1V1OA 3U8ZA 2XLJA 3CH2X 2G9HD 2QQ8A 4WQOB 3PRZA 1KSFX 2J0KA 4IUMB 1PPDA 4NQKE 3PHXA 2APLA 3PBHA 2IDYA 2CP8A 2CHWA 2DWQA 2XSZA 3RE8A 1IFYA 2ZW0A 4RFBA 3H7DA 4BOQA 2YJ9A 1CQVA 2WU5B 2P5TA 3B7NA 1Q1OA 4YY3M 2M1MA 4LJPB 4G3OA 1WGRA 2VH1A 1IXSA 2WGSA 3ZXRA 2DCAA 1J7CA 1QAOA 2W3RA 3T3OA 3IEJA 5A24A 4WH4A 4CISA 2VRRB 1S1QB 3V61A 4IBEA 3BYTB 4N8WA 3U7DA 1GLNA 2LVNC 4CDEB 5EXPA 3PRMA 3GE3C 3QYBA 2D11A 5AZGA 4KDLB 2IGGA 2C5LC 3AJIB 3AXCA 1Q6KA 2M0XA 3H6NA 2Z8LA 4XX5A 3BIID 5CHTA 4F7ZA 2YR0A 2L8JA 3ML9A 2LGYA 1W5SA 1LGRA 3P4QB 4FD2A 2B1MA 1DOIA 4G4QA 3TWLA 1D5XC 4FXCA 1U9QX 2R6FA 2INDC 1L5PA 4TV3A 1WJ6A 3TWKA 3KS8A 4JL9A 3WXEA 1HNZM 3RCZA 2ZCBA 3EA6A 1IY2A 1MHWA 2BYVE 4GLSC 3OVZA 3PZ7A 4LNFA 5BO4B 3VUXA 2K8HA 1TIFA 2GHUA 1G8PA 4B3RM 1H8CA 3L16A 4CQNA 1QDTA 3MJ5A 5EE3A 3ZJTA 3AEDB 2YEPB 4LJ9A 2DZNB 3R7QA 1VEKA 3LDZE 2E6XA 2KNBA 5C2TB 4ZHPA 2DC9A 3N1XC 3A9KA 2KDLA 2LFIA 4GU2A 4R7GA 1BUIC 2Y0TA 3L54A 1YJIA 1XHBA 4BVUC 2GOWA 2JZ3B 4NC6A 2R2OA 3B1LX 4RGNA 1HTOA 1I4HA 2JY8A 3U6SA 2DAJA 4I6LB 2HCBA 4BBAA 4YTPB 1QOBA 1VLBA 2Z84A 4X6HA 5C3JB 2K9XA 2NQGA 3KFQA 1F0ZA 5EF4A 3SFEB 4OELA 2JA2A 1EWCA 5HFYA 1AYUA 4BS6A 4GDLB 2C98A 2VHSA 4KV2A 2JYTA 4FHJA 2DWZB 1HJPA 1WXAA 1SE4A 3Q2AC 3Q6BA 4L23A 2R2QA 4IBBA 3O1GA 2QZ4A 1PXVA 2JY6B 3SARA 2KDFB 4MJSA 4WWPA 3U5ZB 3EC8A 3P5WA 4W9IA 1HTQA 2G8LA 1UH6A 3GLHB 4BKSD 2PREA 2D5GA 1JALA 2MSED 2KRUA 4YSZB 3A1QA 1C3TA 4US9A 5EXXA 1YN4A 2JY6A 2FRQA 2OZ2A 1RLFA 4DDGD 1WGGA 2V3NA 3RD2A 3KSJA 2DCBA 2KHWB 1ICFA 3IG3A 3D8BA 4W9FA 4FJZA 1SBBB 4WAFA 1QLBB 2N1WA 4EZKA 1I4WA 5IN7A 3BY4B 1C4AA 1Z2MA 3GO8A 3RZWC 3IAS1 2XZUA 2GFOA 3I01M 1EWMA 3CBJA 1C76A 1SXJB 2ZZPB 5L95C 2LHEA 3P5UA 5E26A 5ITRA 4PDGA 3OISA 1G6JA 3RUIB 3B79A 3B89A 1K3XA 4FA6A 1W5TA 2EMTA 2V1UA 1ZCMA 1VD2A 1CK1A 2FQ9A 2DWLA 4UN2B 3TBLD 4JWUC 3SU8X 3HHAA 1FCCC 2DZMA 1N34M 4QBBA 2RD0A 2MROB 3ZJUA 5CVOB 1AARA 4C7YA 1G71A 2KFKB 2OULA 2LHDA 4LFBM 3Q8FA 3OAWA 5BMHA 2WXPA 1SGHA 3UGBB 1BQIA 3HHZA 1WWTA 4LJ5A 3AFHA 1FFVA 3A98B 3HZJA 2QMTA 5DCNA 2O25A 4I6PA 1KOTA 1QILA 4HCNB 4BBNF 2FCNA 3SEBA 2UU7A 3W0FA 2RDHA 4B7FA 1T0SC 3A33B 3VTWA 1FEHA 3K8UA 1V97A 5C18A 5EP2A 2O6VD 5FR3A 1WM2A 4X64M 1JCKB 3I3TA 1TGUA 1OFHA 4GKJM 1G4AE 1IN5A 2F5QA 4CGYB 3SYKA 2MJDA 3H1UA 4G11A 3L27A 2WX0A 2DAKA 1AWDA 3V6CA 4N4ZA 2MRPA 1NJGA 1XMOM 4JV5M 1YQ3B 2C9CA 2ZM6M 3UZUA 4FIPA 3D6SA 3I51A 1HQRD 1KLGD 1R4GA 4FWDA 2Z8YM 5IREB 3K9OB 2Y5BB 4QHSA 1AECA 2AUXA 5FTKA 1XWIA 2F4VM 1N60A 2O6VB 3K9OA 3KWVA 1WF9A 3I63C 1JRUA 1C4CA 3RYTA 2NQDB 5C23A 4LRTA 2IY1B 4NQLB 3IHPA 2BVCA 4TQ0A 4N6EB 4WAAA 4GRIA 2UU9M 2MGWA 2KTRA 1IQPA 3AU5A 2DZYA 3F75A 3UINB 2HTME 1RWSA 3GRRA 2KDIA 1XCTL 4AUQC 3I3TB 4S0RA 1TT5B 4K7SA 2NR2A 4EKUA 2D3CA 1XO3A 3AE7B 4URKA 1NENB 2EUCA 1KTKA 3B7QA 4HKQA 3GQ4A 3FTCA 1PQSA 2B76B 3D32A 4PT5A 1NO1A 1V2YA 2LZ6A 3TNXA 3H6SA 2CIOA 4QOZC 2DZJA 1HA5A 2R62A 2O2VB 4C4VA 1U4AA 1JWSD 1EF5A 2SAKA 2DAGA 2L00B 1LFDA 3JVZX 3TPZA 3AE8B 4JX1C 5DYGA 2UUCM 5JI3E 4A3OA 1N61A 2H89B 2MH7A 2QDFA 1P98A 2QSDA 4REZA 3GPPA 5IP4D 2YJ8A 4YV8A 4EUTA 4P16A 3U6MA 3WAOA 4BSQA 1TS5A 3H4MA 3DWGC 3TSSA 1V5OA 1B9RA 4QRVA 3OWEB 5CHWA 1VJVA 1BY8A 2BU3A 4LFAM 1CJEA 5JA7A 3ECIA 3WCQA 2KTFA 2BKRB 3DHHC 2N9XA 1YLAA 2MP2B 1PJIA 1WR6E 1XXHB 4NAWA 4A8XC 3Q3OC 1PCIA 2WHIA 1ZDXA 1E6EB 2KN5A 4WW0A 4BFRA 1UM8A 2JPHA 5E6PA 1R2ZA 3S2AA 3ZKJC 4D81A 3JR5A 4W9HA 2DZOB 3PFIA 2R45A 4BQVA 1QT9A 1VEJA 3L13A 4EOYA 4CDCB 4LJ4A 4YYRA 1LQBA 4AQ7A 1HQYE 3V3XA 2Y5CA 2BPSA 2DNAA 1YOVB 2OPFA 2LVQA 4JI5M 3IBEA 3PNRA 3UI3A 3TEYA 4DHZE 3ZRCA 3EHVA 1DYQA 1E8XA 3ML8A 1NL6A 5BMIA 5CVMA 1EWYC 3HIZA 4Q7JA 3GLFA 1XNRM 2E5LM 2JRIA 3V62A 1Z6TA 3OTOM 2J5YA 2KDEB 2L4EA 1ZKHA 4W5BA 3GRUA 1L2CA 4M02A 3HWNA 2X49A 3IFUA 4X6JA 1SNKA 1V8CA 1S3SA 4G50A 3QWLA 3HJSA 2UXBM 4IG7B 4AXMA 3MHSD 4M00A 4EE2A 3PGEA 3UQAA 1KXRA 3QAQA 3TEWA 3W2DA 1BGOA 3H4JA 3KSXA 1AUAA 2QNJA 2KNAA 4FCWA 2BDLA 3LFYA 3U6QA 1C4PA 3KW5B 4PS8A 4S17A 3AE6B 4AQYM 3GPXA 1NB5A 3SHGB 4JI4M 4AG5A 4GUAA 4D80A 1UF0A 1QQRA 1NJFA 3WIMA 4LGMA 2V3PA 4LRSA 4F1IA 2WQYB 1YQBA 3ZLZA 3F5VA 2L0FA 2F7DA 2LH0A 2HL7A 1YJJA 4AS1A 1GB1A 4IJEA 1N36M 4D82A 4JGHB 3VFKA 1WFYA 2UUAM 2FOIC 2R6NA 2DAEA 3THGA 3RMKC 1A70A 4AKHA 4PS3A 3RULA 3LMMA 2L52A 1PIPA 2MR9A 1KF6B 3O65B 1TLOA 2CV2A 1MFWA 2AYOB 4FW9A 4W9DA 4JI1M 5C1BA 1WJ7A 2ZTDA 3H8HA 2AGAA 1STEA 2LXAA 3L2AA 1OGWA 2JY7A 3BY4A 4QNMA 4MGYE 2V6ZM 3K8ZA 2MA9B 2ZPYA 5GMVA 3TL4X 3V05A 5AEKB 5ITUA 3BPMA 2M4NA 3QWZB 4CIZA 3CTWB 1WX8A 1XLNA 3GCBA 2R0IA 2AIMA 2K8CA 1WSPA 1ZW7A 2JQRB 5ITYA 5FTLA 4K0KM 4HDOA 3QARA 2E02A 2JZPA 3TMPB 2A4ZA 3DVNU 3W30A 1OQYA 3LCVB 3T1HM 4EFOA 3DA1A 2R9MA 4KT0F 3U5ZA 5D3IB 5EDSA 2KT7A 1DOYA 3IFWB 1TH2A 1NVID 4O1NA 1CVZA 1HNXM 2J0JA 1IN4A 2QBYB 2DLBA 3PXGA 3VTUA 4C56C 2AYNA 3MC8A 2R44A 2F1GA 3VKHA 2D2QA 1IXSB 3B2GA 2K0BX 3QHTA 3PTFC 2NQAA 3ZQ4A 4GXBA 2LXEA 1F2CA 4IJFA 3AE5B 2H1RA 4ANRA 1E8WA 4GMVA 5KHOA 3W5UB 2WWZA 1MI0A 3CGWA 2DZIA 3ERVA 3Q8BA 4DV2M 2GRIA 3PVLA 2Y3AA 5J18A 4FK5A 1DGHB 4QH6A 1MX0A 2CB5A 2HKJA 4C4VB 3Q3NC 5J17A 3FE3A 2DOSA 3SHFA 4ACFA 3ONSA 3B0AA 1V80A 1OTRB 2RGOA 2JQFR 1ZE3D 3RVXA 4OU7A 1OAOC 2KZRA 2J7NA 4P1BC 3I4YA 3MTVA 3RGSA 2LD9A 5IKCM 3EIEA 1IN7A 5FTMA 4W9GA 1WMHB 1C78A 1L1TA 1WR1A 2ZAOA 5EJCA 4HPLB 1L2NA 2OOAA 4D2KA 4BKSA 1YX6B 2QILA 4DR5M 3B08A 1PPOA 2R18A 3L25A 3VRAB 4F2LA 1AYWA 1L2DA 2BDZA 4G0NB 3T8MA 4ANXA 1Q3CA 1T43A 2G5GX 4IBCA 3W68A 1YQ4B 4DV6M 4HEA1 4XGAB 1QMYA 2HXZA 3PDFA 2K6DB 3V76A 1NNJA 3Q8CA 4XWWA 4P17A 1SIFA 4ICUA 2Y5BA 4XUIA 4ZPXA 1EFUB 3TEXA 1TJEA 1RFAA 3PHWB 3RVWA 4KGTA 1N78A 1MDWA 1Q02A 2JYEA 1FIQA 3DZDA 1TKYA 3C3EA 1T0RC 5ITXE 1HZ6A 1TTEA 3RZFA 4LY6A 3MORA 4PYZA 4KZ0A 3ZDTA 4LF7M 1IUEA 3AKZA 1L0YB 2R4EA 8CATA 1WYGA 5D7GA 2HH5A 1K50A 4DR3M 1UD7A 3RNFC 2KZUA 3LYYA 2OO9A 1ZXHA 3FKEA 3HHWA 2BKFA 3EGRA 1P0RA 2E00A 3LXFA 1TF0B 1GABA 4MELA 2N9EB 1TTNA 4HWIB 3AM9A 3MHSA 4KGRA 2KQSA 3E4RA 3J2PB 2W3SA 4WJQA 5TR5A 1GB4A 1AU4A 1IBKM 1GC7A 3KUZA 4B3MM 1KYIA 3BPFA 5E6NA 3AEFB 3APFA 4HXDB 2OJRA 2E3TA 3AE3B 4QRGA 1GNUA 2G8JA 2OP3A 2KFKA 1MEGA 3ZGZA 1KHQA 1A6RA 2QC8A 2QPAA 2I7NA 2H7JA 4K81A 2GBNA 1TZOA 1K8RB 2WLBA 1WXSA 3M63B 5G5HA 4TKNA 5J2RA 3C9EA 4WWNA 1NI2A 1V33A 1KJTA 1YN3A 2PMVA 3JW0X 4RCOA 4TSSA 1N62A 4LF8M 2C7NB 1DO0A 5EXTA 3IAM1 2G6DA 4II7A 2PLPA 1WE7A 4M8MA 3IMAA 4MZOA 3L0WB 1UNSA 4LF9M 3VVWB 2B3AA 2C96A 4HVBA 1BMLC 2DVWB 1FH0A 1TR8A 2VQFM 1LXDA 3PSEA 2LVQD 2L32A 1F77A 1D4BA 2L7RA 3CWIA 3VTVA 1EWPA 3H8CA 1QZMA 4EIWA 1KHPA 4B08A 3W0LB 4IBJA 4YYSA 1NHGC 3N1ZC 4WJOA 4IM3A 2INPE 2LMCA 2MHJA 1I4QA 1C1KA 1R2YA 4DHJB 1OEYJ 4I5SA 4DXAB 2KMMA 2QP9X 3U6CA 2FUHB 1D5MC 1PGBA 3GLHA 2PVOD 4DV7M 3A4SC 3NG0A 2CR5A 3NJTA 1YT7A 2L09A 4C7ZA 5G2NA 1TGZB 2FUDA 2KANA 1MIRA 1VJKA 1IY1A 1FXAA 4CDDB 2GBMA 4JI8M 4WQMA 1YALA 4TUWA 1R7SA 3KYCD 5PADA 2Q5WD 5EZSA 1JB0F 2R4JA 1EF1A 4CO7A 4B7GA 3BWUD 4IWOA 4HROA 1YSYA 1XT9B 5FSWA 4ZYNA 3PLUA 1KFUL 4Z8XA 2DAFA 3WALA 3MP2A 4EZJA 4ZTBA 1QZEA 4A90A 3ZIMA 4BOZA 3AULA 4MSQB 1CV8A 2ZJDA 1IBXB 4A3VB 2GBKA 2LGDA 2FYEA 4XYCA 3DHGC 3DOWA 3A9JB 4MEMA 2LRWA 1DGJA 3MP9A 2KDMA 1NBFC 1U9XA 5H8YE 2OEDA 1NYQA 1L0VB 3IUTA 3T6PA 3ILKA 4YHHM 3Q69A 3VDZA 3DPDA 1KFVA 4P7IA 4LCBA 1FXIA 1YJ1A 1X37A 2I7PA 3U6EA 3ZNHB 2AU1A 2N1VA 1PBHA 1PJSA 2UZJA 4IBGA 2BS4B 1N63A 3DOAA 2XBBC 4HJKA 1I4PA 3VHTC 1WGNA 3IECA 3T15A 1C1YB 1PE6A 1STFE 2NQIA 4D8EA 1KM7A 4PYUA 2XU5A 4W9LA 2BWFA 3URYA 3ZRFA 1ISNA 3KQ4A 3RI7C 1WGKA 5L8RF 1L8QA 2F5OA 3KFUG 2HD5A 4YSYB 5J94A 4BZAA 1GG3A 1L0XB 1E9SA 2IYDB 2RDGA 2B1NA 3ETRA 4CYEA 3ZTDA 4W9EA 4IDIA 1WGHA 1PGAA 2DZLA 3OG5A 5KHQA 4P6GA 2JY5A 1VG5A 3GRYA 3AOEC 3PRMB 3I06A 4NJ7A 2G8EA 3RFWA 4IIWA 1NY5A 4FVMA 2WXMA 3AN1A 1MS6A 3A9KB 4X65M 4YYWA 4GDKB 2Y5PA 2C99A 3ZUAA 3M62B 3MTNB 2FBWB 2WXHA 3GLIB 4ZRIA 2DKLA 1GO5A 1NVMA 1JQ4A 4YTMB 4HXDA 2L6OA 3E9SA 4OEMA 3H9DA 2CEAA 2V3SA 4KDIC 1E7UA 3C3DA 1V5TA 3L29A 1L6UA 3PHUA 2DZZA 5LMUM 1AW7A 3U52E 4RF0A 3VFDA 1F9JA 1BXTA 4BOSA 3MTNA 4DWFA 1N77A 1SE3A 3KS4A 1LTMA 2IO3B 1ET6A 1PJQA 3HU3A 5BYRA 4BKTA 1SXJE 2C7HA 3KW9A 1GECE 3I9V1 3GRVA 5DNYA 4N79A 1ZPSA 2MQJA 2TSSA 3LQRA 1HZ5A 1TBEA 3TUOA 1UGJA 2YEPF 2NQ8C 4LDTD 3RNEC 3BOWA 3HWSA 1IY0A 4OVZB 1Y8GA 2KX0A 3BWKA 3GLFE 3DVGY 5AZFA 1O0EA 3W1YA 5E6OA 4X62M 2KDBA 3L4PA 2KNVA 1ZGUB 2MWSB 2CHQA 4ZHOA 1G3IA 1QXPA 3P63A 2MBHA 3IT6B 3JR4A 1WHCA 4FHKA 2ZVOA 4NAMA 1IGCA 2MJ3A 5DPRA 1I42A 3QJZA 5JH5C 4DR2M 2EKFA 4I04A 1WM3A 4MGHA 4YYUA 1MJDA 2JWZA 3KDSE 2BYEA 3BINA 1TU6A 1WH3A 4MZSA 3ZTCA 3IG8A 1MG8A 1Q10A 1MHXA 1WMHA 2PE9A 2W54A 3QC8B 4OHJA 3SD5A 3N3KA 1WGLA 2XZFA 2FAZA 4OZBA 2HE7A 2X38A 3I57A 4RGTA 3A9JA 1K3BB 5IO9A 2YJ2A 1TH3A 3BZDB 1U9VA 1XLPA 1KLVA 2XU4A 4DXGA 4LJAA 1HQCA 3C0RB 2MW5A 3R2TA 1ZP0B 4JIOU 2V9HA 3AU4A 4I6NB 3V60A 1MVKA 3GQ5A 2PEAA 4JQWC 2Z0DB 3FAHA 2R46A 2KZSA 3E21A 2AX5A 3B74A 4YXDB 3ABVB 4WWOA 2J0MA 3DFZA 2BW2A 2I38A 2K6QA 2RPVA 1WJUA 1QUTA 3KOYE 4G6ZA 1QOFA 3BVMA 3RN9C 1CUKA 4WURA 1XC8A 2QBYA 2D3BA 1AU3A 2R9CA 4OZAA 3CF2A 2RR9A 1ZUD2 1YIWA 1AYVA 2DJFB 4TMAB 4XK8F 2ZVNA 4XDCA 1T0YA 3O0UA 4NSOB 1NI3A 3TIXA 3UIOB 3DDCB 4RGOS 3GZNB 3DBHI 2AUZA 4CDFB 1G41A 1V92A 4DR6M 3QYEA 2HJ8A 2WXQA 4XGIA 4IBIA 2LBCA 3VLFB 2DCDA 3HUIA 1F29A 1YK8A 4IBKA 1UWXA 3HX3A 1SE9A 4GDLA 4ITKA 1DGFA 5KO3A 1H4RA 1PJTA 2AS8A 2F5PA 3AECB 4X57B 3M7GA 2CHGA 2KXEA 1V49A 4OX9M 2OOBA 4R3DA 1UGMA 4IOIE 1XCQL 4W9JA 3U6LA 5G55A 4A3PA 1AU0A 1JW9D 2FCSA 4YVAA 1OIZA 3S3QA 3IHPC 4IKGA 4A20A 4JN6A 3PW3A 2KW0A 1OEYA 1VZ6A 2DBYA 2R9FA 2ZTCA 2K6BA 1V6EA 4K3CA 2KD0A 1E7PB 2KC2A 3R2IA 4XZ4A 2NBVB 3OQCA 4B95A 3AL0C 3HHIA 3B9PA 2IBIB 3R66C 3BVGA 4DHZB 5CTRC 1F2BA 1BVSA 2CU3A 1UUPA 4HRSA 3Q8AA 1EM7A 1YNTE 4RGMA 3PPAA 2E03A 3DWMA 1SB3C 1M94A 4HKZE 4MM3B 1JR3D 3HU1A 3KOXE 3MHZA 1QOAA 4G4RA 2O2VA 3T1YM 1PGXA 3BBZA 3W1SC 3SBJA 4LF5M 2KC1A 3AEGB 4II2B 4ZOHC 5CVNB 4GHLA 2FTDA 4PADA 2LVPA 2YLMA 3L28A 3SYLA 2AEHA 1CSBB 3T9LA 3BC3A 3OF8A 1CMXB 1I35A 4M0WB 1SP4B 4JLCA 1UELA 1FNNA 3BOSA 2WSFF 4PK1A 3WAMA 2MCNB 1XEEA 3DBRB 3OJ3A 3U6OA 2L4FA 2JX5A 1V1PA 1P7EA 4Q2JA 2N9LA 3U61B 3RNGC 4LZJA 1WXQA 3KXEC 1FNUA 3R8FA 2WXLA 2V0GA 1F4IA 2N4FA 3NUHB 2IBIA 1PYWD 3N4CA 2DHRA 1TY0A 2KLGA 2LWPA 2Z59B 2RGHA 1IN6A 2JSVX 3JSVB 4AOFA 4FWHA 3CIRB 1OIPA 5ITQA 2MEKA 1IM2A 4DBGA 2KAJA 2D7EA 2K0PA 3KOWE 1HT1E 1FXTB 3DBRI 2BWEA 3N20C 2Z3XA 4LLGM 2OOBB 2WXNA 4ZRKA 3M6AA 3HHXA 2CHXA 2VIIA 5G5GA 3K9PA 1C79A 1I7HA 4NAWB 4WWMA 1VCBA 4BOUA 5JI2E 2ZNVB 1J5EM
chains in the Genus database with same CATH topology
2AQ1B 4XZXA 3SAVA 2BJVA 3R9XB 2IPKD 2LJIA 1PFDA 5HHDG 3NVVA 2WXOA 3AV0A 3VRBB 1AN8A 1Z5CA 2FUG1 1E94E 1K51A 2QENA 1IN8A 3RNVA 3PVSA 4BLCA 3U4EG 1R6BX 4DV4M 3AE1B 3GB1A 3KVWA 5ITXA 4X66M 1N5XA 4I4LA 4RKXA 1C77A 1YE9A 2XFTA 3J81S 3UMMA 3B2FA 2LGIA 1SXJC 1ZDVA 3NRZA 5KPTA 1QAMA 2K3UA 1PUTA 3U6PA 3CF0A 2DYMA 3SR6A 1TS2A 3AEBB 2VZKD 1GKIA 1J09A 4GHAA 4XWTA 1TS4A 1EU3A 2WU2B 1XMQM 2DWMA 1PDXA 4IBFA 2YNMD 3LQQA 3RFZB 4NOOB 1N33M 2WXGA 1YUBA 2N7JA 3IG5A 3AOGA 1E9RA 1TDHA 2D7GA 1GL7A 5H92C 1FCLA 1L2BA 1QAQA 3SMPA 1JROA 2BTWA 3SASA 4QOSA 3BVZA 4HL4A 4YWGG 1J7KA 2DWNA 3AE9B 4ARIA 1XNQM 4JI0M 2BNKA 3M0EA 1SJED 3GLIA 1G59A 4AZFA 2WP9B 2ERCA 2J53A 2L83A 4C80A 1OQRA 1IXZA 1JRPA 4M9ZA 4BOPA 4MH8A 2HWKA 4L78A 1FRDA 3J7BA 4NZLB 5LNK1 4ITQA 5KQDA 3LB8C 3UK6A 2WXIA 4USAA 5BYQA 4JYAM 3NVZA 3FTFA 1SF0A 2M5ZA 1SIJA 2XN9C 4MT5A 2JXTA 4A5UA 2IGDA 2GI9A 4PCZA 2SEBD 5T8IA 1YZBA 3A46A 5AUIA 4LZZA 3ZCBB 4PD2A 1B1ZA 4MH0E 4B0EA 5E6JA 1TS3A 2QEJC 5MPOA 3SMSA 5IWAM 3GP7A 2R65A 1KFYB 3NS1A 1JWMD 3FUUA 2CHVA 2JWUA 2UXCM 1E10A 3FILA 3T3NA 1HR0M 2J42A 3WHLA 4NJCA 4J3OD 3RPFC 4GC9A 3U61A 4WIPA 1DOXA 2K5PA 4NRWA 2G1EA 4ARCA 1ACCA 5KPZA 2UXDM 2LNHC 3IXSA 2CV1A 1HNWM 1H6UA 3P4RB 2NTSA 4LTUA 2ON8A 1IBMM 2KQ4X 1D6EC 3L26A 4I8OA 3HHYA 2O5RA 1JWUD 2V1CA 1GAQB 5BMGA 3AH7A 1NY6A 3AE2B 4JI7M 4ZRPA 2BYTA 1C9FA 1MPEA 2WNMA 1XF5L 1KH0A 1R7RA 3BYYB 1XXGA 1FFUA 5BPVA 1YN5A 2M56B 2BBCA 2EA0A 5A2QS 3KW6A 5DYIA 1GL6A 3EIHA 1HXYD 3HVDA 2QIEB 1VZ7A 1T6BX 2VZKB 3MK6A 3ZC7B 3ZH9B 3P4SB 1XLQA 3K92A 4JPSA 1CZPA 1HEZE 4MGKE 1TYGB 3C58A 4L8RC 1FNWA 2BTEA 5KQ8A 4XDDA 2WXFA 2H88B 3IT4B 5EP1A 5EP3A 5AUKA 4GMQA 3FUTA 4TQ1A 2BB5A 3NZ3A 4DUYM 4OW0A 3AB5A 3AOEA 1L6VA 4DV1M 2Z4SA 1I4GA 5FK9C 2BJWA 4A55A 1AYFA 2KACA 1SE2A 3P4PB 3MC0B 4KX6B 1ZAEA 3W9CB 3P42A 3CF6E 4RH6A 1SEBD 3GP1A 3PNYA 4B7HA 1DGHA 5FKAC 2KEBA 1TY2A 2J7QC 1Q39A 4DV5M 4AW4A 3B9JA 2JTCA 3AEAB 2CFOA 4L16A 3KP0E 2K47A 4DUZM 4KKIA 3FTDA 2FFJA 1RM6C 4LFCM 1GPXA 1N75A 1VRAB 3KWLA 1QOGA 1HT2E 2W82A 4KODA 4YTNB 4YSXB 3P1MA 1FD6A 2VQEM 2AQ3B 3GPYA 1DGBA 2BS3B 3W5VB 2XNAC 2ONQA 1QQWA 2J7OA 1QANA 2C5RA 5HG2A 1DKIA 3QAUA 4AG6A 4B0MA 4DV3M 1K53A 4A9AA 4HLQA 1RYJA 4RF1A 3D8LA 1FRRA 4M9SA 1VZ8A 1VDDA 3SATA 4PDIA 3RGPA 4IUMA 3SFDB 1NSFA 2ICIA 2IJ0A 1GVNA 2CJOA 1F2RC 3J27B 1Y56A 3SAWA 1OQQA 4KKJA 5ITTA 1MHHE 5EZQA 4UDUC 4YT0B 3FUXA 2J7QA 2PVGC 3AE4B 3PT2A 4IP3A 2D7HA 3MFGA 4AKGA 1EE8A 2BT6A 3UGJA 4KLNA 3NVWA 3TWMA 4FCTA 2JU6X 2M19A 1DO2A 3ZJVA 3PO0A 1Q3BA 3GPUA 1PVJA 5BR8M 2PTLA 3BK1A 3WHKA 1Z5AA 1PM5A 2LUMA 1YMHE 4FWGA 2AQ2B 3O65A 2GB1A 2KN4A 1Z5BA 3SC3A 4HJGE 4DV0M 2ZBKB 1I4XA 4KGSA 2F5NA 2DXIA 1XLOA 3NVYA 3SAUA 1FNVA 1GOZA 5BYSA 2KA6B 3VQIA 3HRDD 5TSSA 2QCUA 3SFZA 1Z59A 1IBXA 4NSRA 5JZEA 1OFIA 3K1JA 3HKPA 3HVZA 4NRVA 1XXHA 1FM0D 5EP4A 4LF4M 1SXJD 4S12A 2BB6A 1LV7A 3UJNA 4JI2M 4MB7A 4M0WA 1VDVA 1NYRA 4MI7A 2NMQA 1N32M 4AI6A 4D8IA 3PRPA 5EE1A 4DQOC 3O13A 1IGDA 3U60A 3NBIA 3GLFB 3VDPA 1QKZA 4DXFA 3U7ZA 3TMPA 1KRHA 3HGIA 2Y0QA 5IT9S 2Y21A 1PJJA 4LJ6A 3PZ8A 1D5ZC 1ESFA 4P6VF 3U6DA 4KO8A 4DR4M 1UKFA 1N5WA 2PW9A 4BB9A 3I4VA 1NEKB 3VK8A 4G4NA 2ZAMA 4I81A 1ZQ9A 1NHWC 1JWBD 1ZOYB 3FC4A 4MGZE 3NWLA 3FD9A 2L7HA 2I2YA 3W1SA 5EE0A 1QVRA 2UUBM 2C9OA 2CUZA 2XFSA 5I4DA 4N58A 3Q8XA 2NTTA 1L4DB 3HJ8A 1ROEA 4LF6M 2WS3B 1V1PB 2PKOA 2Z4RA 5EE9A 3LVVA 4Z6YA 3U60B 3C8YA 1E0ZA 2WXJA 2M0AA 3AV8A 2WXKA 3FUVA 1JR3A 3KLSX 4B3TM 3TQSA 2OQ4A 2CJNA 1J7AA 4NXNM 1TDZA 2L7IA 4M9XA 3R8BA 4US8A 1JQJC 5GKNA 4L2YA 4ZYSA 3C0RA 2RMMA 4FCVA 3FUWA 2N0SB 1EU4A 2OHFA 1T3TA 4B3SM 3GLGA 4G4OA 3TE6A 2EKIA 3ZYYX 2A5YB 2WDQB 4LJ7A 1F2RI 2BS2B 3BK2A 2XGNA 1D2NA 1ORYB 1LO5D 2J4XA 2V4IB 4MACA 2LEKA 1ZXIA 4XE0A 3HJQA 2DYOA 3AMZA 1K82A 4A6QA 5F3WA 2CV0A 3GLGB 1SJHD 2AHMA 5D3DA 3ZNHA 4OVZA 3TEZA 3MHVC 5FLXS 4JXJA 1FO4A 4GIPA 3A45A 1UWMA 2EELA 4LGYA 3BBAA 3PNVA 2PIAA 3W31A 3Q8EA 1ENFA 5KPRA 3T38A 2WDVB 1FJGM 4DR7M 2XH9A 4GH9A 1FMAD 1OJLA 4DR1M 2ZANA 1E32A 1T5XD 1KLUD 3FYDA 2IGHA 4JE3B 4AKIA 4XBOA 2F5SA 4JI6M 1QYRA 4QNRA 4N59A 1IBLM 1VR9A 4NXMM 1SXTA 1IXRC 2EO2A 2ZW1A 4D8BA 5EQTA 3U2SC 4ZRQA 2X4AA 7CATA 4MGIE 2HDEA 4IBDA 1RFKA 2RKOA 4GC5A 4NL4H 1E9MA 2KRKA 1I4RA 2BTWB 5HI1A 4L1BA 3FYCA 1P7FA 2CE7A 5GXGB 4LJ8A 1L4ZB 3VR9B 3J80S 4LG2A 3J7AS 2W55A 2WDRB 4JWSC 2XF3A 3A42A 2Y20A 2MJEA 1ET9A 3TRKA 3B21A 2M60A 3JAMS 3VK7A 2N9KA 1K3WA 4KHPM 2HHHM 1L1ZA 2J52A 4GITA 2Z7JA 2INNE 1TKGA 5JXVA 4OZCA 1QF6A 4GKKM 4L15A 1SXJA 2K22A 5FTNA 5LMNM 1TH4A 2FNAA 3GS2A 2XSZD 3J9CA 5EXSA 2YQZA 2L1AA 3VR8B 3KOZE 2QJLA 3GQ3A 2YFQA 2R61A 3N9YC 4H2AA 5FTJA 1J7BA 2LWXA 1TKEA 3FTEA 1T3QA 4W5WA 4JI3M 4LK0M 2XEPA 3PHWA 3AEEB 2X8AA 1JMLA 1NNUC 2KWDA 3E56A 4RNAA 2FE8A 3FILB 3VDUA 3K2LA 3LVWA 2Q2EB 1MU5A 4L4UA 2ACZB 5H37D 1WRIA 4CHTB 1I94M 3KP1E 1OFFA 1DGGA 1M4VA 1SSNA 2WXRA 4QHTA 3EUB2 4M0DA 1JWAD 3VKGA 1K52A 3HU2A 5IZ7D 1V1OA 2XLJA 2G9HD 1KSFX 3PHXA 2IDYA 2DWQA 2XSZA 3RE8A 2ZW0A 4RFBA 4BOQA 1CQVA 2WU5B 2P5TA 4YY3M 2W3RA 1J7CA 1QAOA 3T3OA 4WH4A 4CISA 4IBEA 3BYTB 1GLNA 5EXPA 3PRMA 2IGGA 3AJIB 2Z8LA 3BIID 2YR0A 1W5SA 3P4QB 4FD2A 1DOIA 4G4QA 3TWLA 1D5XC 4FXCA 1L5PA 3TWKA 3KS8A 1HNZM 3EA6A 1IY2A 4GLSC 3PZ7A 1G8PA 4B3RM 4CQNA 3MJ5A 5EE3A 3ZJTA 3AEDB 2YEPB 4LJ9A 2DZNB 2E6XA 5C2TB 4ZHPA 2LFIA 4R7GA 1BUIC 2Y0TA 1YJIA 1XHBA 4RGNA 1I4HA 3U6SA 2HCBA 4BBAA 4YTPB 1QOBA 1VLBA 2Z84A 5C3JB 2K9XA 1F0ZA 3SFEB 2JA2A 1EWCA 5HFYA 4GDLB 2C98A 2JYTA 2DWZB 1SE4A 4L23A 4IBBA 2QZ4A 3SARA 3U5ZB 2G8LA 3GLHB 2D5GA 1JALA 2KRUA 4YSZB 4US9A 5EXXA 1YN4A 2V3NA 3KSJA 3D8BA 1SBBB 4WAFA 1QLBB 1I4WA 1C4AA 3GO8A 3IAS1 2XZUA 1C76A 1SXJB 2LHEA 5E26A 5ITRA 4PDGA 1K3XA 1W5TA 2V1UA 1CK1A 2DWLA 4JWUC 1FCCC 1N34M 3ZJUA 4C7YA 2LHDA 4LFBM 3Q8FA 5BMHA 2WXPA 3HHZA 1WWTA 4LJ5A 3AFHA 1FFVA 3A98B 2QMTA 1QILA 3SEBA 3W0FA 2RDHA 4B7FA 1FEHA 1V97A 5C18A 5EP2A 5FR3A 4X64M 1JCKB 1TGUA 1OFHA 4GKJM 1G4AE 1IN5A 2F5QA 4CGYB 3SYKA 2MJDA 3L27A 1AWDA 1NJGA 1XMOM 4JV5M 1YQ3B 2C9CA 2ZM6M 3UZUA 3I51A 1HQRD 1KLGD 4FWDA 5IREB 4QHSA 5FTKA 1XWIA 2F4VM 1N60A 3KWVA 1C4CA 4LRTA 4TQ0A 4N6EB 4GRIA 2UU9M 1IQPA 2HTME 1RWSA 3GRRA 1XCTL 3AE7B 1XO3A 1NENB 2EUCA 1KTKA 4HKQA 3GQ4A 3FTCA 2B76B 4PT5A 4QOZC 1HA5A 2R62A 1JWSD 2SAKA 3TPZA 3AE8B 4JX1C 5DYGA 2UUCM 5JI3E 1N61A 2H89B 2MH7A 2QSDA 4REZA 3GPPA 4P16A 3U6MA 1TS5A 3H4MA 3DWGC 3TSSA 1B9RA 3OWEB 2BU3A 4LFAM 1CJEA 3WCQA 1PJIA 4A8XC 1XXHB 1ZDXA 1E6EB 4WW0A 1UM8A 1R2ZA 4D81A 3JR5A 2DZOB 3PFIA 2R45A 1QT9A 4LJ4A 4AQ7A 1HQYE 3V3XA 2Y5CA 2OPFA 4JI5M 3UI3A 3TEYA 1DYQA 5BMIA 1EWYC 3GLFA 1XNRM 2E5LM 2JRIA 1Z6TA 3OTOM 3GRUA 1L2CA 2X49A 3IFUA 1V8CA 1S3SA 3QWLA 3HJSA 2UXBM 4EE2A 3TEWA 3W2DA 3KSXA 4FCWA 3U6QA 1C4PA 3AE6B 4AQYM 3GPXA 3SHGB 4JI4M 4AG5A 4GUAA 4D80A 1QQRA 1NJFA 4LGMA 2V3PA 4LRSA 2WQYB 2LH0A 2HL7A 1YJJA 4AS1A 1GB1A 4IJEA 1N36M 4D82A 2UUAM 2FOIC 3THGA 1A70A 4AKHA 3LMMA 2L52A 1KF6B 2CV2A 4FW9A 4JI1M 5C1BA 3H8HA 2AGAA 1STEA 3L2AA 3BY4A 4QNMA 4MGYE 2V6ZM 3K8ZA 3TL4X 3V05A 5ITUA 3CTWB 1XLNA 1WSPA 2JQRB 5ITYA 5FTLA 4K0KM 2JZPA 3W30A 3T1HM 3DA1A 3U5ZA 5D3IB 1DOYA 1TH2A 1NVID 4O1NA 3BB7A 1HNXM 4C56C 1IN4A 2QBYB 2DLBA 3PXGA 3VKHA 1IXSB 3B2GA 3ZQ4A 2LXEA 4IJFA 3AE5B 2H1RA 3W5UB 1MI0A 3Q8BA 4DV2M 2GRIA 2Y3AA 1DGHB 1MX0A 2HKJA 2DOSA 3SHFA 2RGOA 1ZE3D 4OU7A 2J7NA 3I4YA 3MTVA 3RGSA 3EIEA 1IN7A 5FTMA 1C78A 1L1TA 5EJCA 2ZAOA 4D2KA 2QILA 4DR5M 2R18A 3L25A 3VRAB 1L2DA 1Q3CA 2G5GX 4IBCA 1YQ4B 4DV6M 4HEA1 3Q8CA 1NNJA 4XWWA 4ZPXA 3TEXA 1TJEA 4KGTA 1N78A 2JYEA 1FIQA 3DZDA 1TKYA 5ITXE 1HZ6A 4LY6A 4LF7M 1IUEA 3AKZA 1L0YB 2R4EA 8CATA 1WYGA 5D7GA 1K50A 4DR3M 2KZUA 3LYYA 1ZXHA 3FKEA 3HHWA 3EGRA 3LXFA 3AM9A 4KGRA 3E4RA 3J2PB 2W3SA 1GB4A 1IBKM 4B3MM 1KYIA 3AEFB 4HXDB 2E3TA 3AE3B 3ZGZA 2QPAA 2I7NA 1TZOA 2WLBA 5G5HA 1YN3A 2PMVA 4RCOA 4TSSA 1N62A 4LF8M 1DO0A 5EXTA 3IAM1 4II7A 2PLPA 1UNSA 4LF9M 2C96A 1BMLC 2DVWB 2VQFM 3PSEA 2L32A 1F77A 1D4BA 3CWIA 1QZMA 4EIWA 4B08A 3W0LB 4IBJA 1NHGC 2INPE 2LMCA 1I4QA 1C1KA 1R2YA 4I5SA 2KMMA 2QP9X 3U6CA 1D5MC 1PGBA 3GLHA 2PVOD 4DV7M 2L09A 4C7ZA 1VJKA 1IY1A 1FXAA 4JI8M 4WQMA 4TUWA 1R7SA 2Q5WD 5EZSA 2R4JA 4B7GA 3BWUD 4HROA 1YSYA 5FSWA 4Z8XA 3MP2A 4ZTBA 4A90A 4BOZA 1IBXB 4A3VB 1DGJA 3MP9A 2KDMA 5H8YE 2OEDA 1NYQA 1L0VB 3ILKA 4YHHM 3Q69A 1KFVA 4LCBA 1FXIA 1X37A 2I7PA 3U6EA 2UZJA 4IBGA 2BS4B 1N63A 3DOAA 1I4PA 3T15A 4D8EA 3URYA 3KQ4A 1WGKA 2F5OA 1L8QA 3KFUG 4YSYB 1L0XB 1E9SA 2RDGA 3ETRA 4IDIA 1PGAA 3GRYA 3AOEC 3RFWA 4IIWA 1NY5A 4FVMA 2WXMA 3AN1A 4X65M 4GDKB 2Y5PA 2C99A 2FBWB 2WXHA 3GLIB 1NVMA 1JQ4A 4YTMB 2L6OA 3E9SA 2CEAA 3L29A 1L6UA 3PHUA 5LMUM 1AW7A 3U52E 4RF0A 3VFDA 1BXTA 4BOSA 1N77A 1SE3A 3KS4A 1ET6A 3HU3A 5BYRA 1SXJE 3I9V1 3GRVA 5DNYA 1ZPSA 2TSSA 3LQRA 1HZ5A 3TUOA 1UGJA 2YEPF 2NQ8C 3HWSA 1IY0A 4OVZB 4X62M 3L4PA 2CHQA 4ZHOA 1G3IA 3P63A 3IT6B 3JR4A 4NAMA 1IGCA 2MJ3A 4DR2M 4MGHA 3KDSE 3IG8A 1Q10A 2W54A 1MHXA 4OHJA 2XZFA 4OZBA 2X38A 3I57A 4RGTA 1TH3A 3BZDB 1XLPA 4DXGA 4LJAA 1HQCA 3R2TA 1ZP0B 1MVKA 3GQ5A 3FAHA 2R46A 2KZSA 4YXDB 2AX5A 3ABVB 2BW2A 3DFZA 2I38A 2RPVA 4G6ZA 3KOYE 1QOFA 3BVMA 4WURA 1XC8A 2QBYA 4OZAA 3CF2A 1ZUD2 4TMAB 4XDCA 4NSOB 1NI3A 4RGOS 1G41A 4DR6M 2WXQA 4XGIA 4IBIA 3VLFB 3HUIA 4IBKA 1UWXA 4ITKA 1DGFA 5KO3A 2F5PA 3AECB 3M7GA 2CHGA 2KXEA 4OX9M 4R3DA 4IOIE 1XCQL 3U6LA 1JW9D 4IKGA 4JN6A 2KW0A 1VZ6A 2DBYA 3R2IA 1E7PB 3OQCA 3AL0C 3B9PA 3BVGA 2CU3A 1UUPA 4HRSA 3Q8AA 1EM7A 1YNTE 4RGMA 3DWMA 1SB3C 4HKZE 4MM3B 1JR3D 3HU1A 3KOXE 3MHZA 1QOAA 4G4RA 3T1YM 1PGXA 3SBJA 4LF5M 3AEGB 4ZOHC 4GHLA 3L28A 3SYLA 1FNNA 3BOSA 1XEEA 3U6OA 2JX5A 1V1PA 1P7EA 4Q2JA 2N9LA 3U61B 4LZJA 1WXQA 3KXEC 1FNUA 3R8FA 2WXLA 2V0GA 3NUHB 1PYWD 2DHRA 1TY0A 2RGHA 1IN6A 2JSVX 4FWHA 3CIRB 5ITQA 2MEKA 1IM2A 2KAJA 2D7EA 2K0PA 3KOWE 1HT1E 4LLGM 2Z3XA 2WXNA 3M6AA 3HHXA 2VIIA 5G5GA 1C79A 1I7HA 4WWMA 4NAWB 4BOUA 5JI2E 1J5EM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE8 A;  4REZ A;  3E9S A;  4RF1 A;  4OVZ A;  4WUR A;  4R3D A;  5KO3 A;  3MP2 A;  4OVZ B;  4PT5 A;  4MM3 B;  4OW0 A;  4P16 A;  3MJ5 A;  4RF0 A;  4RNA A;  5E6J A;  4M0W A; 
#chains in the Genus database with same CATH topology
 2AQ1 B;  1OTR A;  1THE A;  3SAV A;  2BJV A;  4XZX A;  3R9X B;  2IPK D;  5FR6 A;  1NLJ A;  2R9N A;  2LJI A;  1PFD A;  1GC6 A;  2BQQ A;  5HHD G;  3NVV A;  2WXO A;  1XD3 B;  2P0R A;  3AV0 A;  3VRB B;  2LTU A;  1AN8 A;  2HHN A;  1Z5C A;  2FUG 1;  1R4M I;  2AL3 A;  4FJC A;  3OJ4 B;  1E94 E;  1K51 A;  4WP2 A;  2QEN A;  1IN8 A;  3RNV A;  2K9D A;  3PVS A;  2KVZ A;  4BLC A;  2D10 A;  3U4E G;  1R6B X;  4IC7 B;  1BT0 A;  4DV4 M;  3AE1 B;  2ZEQ A;  3VUW A;  3KKU A;  2GBR A;  3GB1 A;  1WE6 A;  4BKG A;  3KVW A;  5ITX A;  2JUO A;  3DVG X;  3PS6 A;  1Y8R C;  3LXS A;  4X66 M;  1N5X A;  4KSL C;  2DNF A;  2HJ1 A;  3P2B A;  4I4L A;  4RKX A;  1C77 A;  4W4U A;  4HPP A;  4ZDV A;  1IYF A;  1AU2 A;  1P3Q Q;  1YE9 A;  4DBG B;  4WJP A;  1OKS A;  2XFT A;  3BB7 A;  3J81 S;  3UMM A;  3B2F A;  1J8C A;  2LGI A;  4M8N A;  1SXJ C;  3QCA A;  2LXC A;  1ZDV A;  2C0Y A;  3NRZ A;  2KHH A;  3HM6 X;  4GIV A;  1SG9 A;  5KPT A;  2RPQ A;  1QAM A;  2K3U A;  4CZW A;  2KMC A;  2KYW A;  3B7Z A;  1PUT A;  2KO3 A;  3U6P A;  3CF0 A;  2MP2 A;  3IVF A;  2DYM A;  3SR6 A;  4WJN A;  1DF0 A;  1V86 A;  1TS2 A;  3AEB B;  3OF9 A;  2VZK D;  1GKI A;  1J09 A;  4GHA A;  2NCN A;  4XWT A;  2FT2 A;  4GOC A;  2LHC A;  1TS4 A;  1EU3 A;  2WU2 B;  1XMQ M;  2DWM A;  1V9J A;  4BS5 A;  1PDX A;  4IBF A;  2YNM D;  2CKH B;  3LQQ A;  3RFZ B;  4HPM B;  1EO6 A;  4NOO B;  2JZZ A;  4ASW C;  1N33 M;  2WXG A;  2RSU A;  3H7S A;  1YUB A;  2N7J A;  3ZNZ B;  4RY2 A;  3IG5 A;  3VXW A;  3WXF A;  2HWJ A;  3AOG A;  1M6D A;  1E9R A;  1TDH A;  2D7G A;  1GL7 A;  2EMS A;  2LRU A;  3Q3F A;  5H92 C;  1R4N I;  2ACT A;  1GJS A;  1FCL A;  1L2B A;  1QAQ A;  3SMP A;  1JRO A;  2G3Q B;  2L0T A;  3GE8 C;  2BTW A;  3SAS A;  3N3K B;  4QOS A;  3BVZ A;  4HL4 A;  4YWG G;  2DC7 A;  4CJ6 A;  2LHG A;  1J7K A;  2DWN A;  3AE9 B;  3TCA A;  4ARI A;  2MBE A;  4LNN A;  4PI3 A;  1XNQ M;  4JI0 M;  2DX5 B;  1S3S G;  2IPP B;  2BNK A;  3F92 A;  3M0E A;  1SJE D;  3GLI A;  4YYV A;  1G59 A;  2K1F A;  4AZF A;  2WP9 B;  2A5U A;  3ZUN A;  3WAN A;  1IP9 A;  2MJ5 B;  2ERC A;  2J53 A;  2FO5 A;  2L83 A;  4C80 A;  1OQR A;  2JWS A;  1IXZ A;  1JRP A;  4M9Z A;  4BOP A;  1GJT A;  2KFJ A;  4MH8 A;  2KLC A;  2HWK A;  3EEC A;  1E8Y A;  2NBW B;  1XKG A;  4L78 A;  1FRD A;  3J7B A;  3HM3 A;  4NZL B;  4ANW A;  4ITQ A;  5LNK 1;  5KQD A;  4DMX A;  3KWB X;  1JQP A;  3P5X A;  3LB8 C;  1MEM A;  2MLB A;  3UK6 A;  4KIK A;  3H89 A;  1IWD A;  2WXI A;  4B6W A;  4C00 A;  4USA A;  5BYQ A;  1GLO A;  3RNA C;  4JYA M;  3NVZ A;  3FTF A;  2CWB A;  1SF0 A;  1DEU A;  2M5Z A;  3USV A;  1QDQ A;  1SIJ A;  3HD3 A;  2XN9 C;  3DQV A;  2X8X X;  1Z5S B;  4MT5 A;  4E74 A;  3DBS A;  2JXT A;  2RGF A;  4A5U A;  3N32 A;  3DCG A;  2IGD A;  2M8S A;  2RDB C;  3KX1 A;  2KNZ A;  1A5T A;  2GI9 A;  4PCZ A;  4NPN A;  4DMY A;  3NZU A;  5JZE B;  2SEB D;  5T8I A;  1YZB A;  3NHE A;  4BPV A;  1WGY A;  2C60 A;  5EGW A;  2C9W B;  4TUU A;  3A46 A;  2O6X A;  2V4L A;  1HE8 A;  1V81 A;  2LVA A;  2D3A A;  2WX1 A;  3NOB A;  5AUI A;  4LZZ A;  3ZCB B;  4PD2 A;  1LM8 B;  4HDQ A;  1B1Z A;  1YX5 B;  4MH0 E;  4B0E A;  5C1Z A;  3M99 A;  5E6J A;  1TS3 A;  2QEJ C;  3Q8G A;  2I1K A;  5MPO A;  3PZD A;  3SMS A;  5IWA M;  3GP7 A;  2R65 A;  5JHA A;  1KFY B;  2EJS A;  1CQD A;  3NS1 A;  3LW5 F;  1ZIV A;  1JWM D;  3FUU A;  3GZN I;  2CHV A;  3JSV A;  2JWU A;  2UXC M;  1E10 A;  2JUJ A;  2DZK A;  5LLI A;  3FIL A;  3QK0 A;  3T3N A;  1HR0 M;  4G3X B;  2J42 A;  3WHL A;  1DV0 A;  4NJC A;  3A1Q B;  4J3O D;  3RPF C;  2MH8 A;  4GC9 A;  3U61 A;  1YD8 U;  1GMY A;  4WIP A;  4J6I A;  8PCH A;  1DOX A;  2K5P A;  4NRW A;  2G1E A;  3K24 A;  3KSE A;  3V6C B;  4ARC A;  1ACC A;  2MBQ A;  4AJW A;  5KPZ A;  5DPT A;  2KKC A;  4ANV A;  2GNO A;  2UXD M;  2LNH C;  3IXS A;  2CV1 A;  1HNW M;  3H7P B;  4Q8G A;  1H6U A;  4LNK A;  3P4R B;  2NTS A;  4LTU A;  2ON8 A;  1IBM M;  4ZRJ A;  2KQ4 X;  1D6E C;  2ZCC A;  1X1M A;  4K7W A;  3L26 A;  2JVC A;  4I8O A;  3HHY A;  2O5R A;  1JWU D;  2V1C A;  1GAQ B;  1RRB A;  2DHZ A;  5BMG A;  4XR7 A;  3AH7 A;  3SDL C;  4MSM B;  1CS8 A;  4II3 B;  1NY6 A;  1UBI A;  3AE2 B;  4JI7 M;  5IA7 A;  4ZRP A;  2BYT A;  1C9F A;  4NY0 A;  1MPE A;  3MJW A;  2WNM A;  2DAM A;  2LAS A;  2NBU A;  2WDT B;  2FH0 A;  1XF5 L;  1KH0 A;  1R7R A;  2JZ0 A;  2IO2 B;  2INC C;  3BYY B;  1XXG A;  1FFU A;  2G4S A;  1R4N B;  2JRH A;  3E1Z B;  5BPV A;  1YN5 A;  3APD A;  9PAP A;  2P7U A;  2M56 B;  2BBC A;  3DHI C;  2EA0 A;  5A2Q S;  3KW6 A;  2LVP C;  5DYI A;  2QCZ A;  3DBH B;  1GL6 A;  3EIH A;  1HXY D;  3HVD A;  3AI8 A;  2QIE B;  1VZ7 A;  1T6B X;  2LUE A;  3FRI A;  2ARY A;  2WYQ A;  2VZK B;  3IV2 A;  2R9O A;  2BWB A;  3MK6 A;  1VSN A;  3ZC7 B;  3ZH9 B;  1NV9 A;  3P4S B;  1E90 A;  1XLQ A;  3K92 A;  4KIK B;  4JPS A;  1CZP A;  1UFZ A;  1HEZ E;  4L6V 6;  1CTE A;  4RMA A;  3APC A;  4MGK E;  1TYG B;  3ZO5 B;  3C58 A;  4L8R C;  2L2D A;  1FNW A;  2BTE A;  4I07 A;  1MN3 A;  3KVF B;  5KQ8 A;  1Q0W B;  2WSC F;  4LNO A;  2Z0E B;  3M95 A;  1PRB A;  4LNI A;  1WZ0 A;  4XDD A;  2WXF A;  2NVU I;  2H88 B;  2KJR A;  1T0Q C;  3IT4 B;  2O01 F;  5EP1 A;  5EP3 A;  3AI5 A;  3CST A;  5AUK A;  4AWJ A;  1GCB A;  4GMQ A;  3FUT A;  4TQ1 A;  2BB5 A;  3NZ3 A;  4IW0 A;  4DUY M;  4OW0 A;  1PPP A;  5DFL A;  3AB5 A;  3AOE A;  1L6V A;  4DV1 M;  1I4G A;  2Z4S A;  1QDR A;  2VF7 A;  2KXJ A;  3HY5 A;  5FK9 C;  4P6E A;  2BJW A;  1ZMW A;  4A55 A;  1AYF A;  2KAC A;  1SE2 A;  3P4P B;  3MC0 B;  4KX6 B;  2WBF X;  1ZAE A;  3ZVV A;  3GLH E;  4QRX A;  3W9C B;  2Y6E A;  3P42 A;  3CF6 E;  4M01 A;  4RH6 A;  2IZV B;  2W9N A;  2XK5 B;  2E01 A;  1SEB D;  1OAI A;  3GP1 A;  3P5V A;  3TJP A;  3PNY A;  4B7H A;  1JR3 E;  1DGH A;  3NBX X;  5FKA C;  2KEB A;  1TY2 A;  2J7Q C;  1Q39 A;  1EWO A;  4DV5 M;  3H8B A;  4AW4 A;  1E5W A;  3B9J A;  5JHB A;  3AEA B;  2JTC A;  2ASQ A;  4NNJ B;  1D0K A;  2CFO A;  4L16 A;  4R71 A;  2LI5 A;  3KP0 E;  2I1J A;  2K47 A;  2DEN A;  4DUZ M;  4KKI A;  3FTD A;  3KWZ A;  1WXV A;  2REX A;  2FFJ A;  1RM6 C;  4LFC M;  2LGS A;  1GPX A;  1N75 A;  1VRA B;  3KWL A;  4N9F 4;  1QOG A;  1HT2 E;  2FRA A;  1EUV B;  4FN2 A;  3H7P A;  3QJ3 A;  2W82 A;  2YJB A;  2QHO B;  1D3Z A;  2AVW A;  2V1Y A;  5LXI B;  4KOD A;  4YTN B;  1TL9 A;  4YSX B;  2L05 A;  3P1M A;  4K3B A;  2L3Z A;  1FD6 A;  2VQE M;  2AQ3 B;  3N3G A;  3GPY A;  3R3M A;  1DGB A;  2BS3 B;  3W5V B;  2XNA C;  4W9K A;  2ONQ A;  1QQW A;  2J7O A;  1QAN A;  2C5R A;  5HG2 A;  1DKI A;  4BOS C;  3QAU A;  2VDB B;  4AG6 A;  4BBN C;  4BAX A;  1POP A;  4IM2 A;  3VUY A;  4IM0 A;  4B0M A;  4BOZ B;  2JF5 A;  4DV3 M;  4HLE A;  4CHK A;  1K53 A;  3ENE A;  4A9A A;  4HLQ A;  1RYJ A;  4RF1 A;  3RNC C;  4FUL A;  3D8L A;  1FRR A;  2L76 A;  2PJH A;  3GOE A;  4M9S A;  1VZ8 A;  2GMI C;  4AXL A;  2FS1 A;  3MMP A;  1VDD A;  3SAT A;  4PDI A;  3RGP A;  4Y28 F;  4IUM A;  2LGX A;  2XEW A;  3BXW A;  3SFD B;  1NSF A;  3LJ3 A;  2H5X A;  2BYF A;  2ICI A;  5D94 A;  2IJ0 A;  1GVN A;  2CJO A;  1F2R C;  4K7U A;  2JT4 B;  3J27 B;  1Y56 A;  3GLI E;  3SAW A;  1OQQ A;  5ITT A;  4KKJ A;  3X0W A;  2JQG R;  1MHH E;  3CH3 X;  2K8B A;  1VDL A;  2VH2 A;  5EZQ A;  2EKE C;  4UDU C;  4EEW A;  4YT0 B;  1V34 A;  2KWV B;  2UYZ B;  3S3R A;  3FUX A;  2J7Q A;  4GB9 A;  2PVG C;  3AE4 B;  3PT2 A;  4IP3 A;  1XXH E;  2D7H A;  3ZNI D;  3MFG A;  4AKG A;  1EE8 A;  4X6I A;  4HCP B;  2BT6 A;  5D2M B;  5DPW A;  2N9P C;  4RM9 A;  3UGJ A;  1KFX L;  1ZV1 A;  4W5C A;  4KLN A;  1WI0 A;  3NVW A;  3TWM A;  1PPN A;  4FCT A;  4I05 A;  2JU6 X;  2M19 A;  1DO2 A;  3ZJV A;  1J0G A;  3PO0 A;  1Q3B A;  3GPU A;  3NY5 A;  5BR8 M;  1PVJ A;  2MBO A;  2PTL A;  3WHK A;  3BK1 A;  2P86 A;  1Z5A A;  1PM5 A;  2LUM A;  1YMH E;  4ZUX U;  1D0L A;  4FWG A;  3K9P B;  1F52 A;  2ZPN A;  2AQ2 B;  3W67 A;  3O65 A;  2CU1 A;  2GB1 A;  2KQ7 A;  3I5J C;  4YL8 A;  3N1Y C;  1WZ3 A;  2KN4 A;  4HEO A;  1WX7 A;  1Z5B A;  3SC3 A;  4HJG E;  5HKH A;  4DV0 M;  2ZBK B;  1I4X A;  2FIF A;  4KGS A;  2F5N A;  2DXI A;  1XLO A;  2JXX A;  3SAU A;  3NVY A;  1Y4H A;  1FNV A;  1GOZ A;  2N7E A;  1WGD A;  3L08 A;  4IWQ A;  5CHV C;  5BYS A;  4MSX A;  4P1C C;  4YYQ A;  4K7C A;  2KA6 B;  3VQI A;  2JP7 A;  3HRD D;  5DPS A;  5TSS A;  2QCU A;  2IO0 B;  3SFZ A;  1Z59 A;  1IBX A;  4NSR A;  4ICV A;  1OFI A;  3QA8 A;  5JZE A;  3QIJ A;  3DBL B;  3K1J A;  3HKP A;  4GSW A;  1CJL A;  2G7Y A;  3HVZ A;  2KK8 A;  2FCQ A;  4NRV A;  3IOQ A;  1XXH A;  2FCM A;  1FM0 D;  5EP4 A;  4LF4 M;  1SXJ D;  4HWY A;  4S12 A;  2BB6 A;  1LV7 A;  2UWQ A;  3DBL I;  3PRE A;  3UJN A;  4JI2 M;  4MB7 A;  4M0W A;  1VDV A;  1TZ1 A;  3PRP B;  1NYR A;  3E46 A;  2KMA A;  1N32 M;  4AI6 A;  2NMQ A;  3FKY A;  4MI7 A;  4D8I A;  1E8Z A;  3PRP A;  2IO1 B;  5EE1 A;  2PAD A;  2CHZ A;  1RU3 A;  2PE6 B;  5CHF A;  3TL5 A;  2FID A;  4DQO C;  3O13 A;  1IGD A;  2JRI B;  3U60 A;  3NBI A;  3GLF B;  3VDP A;  2MBB B;  1QKZ A;  3CBK A;  2C7M B;  4GEW A;  2PBH A;  4DXF A;  1BP4 A;  2D3G A;  3U7Z A;  1ITO A;  1KRH A;  2K39 A;  3TMP A;  2RRU A;  1P9D U;  2VF8 A;  3HGI A;  1U5I A;  2Y0Q A;  1GJZ A;  1E7V A;  2MX2 A;  3QQ8 B;  5IT9 S;  4AJY B;  2Y21 A;  1PJJ A;  4LJ6 A;  2NPT A;  3PZ8 A;  3RVV A;  2GBJ A;  2GQF A;  1D5Z C;  1ESF A;  4P6V F;  3U6D A;  1YK7 A;  4KO8 A;  4DR4 M;  3OLM D;  1UKF A;  1N5W A;  2FNJ B;  2PW9 A;  4BB9 A;  3I4V A;  1NEK B;  3VK8 A;  4G4N A;  2ZAM A;  4I81 A;  1ZQ9 A;  1NPZ A;  1NHW C;  1JWB D;  2YVC A;  4KZC A;  4FAD A;  1ZOY B;  3FC4 A;  4MGZ E;  4E3C A;  3NWL A;  3FD9 A;  3BCN A;  2L7H A;  3Q14 C;  2I2Y A;  3W1S A;  5EE0 A;  1QVR A;  2UUB M;  2C9O A;  2CUZ A;  2XFS A;  3RNB C;  5I4D A;  2G3Q A;  4N58 A;  3Q8X A;  5AZH A;  1UBQ A;  2NTT A;  3C19 A;  4F1S A;  1L4D B;  3HJ8 A;  1EIJ A;  1P3Q U;  1ROE A;  2DYB A;  4LF6 M;  2WS3 B;  1V1P B;  3CMM B;  2PKO A;  3QT4 A;  4EZL A;  2Z4R A;  5EE9 A;  2G4D B;  3U30 A;  2JNH A;  1MJG M;  1CPJ A;  1WRD B;  3I04 M;  3LVV A;  4Z6Y A;  3U60 B;  4AP4 C;  1L7Y A;  3VAW A;  3UQB A;  3C8Y A;  1E0Z A;  2WXJ A;  2M0A A;  3AV8 A;  3ZXV A;  2WXK A;  3FUV A;  1JR3 A;  4OVU A;  3KLS X;  3WXG A;  4B3T M;  3TQS A;  2OQ4 A;  2CJN A;  1J7A A;  4F8C B;  4NXN M;  1TDZ A;  1RAX A;  2L7I A;  4M9X A;  1EWL A;  7PCK A;  3ALB A;  4MM3 A;  3RT3 B;  3L17 A;  4WA6 A;  3R8B A;  4LDT B;  4US8 A;  1JQJ C;  5GKN A;  3PHX B;  4L2Y A;  4ZYS A;  3C0R A;  2RMM A;  3FRH A;  3FUW A;  4FCV A;  3KH0 A;  2N0S B;  4RKU F;  1EU4 A;  2OHF A;  1T3T A;  4B3S M;  3OVX A;  5FPW A;  3KUD B;  3GLG A;  4OVV A;  3QX1 A;  4G4O A;  1UZX B;  2KWU B;  2KVR A;  1XQQ A;  3TE6 A;  1NB3 A;  3X23 A;  2EKI A;  3HK0 A;  2LJ5 A;  3ZYY X;  1VQ1 A;  2CS4 A;  2A5Y B;  2WDQ B;  2AYO A;  4LJ7 A;  3ZW3 A;  2WZJ A;  1F2R I;  1AIP C;  1WYW B;  2D07 B;  1NDD A;  2BS2 B;  3BK2 A;  2XGN A;  1D2N A;  1ORY B;  2QSF X;  1WJ4 A;  3MC9 A;  1XB2 B;  1LO5 D;  1HUC B;  1WR1 B;  2J4X A;  2V4I B;  4MAC A;  3EFU A;  2LEK A;  1GUA B;  1ZXI A;  4XE0 A;  2BF8 B;  2DC6 A;  3HJQ A;  2DYO A;  3AMZ A;  1K82 A;  2IY0 B;  4A6Q A;  5F3W A;  3DF0 A;  2CV0 A;  3GLG B;  1SJH D;  5JH3 A;  1VEG A;  2DEN B;  4DDI D;  2AHM A;  1MG4 A;  1Q5W B;  5D3D A;  1EF7 A;  1AIM A;  5F02 A;  3ZNH A;  3L10 B;  3R7R A;  1T6O A;  1J19 A;  4OVZ A;  3PT2 B;  2J7Q B;  3MHV C;  3UF8 A;  3TEZ A;  5FLX S;  2KX3 A;  4JXJ A;  1FO4 A;  4GIP A;  3A45 A;  4MDK E;  2M17 A;  4QAY A;  2N7D A;  1UWM A;  1CB5 A;  2EEL A;  1PAD A;  4LGY A;  3BBA A;  3PNV A;  2PIA A;  3ZQJ A;  4FJV B;  1ATK A;  1YVB A;  3W31 A;  3Q8E A;  1ENF A;  1D0M A;  3ZNG C;  5KPR A;  3T38 A;  2WDV B;  1FJG M;  4PP2 E;  4DR7 M;  2XH9 A;  4GH9 A;  2OJW A;  1FMA D;  1OJL A;  4DR1 M;  1R5L A;  2ZAN A;  4GN1 A;  1E32 A;  1T5X D;  1F2A A;  2JXN A;  2B3T A;  4K1R B;  2KTR B;  3K9M A;  1KLU D;  3PLV A;  3FYD A;  2IGH A;  4JE3 B;  4AKI A;  4XBO A;  2BGF A;  2F5S A;  1U9W A;  2YJC A;  4JI6 M;  1QYR A;  4IWP A;  4QNR A;  4GDK A;  4N59 A;  1IBL M;  3A4R A;  2EKK A;  2KOX A;  1VR9 A;  1ZMV A;  2O6V A;  2JZ1 A;  4NXM M;  1IXR C;  1SXT A;  3SHQ A;  2EO2 A;  3U8E A;  2ZW1 A;  4D8B A;  2VHF A;  2KWC A;  5EQT A;  3LCU A;  3U2S C;  4ZRQ A;  2X4A A;  4B9K A;  3N30 A;  5D6J B;  1NV8 A;  2KJH B;  4DHJ D;  7CAT A;  4MGI E;  2HDE A;  4IBD A;  1RFK A;  4KSK C;  2RKO A;  3KYD D;  4GC5 A;  4MJS B;  5LXH A;  2DJG B;  3GLG E;  4NL4 H;  1E9M A;  2HD5 B;  4FJY A;  2KRK A;  1WXM A;  4FLH A;  1I4R A;  1A5R A;  4W9C A;  2BTW B;  5HI1 A;  3KUC B;  4L1B A;  3FYC A;  2ZNV C;  2NPT B;  2DC8 A;  1P7F A;  2CE7 A;  3PSE B;  5GXG B;  4LJ8 A;  1L4Z B;  3VR9 B;  3MHH A;  3J80 S;  4LG2 A;  6PAD A;  3J7A S;  1N6Z A;  2W55 A;  1WIA A;  2WDR B;  3NZS A;  2G45 B;  4JWS C;  2AWT A;  4KVG B;  2XF3 A;  1FPY A;  3A42 A;  2Y20 A;  2MJE A;  1ZMU A;  1ET9 A;  1F1H A;  2BWE S;  2GLS A;  3TRK A;  3B21 A;  3VH4 B;  2M60 A;  2K25 A;  3JAM S;  3VK7 A;  2N9K A;  3UIP B;  1K3W A;  4KHP M;  2HHH M;  1L1Z A;  4XC2 A;  2CRU A;  1C7Y A;  1WJN A;  2J52 A;  2DAI A;  2Z7J A;  4GIT A;  2INN E;  2LVO A;  4FBJ B;  1TKG A;  5JXV A;  1QOL A;  4ANU A;  4OZC A;  3EFC A;  1QF6 A;  4GKK M;  4L15 A;  4HK2 A;  4G54 A;  3DVN V;  1SXJ A;  2DI0 A;  2K22 A;  5FTN A;  5LMN M;  1TH4 A;  2FNA A;  3GS2 A;  1R4M B;  2XSZ D;  3J9C A;  2WSE F;  2DHY A;  5EXS A;  2XU3 A;  4NJ6 A;  2YQZ A;  3WAP A;  2L1A A;  3VR8 B;  3KOZ E;  2DCC A;  1PGY A;  2QJL A;  3GQ3 A;  2YFQ A;  2R61 A;  3N9Y C;  4E71 A;  4H2A A;  5K16 A;  5FTJ A;  1J7B A;  1ME3 A;  2AL6 A;  3NS8 A;  2LWX A;  1TKE A;  3FTE A;  1T3Q A;  4W5W A;  1QUS A;  4JI3 M;  4LCD E;  4LK0 M;  2XEP A;  3HHM A;  2NS5 A;  2QHO A;  3PHW A;  2X8A A;  3AEE B;  1JML A;  2XU1 A;  1NNU C;  2KWD A;  3E56 A;  4RNA A;  3V6E A;  2FE8 A;  1X9Y A;  5IAA C;  1Y08 A;  2HTH A;  3FIL B;  4LJO B;  1ME4 A;  1WY8 A;  3V6E B;  3VDU A;  3K2L A;  3LVW A;  3Q3J A;  4RM8 A;  2LVO C;  3QSD A;  3JYU A;  3ZDM C;  2Q2E B;  1NQC A;  1MU5 A;  4L4U A;  3PV1 A;  3C9P A;  2ACZ B;  5H37 D;  4PS7 A;  4PP1 A;  2PNS A;  2N35 A;  3CSF A;  5IOI A;  1WRI A;  5CHV A;  4CHT B;  1I94 M;  1WIV A;  3KP1 E;  1OFF A;  5CX3 A;  5L83 A;  4DK5 A;  3Q3M C;  1WX9 A;  1DGG A;  1M4V A;  1IPG A;  1SSN A;  2PPH A;  2WXR A;  3M3J A;  4Q8H A;  4QHT A;  3EUB 2;  2HAK A;  1S4V A;  2ATO A;  4M0D A;  4GGQ A;  4KLB A;  3VH3 B;  3WA0 A;  1JWA D;  2KJ6 A;  3VKG A;  1K52 A;  1P1A A;  3HU2 A;  2XK5 A;  5IZ7 D;  3NHE B;  1V1O A;  3U8Z A;  2XLJ A;  3CH2 X;  2G9H D;  2QQ8 A;  4WQO B;  3PRZ A;  1KSF X;  2J0K A;  4IUM B;  1PPD A;  4NQK E;  3PHX A;  2APL A;  3PBH A;  2IDY A;  2CP8 A;  2CHW A;  2DWQ A;  2XSZ A;  3RE8 A;  1IFY A;  2ZW0 A;  4RFB A;  3H7D A;  4BOQ A;  2YJ9 A;  1CQV A;  2WU5 B;  2P5T A;  3B7N A;  1Q1O A;  4YY3 M;  2M1M A;  4LJP B;  4G3O A;  1WGR A;  2VH1 A;  1IXS A;  2WGS A;  3ZXR A;  2DCA A;  1J7C A;  1QAO A;  2W3R A;  3T3O A;  3IEJ A;  5A24 A;  4WH4 A;  4CIS A;  2VRR B;  1S1Q B;  3V61 A;  4IBE A;  3BYT B;  4N8W A;  3U7D A;  1GLN A;  2LVN C;  4CDE B;  5EXP A;  3PRM A;  3GE3 C;  3QYB A;  2D11 A;  5AZG A;  4KDL B;  2IGG A;  2C5L C;  3AJI B;  3AXC A;  1Q6K A;  2M0X A;  3H6N A;  2Z8L A;  4XX5 A;  3BII D;  5CHT A;  4F7Z A;  2YR0 A;  2L8J A;  3ML9 A;  2LGY A;  1W5S A;  1LGR A;  3P4Q B;  4FD2 A;  2B1M A;  1DOI A;  4G4Q A;  3TWL A;  1D5X C;  4FXC A;  1U9Q X;  2R6F A;  2IND C;  1L5P A;  4TV3 A;  1WJ6 A;  3TWK A;  3KS8 A;  4JL9 A;  3WXE A;  1HNZ M;  3RCZ A;  2ZCB A;  3EA6 A;  1IY2 A;  1MHW A;  2BYV E;  4GLS C;  3OVZ A;  3PZ7 A;  4LNF A;  5BO4 B;  3VUX A;  2K8H A;  1TIF A;  2GHU A;  1G8P A;  4B3R M;  1H8C A;  3L16 A;  4CQN A;  1QDT A;  3MJ5 A;  5EE3 A;  3ZJT A;  3AED B;  2YEP B;  4LJ9 A;  2DZN B;  3R7Q A;  1VEK A;  3LDZ E;  2E6X A;  2KNB A;  5C2T B;  4ZHP A;  2DC9 A;  3N1X C;  3A9K A;  2KDL A;  2LFI A;  4GU2 A;  4R7G A;  1BUI C;  2Y0T A;  3L54 A;  1YJI A;  1XHB A;  4BVU C;  2GOW A;  2JZ3 B;  4NC6 A;  2R2O A;  3B1L X;  4RGN A;  1HTO A;  1I4H A;  2JY8 A;  3U6S A;  2DAJ A;  4I6L B;  2HCB A;  4BBA A;  4YTP B;  1QOB A;  1VLB A;  2Z84 A;  4X6H A;  5C3J B;  2K9X A;  2NQG A;  3KFQ A;  1F0Z A;  5EF4 A;  3SFE B;  4OEL A;  2JA2 A;  1EWC A;  5HFY A;  1AYU A;  4BS6 A;  4GDL B;  2C98 A;  2VHS A;  4KV2 A;  2JYT A;  4FHJ A;  2DWZ B;  1HJP A;  1WXA A;  1SE4 A;  3Q2A C;  3Q6B A;  4L23 A;  2R2Q A;  4IBB A;  3O1G A;  2QZ4 A;  1PXV A;  2JY6 B;  3SAR A;  2KDF B;  4MJS A;  4WWP A;  3U5Z B;  3EC8 A;  3P5W A;  4W9I A;  1HTQ A;  2G8L A;  1UH6 A;  3GLH B;  4BKS D;  2PRE A;  2D5G A;  1JAL A;  2MSE D;  2KRU A;  4YSZ B;  3A1Q A;  1C3T A;  4US9 A;  5EXX A;  1YN4 A;  2JY6 A;  2FRQ A;  2OZ2 A;  1RLF A;  4DDG D;  1WGG A;  2V3N A;  3RD2 A;  3KSJ A;  2DCB A;  2KHW B;  1ICF A;  3IG3 A;  3D8B A;  4W9F A;  4FJZ A;  1SBB B;  4WAF A;  1QLB B;  2N1W A;  4EZK A;  1I4W A;  5IN7 A;  3BY4 B;  1C4A A;  1Z2M A;  3GO8 A;  3RZW C;  3IAS 1;  2XZU A;  2GFO A;  3I01 M;  1EWM A;  3CBJ A;  1C76 A;  1SXJ B;  2ZZP B;  5L95 C;  2LHE A;  3P5U A;  5E26 A;  5ITR A;  4PDG A;  3OIS A;  1G6J A;  3RUI B;  3B79 A;  3B89 A;  1K3X A;  4FA6 A;  1W5T A;  2EMT A;  2V1U A;  1ZCM A;  1VD2 A;  1CK1 A;  2FQ9 A;  2DWL A;  4UN2 B;  3TBL D;  4JWU C;  3SU8 X;  3HHA A;  1FCC C;  2DZM A;  1N34 M;  4QBB A;  2RD0 A;  2MRO B;  3ZJU A;  5CVO B;  1AAR A;  4C7Y A;  1G71 A;  2KFK B;  2OUL A;  2LHD A;  4LFB M;  3Q8F A;  3OAW A;  5BMH A;  2WXP A;  1SGH A;  3UGB B;  1BQI A;  3HHZ A;  1WWT A;  4LJ5 A;  3AFH A;  1FFV A;  3A98 B;  3HZJ A;  2QMT A;  5DCN A;  2O25 A;  4I6P A;  1KOT A;  1QIL A;  4HCN B;  4BBN F;  2FCN A;  3SEB A;  2UU7 A;  3W0F A;  2RDH A;  4B7F A;  1T0S C;  3A33 B;  3VTW A;  1FEH A;  3K8U A;  1V97 A;  5C18 A;  5EP2 A;  2O6V D;  5FR3 A;  1WM2 A;  4X64 M;  1JCK B;  3I3T A;  1TGU A;  1OFH A;  4GKJ M;  1G4A E;  1IN5 A;  2F5Q A;  4CGY B;  3SYK A;  2MJD A;  3H1U A;  4G11 A;  3L27 A;  2WX0 A;  2DAK A;  1AWD A;  3V6C A;  4N4Z A;  2MRP A;  1NJG A;  1XMO M;  4JV5 M;  1YQ3 B;  2C9C A;  2ZM6 M;  3UZU A;  4FIP A;  3D6S A;  3I51 A;  1HQR D;  1KLG D;  1R4G A;  4FWD A;  2Z8Y M;  5IRE B;  3K9O B;  2Y5B B;  4QHS A;  1AEC A;  2AUX A;  5FTK A;  1XWI A;  2F4V M;  1N60 A;  2O6V B;  3K9O A;  3KWV A;  1WF9 A;  3I63 C;  1JRU A;  1C4C A;  3RYT A;  2NQD B;  5C23 A;  4LRT A;  2IY1 B;  4NQL B;  3IHP A;  2BVC A;  4TQ0 A;  4N6E B;  4WAA A;  4GRI A;  2UU9 M;  2MGW A;  2KTR A;  1IQP A;  3AU5 A;  2DZY A;  3F75 A;  3UIN B;  2HTM E;  1RWS A;  3GRR A;  2KDI A;  1XCT L;  4AUQ C;  3I3T B;  4S0R A;  1TT5 B;  4K7S A;  2NR2 A;  4EKU A;  2D3C A;  1XO3 A;  3AE7 B;  4URK A;  1NEN B;  2EUC A;  1KTK A;  3B7Q A;  4HKQ A;  3GQ4 A;  3FTC A;  1PQS A;  2B76 B;  3D32 A;  4PT5 A;  1NO1 A;  1V2Y A;  2LZ6 A;  3TNX A;  3H6S A;  2CIO A;  4QOZ C;  2DZJ A;  1HA5 A;  2R62 A;  2O2V B;  4C4V A;  1U4A A;  1JWS D;  1EF5 A;  2SAK A;  2DAG A;  2L00 B;  1LFD A;  3JVZ X;  3TPZ A;  3AE8 B;  4JX1 C;  5DYG A;  2UUC M;  5JI3 E;  4A3O A;  1N61 A;  2H89 B;  2MH7 A;  2QDF A;  1P98 A;  2QSD A;  4REZ A;  3GPP A;  5IP4 D;  2YJ8 A;  4YV8 A;  4EUT A;  4P16 A;  3U6M A;  3WAO A;  4BSQ A;  1TS5 A;  3H4M A;  3DWG C;  3TSS A;  1V5O A;  1B9R A;  4QRV A;  3OWE B;  5CHW A;  1VJV A;  1BY8 A;  2BU3 A;  4LFA M;  1CJE A;  5JA7 A;  3ECI A;  3WCQ A;  2KTF A;  2BKR B;  3DHH C;  2N9X A;  1YLA A;  2MP2 B;  1PJI A;  1WR6 E;  1XXH B;  4NAW A;  4A8X C;  3Q3O C;  1PCI A;  2WHI A;  1ZDX A;  1E6E B;  2KN5 A;  4WW0 A;  4BFR A;  1UM8 A;  2JPH A;  5E6P A;  1R2Z A;  3S2A A;  3ZKJ C;  4D81 A;  3JR5 A;  4W9H A;  2DZO B;  3PFI A;  2R45 A;  4BQV A;  1QT9 A;  1VEJ A;  3L13 A;  4EOY A;  4CDC B;  4LJ4 A;  4YYR A;  1LQB A;  4AQ7 A;  1HQY E;  3V3X A;  2Y5C A;  2BPS A;  2DNA A;  1YOV B;  2OPF A;  2LVQ A;  4JI5 M;  3IBE A;  3PNR A;  3UI3 A;  3TEY A;  4DHZ E;  3ZRC A;  3EHV A;  1DYQ A;  1E8X A;  3ML8 A;  1NL6 A;  5BMI A;  5CVM A;  1EWY C;  3HIZ A;  4Q7J A;  3GLF A;  1XNR M;  2E5L M;  2JRI A;  3V62 A;  1Z6T A;  3OTO M;  2J5Y A;  2KDE B;  2L4E A;  1ZKH A;  4W5B A;  3GRU A;  1L2C A;  4M02 A;  3HWN A;  2X49 A;  3IFU A;  4X6J A;  1SNK A;  1V8C A;  1S3S A;  4G50 A;  3QWL A;  3HJS A;  2UXB M;  4IG7 B;  4AXM A;  3MHS D;  4M00 A;  4EE2 A;  3PGE A;  3UQA A;  1KXR A;  3QAQ A;  3TEW A;  3W2D A;  1BGO A;  3H4J A;  3KSX A;  1AUA A;  2QNJ A;  2KNA A;  4FCW A;  2BDL A;  3LFY A;  3U6Q A;  1C4P A;  3KW5 B;  4PS8 A;  4S17 A;  3AE6 B;  4AQY M;  3GPX A;  1NB5 A;  3SHG B;  4JI4 M;  4AG5 A;  4GUA A;  4D80 A;  1UF0 A;  1QQR A;  1NJF A;  3WIM A;  4LGM A;  2V3P A;  4LRS A;  4F1I A;  2WQY B;  1YQB A;  3ZLZ A;  3F5V A;  2L0F A;  2F7D A;  2LH0 A;  2HL7 A;  1YJJ A;  4AS1 A;  1GB1 A;  4IJE A;  1N36 M;  4D82 A;  4JGH B;  3VFK A;  1WFY A;  2UUA M;  2FOI C;  2R6N A;  2DAE A;  3THG A;  3RMK C;  1A70 A;  4AKH A;  4PS3 A;  3RUL A;  3LMM A;  2L52 A;  1PIP A;  2MR9 A;  1KF6 B;  3O65 B;  1TLO A;  2CV2 A;  1MFW A;  2AYO B;  4FW9 A;  4W9D A;  4JI1 M;  5C1B A;  1WJ7 A;  2ZTD A;  3H8H A;  2AGA A;  1STE A;  2LXA A;  3L2A A;  1OGW A;  2JY7 A;  3BY4 A;  4QNM A;  4MGY E;  2V6Z M;  3K8Z A;  2MA9 B;  2ZPY A;  5GMV A;  3TL4 X;  3V05 A;  5AEK B;  5ITU A;  3BPM A;  2M4N A;  3QWZ B;  4CIZ A;  3CTW B;  1WX8 A;  1XLN A;  3GCB A;  2R0I A;  2AIM A;  2K8C A;  1WSP A;  1ZW7 A;  2JQR B;  5ITY A;  5FTL A;  4K0K M;  4HDO A;  3QAR A;  2E02 A;  2JZP A;  3TMP B;  2A4Z A;  3DVN U;  3W30 A;  1OQY A;  3LCV B;  3T1H M;  4EFO A;  3DA1 A;  2R9M A;  4KT0 F;  3U5Z A;  5D3I B;  5EDS A;  2KT7 A;  1DOY A;  3IFW B;  1TH2 A;  1NVI D;  4O1N A;  1CVZ A;  1HNX M;  2J0J A;  1IN4 A;  2QBY B;  2DLB A;  3PXG A;  3VTU A;  4C56 C;  2AYN A;  3MC8 A;  2R44 A;  2F1G A;  3VKH A;  2D2Q A;  1IXS B;  3B2G A;  2K0B X;  3QHT A;  3PTF C;  2NQA A;  3ZQ4 A;  4GXB A;  2LXE A;  1F2C A;  4IJF A;  3AE5 B;  2H1R A;  4ANR A;  1E8W A;  4GMV A;  5KHO A;  3W5U B;  2WWZ A;  1MI0 A;  3CGW A;  2DZI A;  3ERV A;  3Q8B A;  4DV2 M;  2GRI A;  3PVL A;  2Y3A A;  5J18 A;  4FK5 A;  1DGH B;  4QH6 A;  1MX0 A;  2CB5 A;  2HKJ A;  4C4V B;  3Q3N C;  5J17 A;  3FE3 A;  2DOS A;  3SHF A;  4ACF A;  3ONS A;  3B0A A;  1V80 A;  1OTR B;  2RGO A;  2JQF R;  1ZE3 D;  3RVX A;  4OU7 A;  1OAO C;  2KZR A;  2J7N A;  4P1B C;  3I4Y A;  3MTV A;  3RGS A;  2LD9 A;  5IKC M;  3EIE A;  1IN7 A;  5FTM A;  4W9G A;  1WMH B;  1C78 A;  1L1T A;  1WR1 A;  2ZAO A;  5EJC A;  4HPL B;  1L2N A;  2OOA A;  4D2K A;  4BKS A;  1YX6 B;  2QIL A;  4DR5 M;  3B08 A;  1PPO A;  2R18 A;  3L25 A;  3VRA B;  4F2L A;  1AYW A;  1L2D A;  2BDZ A;  4G0N B;  3T8M A;  4ANX A;  1Q3C A;  1T43 A;  2G5G X;  4IBC A;  3W68 A;  1YQ4 B;  4DV6 M;  4HEA 1;  4XGA B;  1QMY A;  2HXZ A;  3PDF A;  2K6D B;  3V76 A;  1NNJ A;  3Q8C A;  4XWW A;  4P17 A;  1SIF A;  4ICU A;  2Y5B A;  4XUI A;  4ZPX A;  1EFU B;  3TEX A;  1TJE A;  1RFA A;  3PHW B;  3RVW A;  4KGT A;  1N78 A;  1MDW A;  1Q02 A;  2JYE A;  1FIQ A;  3DZD A;  1TKY A;  3C3E A;  1T0R C;  5ITX E;  1HZ6 A;  1TTE A;  3RZF A;  4LY6 A;  3MOR A;  4PYZ A;  4KZ0 A;  3ZDT A;  4LF7 M;  1IUE A;  3AKZ A;  1L0Y B;  2R4E A;  8CAT A;  1WYG A;  5D7G A;  2HH5 A;  1K50 A;  4DR3 M;  1UD7 A;  3RNF C;  2KZU A;  3LYY A;  2OO9 A;  1ZXH A;  3FKE A;  3HHW A;  2BKF A;  3EGR A;  1P0R A;  2E00 A;  3LXF A;  1TF0 B;  1GAB A;  4MEL A;  2N9E B;  1TTN A;  4HWI B;  3AM9 A;  3MHS A;  4KGR A;  2KQS A;  3E4R A;  3J2P B;  2W3S A;  4WJQ A;  5TR5 A;  1GB4 A;  1AU4 A;  1IBK M;  1GC7 A;  3KUZ A;  4B3M M;  1KYI A;  3BPF A;  5E6N A;  3AEF B;  3APF A;  4HXD B;  2OJR A;  2E3T A;  3AE3 B;  4QRG A;  1GNU A;  2G8J A;  2OP3 A;  2KFK A;  1MEG A;  3ZGZ A;  1KHQ A;  1A6R A;  2QC8 A;  2QPA A;  2I7N A;  2H7J A;  4K81 A;  2GBN A;  1TZO A;  1K8R B;  2WLB A;  1WXS A;  3M63 B;  5G5H A;  4TKN A;  5J2R A;  3C9E A;  4WWN A;  1NI2 A;  1V33 A;  1KJT A;  1YN3 A;  2PMV A;  3JW0 X;  4RCO A;  4TSS A;  1N62 A;  4LF8 M;  2C7N B;  1DO0 A;  5EXT A;  3IAM 1;  2G6D A;  4II7 A;  2PLP A;  1WE7 A;  4M8M A;  3IMA A;  4MZO A;  3L0W B;  1UNS A;  4LF9 M;  3VVW B;  2B3A A;  2C96 A;  4HVB A;  1BML C;  2DVW B;  1FH0 A;  1TR8 A;  2VQF M;  1LXD A;  3PSE A;  2LVQ D;  2L32 A;  1F77 A;  1D4B A;  2L7R A;  3CWI A;  3VTV A;  1EWP A;  3H8C A;  1QZM A;  4EIW A;  1KHP A;  4B08 A;  3W0L B;  4IBJ A;  4YYS A;  1NHG C;  3N1Z C;  4WJO A;  4IM3 A;  2INP E;  2LMC A;  2MHJ A;  1I4Q A;  1C1K A;  1R2Y A;  4DHJ B;  1OEY J;  4I5S A;  4DXA B;  2KMM A;  2QP9 X;  3U6C A;  2FUH B;  1D5M C;  1PGB A;  3GLH A;  2PVO D;  4DV7 M;  3A4S C;  3NG0 A;  2CR5 A;  3NJT A;  1YT7 A;  2L09 A;  4C7Z A;  5G2N A;  1TGZ B;  2FUD A;  2KAN A;  1MIR A;  1VJK A;  1IY1 A;  1FXA A;  4CDD B;  2GBM A;  4JI8 M;  4WQM A;  1YAL A;  4TUW A;  1R7S A;  3KYC D;  5PAD A;  2Q5W D;  5EZS A;  1JB0 F;  2R4J A;  1EF1 A;  4CO7 A;  4B7G A;  3BWU D;  4IWO A;  4HRO A;  1YSY A;  1XT9 B;  5FSW A;  4ZYN A;  3PLU A;  1KFU L;  4Z8X A;  2DAF A;  3WAL A;  3MP2 A;  4EZJ A;  4ZTB A;  1QZE A;  4A90 A;  3ZIM A;  4BOZ A;  3AUL A;  4MSQ B;  1CV8 A;  2ZJD A;  1IBX B;  4A3V B;  2GBK A;  2LGD A;  2FYE A;  4XYC A;  3DHG C;  3DOW A;  3A9J B;  4MEM A;  2LRW A;  1DGJ A;  3MP9 A;  2KDM A;  1NBF C;  1U9X A;  5H8Y E;  2OED A;  1NYQ A;  1L0V B;  3IUT A;  3T6P A;  3ILK A;  4YHH M;  3Q69 A;  3VDZ A;  3DPD A;  1KFV A;  4P7I A;  4LCB A;  1FXI A;  1YJ1 A;  1X37 A;  2I7P A;  3U6E A;  3ZNH B;  2AU1 A;  2N1V A;  1PBH A;  1PJS A;  2UZJ A;  4IBG A;  2BS4 B;  1N63 A;  3DOA A;  2XBB C;  4HJK A;  1I4P A;  3VHT C;  1WGN A;  3IEC A;  3T15 A;  1C1Y B;  1PE6 A;  1STF E;  2NQI A;  4D8E A;  1KM7 A;  4PYU A;  2XU5 A;  4W9L A;  2BWF A;  3URY A;  3ZRF A;  1ISN A;  3KQ4 A;  3RI7 C;  1WGK A;  5L8R F;  1L8Q A;  2F5O A;  3KFU G;  2HD5 A;  4YSY B;  5J94 A;  4BZA A;  1GG3 A;  1L0X B;  1E9S A;  2IYD B;  2RDG A;  2B1N A;  3ETR A;  4CYE A;  3ZTD A;  4W9E A;  4IDI A;  1WGH A;  1PGA A;  2DZL A;  3OG5 A;  5KHQ A;  4P6G A;  2JY5 A;  1VG5 A;  3GRY A;  3AOE C;  3PRM B;  3I06 A;  4NJ7 A;  2G8E A;  3RFW A;  4IIW A;  1NY5 A;  4FVM A;  2WXM A;  3AN1 A;  1MS6 A;  3A9K B;  4X65 M;  4YYW A;  4GDK B;  2Y5P A;  2C99 A;  3ZUA A;  3M62 B;  3MTN B;  2FBW B;  2WXH A;  3GLI B;  4ZRI A;  2DKL A;  1GO5 A;  1NVM A;  1JQ4 A;  4YTM B;  4HXD A;  2L6O A;  3E9S A;  4OEM A;  3H9D A;  2CEA A;  2V3S A;  4KDI C;  1E7U A;  3C3D A;  1V5T A;  3L29 A;  1L6U A;  3PHU A;  2DZZ A;  5LMU M;  1AW7 A;  3U52 E;  4RF0 A;  3VFD A;  1F9J A;  1BXT A;  4BOS A;  3MTN A;  4DWF A;  1N77 A;  1SE3 A;  3KS4 A;  1LTM A;  2IO3 B;  1ET6 A;  1PJQ A;  3HU3 A;  5BYR A;  4BKT A;  1SXJ E;  2C7H A;  3KW9 A;  1GEC E;  3I9V 1;  3GRV A;  5DNY A;  4N79 A;  1ZPS A;  2MQJ A;  2TSS A;  3LQR A;  1HZ5 A;  1TBE A;  3TUO A;  1UGJ A;  2YEP F;  2NQ8 C;  4LDT D;  3RNE C;  3BOW A;  3HWS A;  1IY0 A;  4OVZ B;  1Y8G A;  2KX0 A;  3BWK A;  3GLF E;  3DVG Y;  5AZF A;  1O0E A;  3W1Y A;  5E6O A;  4X62 M;  2KDB A;  3L4P A;  2KNV A;  1ZGU B;  2MWS B;  2CHQ A;  4ZHO A;  1G3I A;  1QXP A;  3P63 A;  2MBH A;  3IT6 B;  3JR4 A;  1WHC A;  4FHK A;  2ZVO A;  4NAM A;  1IGC A;  2MJ3 A;  5DPR A;  1I42 A;  3QJZ A;  5JH5 C;  4DR2 M;  2EKF A;  4I04 A;  1WM3 A;  4MGH A;  4YYU A;  1MJD A;  2JWZ A;  3KDS E;  2BYE A;  3BIN A;  1TU6 A;  1WH3 A;  4MZS A;  3ZTC A;  3IG8 A;  1MG8 A;  1Q10 A;  1MHX A;  1WMH A;  2PE9 A;  2W54 A;  3QC8 B;  4OHJ A;  3SD5 A;  3N3K A;  1WGL A;  2XZF A;  2FAZ A;  4OZB A;  2HE7 A;  2X38 A;  3I57 A;  4RGT A;  3A9J A;  1K3B B;  5IO9 A;  2YJ2 A;  1TH3 A;  3BZD B;  1U9V A;  1XLP A;  1KLV A;  2XU4 A;  4DXG A;  4LJA A;  1HQC A;  3C0R B;  2MW5 A;  3R2T A;  1ZP0 B;  4JIO U;  2V9H A;  3AU4 A;  4I6N B;  3V60 A;  1MVK A;  3GQ5 A;  2PEA A;  4JQW C;  2Z0D B;  3FAH A;  2R46 A;  2KZS A;  3E21 A;  2AX5 A;  3B74 A;  4YXD B;  3ABV B;  4WWO A;  2J0M A;  3DFZ A;  2BW2 A;  2I38 A;  2K6Q A;  2RPV A;  1WJU A;  1QUT A;  3KOY E;  4G6Z A;  1QOF A;  3BVM A;  3RN9 C;  1CUK A;  4WUR A;  1XC8 A;  2QBY A;  2D3B A;  1AU3 A;  2R9C A;  4OZA A;  3CF2 A;  2RR9 A;  1ZUD 2;  1YIW A;  1AYV A;  2DJF B;  4TMA B;  4XK8 F;  2ZVN A;  4XDC A;  1T0Y A;  3O0U A;  4NSO B;  1NI3 A;  3TIX A;  3UIO B;  3DDC B;  4RGO S;  3GZN B;  3DBH I;  2AUZ A;  4CDF B;  1G41 A;  1V92 A;  4DR6 M;  3QYE A;  2HJ8 A;  2WXQ A;  4XGI A;  4IBI A;  2LBC A;  3VLF B;  2DCD A;  3HUI A;  1F29 A;  1YK8 A;  4IBK A;  1UWX A;  3HX3 A;  1SE9 A;  4GDL A;  4ITK A;  1DGF A;  5KO3 A;  1H4R A;  1PJT A;  2AS8 A;  2F5P A;  3AEC B;  4X57 B;  3M7G A;  2CHG A;  2KXE A;  1V49 A;  4OX9 M;  2OOB A;  4R3D A;  1UGM A;  4IOI E;  1XCQ L;  4W9J A;  3U6L A;  5G55 A;  4A3P A;  1AU0 A;  1JW9 D;  2FCS A;  4YVA A;  1OIZ A;  3S3Q A;  3IHP C;  4IKG A;  4A20 A;  4JN6 A;  3PW3 A;  2KW0 A;  1OEY A;  1VZ6 A;  2DBY A;  2R9F A;  2ZTC A;  2K6B A;  1V6E A;  4K3C A;  2KD0 A;  1E7P B;  2KC2 A;  3R2I A;  4XZ4 A;  2NBV B;  3OQC A;  4B95 A;  3AL0 C;  3HHI A;  3B9P A;  2IBI B;  3R66 C;  3BVG A;  4DHZ B;  5CTR C;  1F2B A;  1BVS A;  2CU3 A;  1UUP A;  4HRS A;  3Q8A A;  1EM7 A;  1YNT E;  4RGM A;  3PPA A;  2E03 A;  3DWM A;  1SB3 C;  1M94 A;  4HKZ E;  4MM3 B;  1JR3 D;  3HU1 A;  3KOX E;  3MHZ A;  1QOA A;  4G4R A;  2O2V A;  3T1Y M;  1PGX A;  3BBZ A;  3W1S C;  3SBJ A;  4LF5 M;  2KC1 A;  3AEG B;  4II2 B;  4ZOH C;  5CVN B;  4GHL A;  2FTD A;  4PAD A;  2LVP A;  2YLM A;  3L28 A;  3SYL A;  2AEH A;  1CSB B;  3T9L A;  3BC3 A;  3OF8 A;  1CMX B;  1I35 A;  4M0W B;  1SP4 B;  4JLC A;  1UEL A;  1FNN A;  3BOS A;  2WSF F;  4PK1 A;  3WAM A;  2MCN B;  1XEE A;  3DBR B;  3OJ3 A;  3U6O A;  2L4F A;  2JX5 A;  1V1P A;  1P7E A;  4Q2J A;  2N9L A;  3U61 B;  3RNG C;  4LZJ A;  1WXQ A;  3KXE C;  1FNU A;  3R8F A;  2WXL A;  2V0G A;  1F4I A;  2N4F A;  3NUH B;  2IBI A;  1PYW D;  3N4C A;  2DHR A;  1TY0 A;  2KLG A;  2LWP A;  2Z59 B;  2RGH A;  1IN6 A;  2JSV X;  3JSV B;  4AOF A;  4FWH A;  3CIR B;  1OIP A;  5ITQ A;  2MEK A;  1IM2 A;  4DBG A;  2KAJ A;  2D7E A;  2K0P A;  3KOW E;  1HT1 E;  1FXT B;  3DBR I;  2BWE A;  3N20 C;  2Z3X A;  4LLG M;  2OOB B;  2WXN A;  4ZRK A;  3M6A A;  3HHX A;  2CHX A;  2VII A;  5G5G A;  3K9P A;  1C79 A;  1I7H A;  4NAW B;  4WWM A;  1VCB A;  4BOU A;  5JI2 E;  2ZNV B;  1J5E M; 
#chains in the Genus database with same CATH homology
 2AQ1 B;  4XZX A;  3SAV A;  2BJV A;  3R9X B;  2IPK D;  2LJI A;  1PFD A;  5HHD G;  3NVV A;  2WXO A;  3AV0 A;  3VRB B;  1AN8 A;  1Z5C A;  2FUG 1;  1E94 E;  1K51 A;  2QEN A;  1IN8 A;  3RNV A;  3PVS A;  4BLC A;  3U4E G;  1R6B X;  4DV4 M;  3AE1 B;  3GB1 A;  3KVW A;  5ITX A;  4X66 M;  1N5X A;  4I4L A;  4RKX A;  1C77 A;  1YE9 A;  2XFT A;  3J81 S;  3UMM A;  3B2F A;  2LGI A;  1SXJ C;  1ZDV A;  3NRZ A;  5KPT A;  1QAM A;  2K3U A;  1PUT A;  3U6P A;  3CF0 A;  2DYM A;  3SR6 A;  1TS2 A;  3AEB B;  2VZK D;  1GKI A;  1J09 A;  4GHA A;  4XWT A;  1TS4 A;  1EU3 A;  2WU2 B;  1XMQ M;  2DWM A;  1PDX A;  4IBF A;  2YNM D;  3LQQ A;  3RFZ B;  4NOO B;  1N33 M;  2WXG A;  1YUB A;  2N7J A;  3IG5 A;  3AOG A;  1E9R A;  1TDH A;  2D7G A;  1GL7 A;  5H92 C;  1FCL A;  1L2B A;  1QAQ A;  3SMP A;  1JRO A;  2BTW A;  3SAS A;  4QOS A;  3BVZ A;  4HL4 A;  4YWG G;  1J7K A;  2DWN A;  3AE9 B;  4ARI A;  1XNQ M;  4JI0 M;  2BNK A;  3M0E A;  1SJE D;  3GLI A;  1G59 A;  4AZF A;  2WP9 B;  2ERC A;  2J53 A;  2L83 A;  4C80 A;  1OQR A;  1IXZ A;  1JRP A;  4M9Z A;  4BOP A;  4MH8 A;  2HWK A;  4L78 A;  1FRD A;  3J7B A;  4NZL B;  5LNK 1;  4ITQ A;  5KQD A;  3LB8 C;  3UK6 A;  2WXI A;  4USA A;  5BYQ A;  4JYA M;  3NVZ A;  3FTF A;  1SF0 A;  2M5Z A;  1SIJ A;  2XN9 C;  4MT5 A;  2JXT A;  4A5U A;  2IGD A;  2GI9 A;  4PCZ A;  2SEB D;  5T8I A;  1YZB A;  3A46 A;  5AUI A;  4LZZ A;  3ZCB B;  4PD2 A;  1B1Z A;  4MH0 E;  4B0E A;  5E6J A;  1TS3 A;  2QEJ C;  5MPO A;  3SMS A;  5IWA M;  3GP7 A;  2R65 A;  1KFY B;  3NS1 A;  1JWM D;  3FUU A;  2CHV A;  2JWU A;  2UXC M;  1E10 A;  3FIL A;  3T3N A;  1HR0 M;  2J42 A;  3WHL A;  4NJC A;  4J3O D;  3RPF C;  4GC9 A;  3U61 A;  4WIP A;  1DOX A;  2K5P A;  4NRW A;  2G1E A;  4ARC A;  1ACC A;  5KPZ A;  2UXD M;  2LNH C;  3IXS A;  2CV1 A;  1HNW M;  1H6U A;  3P4R B;  2NTS A;  4LTU A;  2ON8 A;  1IBM M;  2KQ4 X;  1D6E C;  3L26 A;  4I8O A;  3HHY A;  2O5R A;  1JWU D;  2V1C A;  1GAQ B;  5BMG A;  3AH7 A;  1NY6 A;  3AE2 B;  4JI7 M;  4ZRP A;  2BYT A;  1C9F A;  1MPE A;  2WNM A;  1XF5 L;  1KH0 A;  1R7R A;  3BYY B;  1XXG A;  1FFU A;  5BPV A;  1YN5 A;  2M56 B;  2BBC A;  2EA0 A;  5A2Q S;  3KW6 A;  5DYI A;  1GL6 A;  3EIH A;  1HXY D;  3HVD A;  2QIE B;  1VZ7 A;  1T6B X;  2VZK B;  3MK6 A;  3ZC7 B;  3ZH9 B;  3P4S B;  1XLQ A;  3K92 A;  4JPS A;  1CZP A;  1HEZ E;  4MGK E;  1TYG B;  3C58 A;  4L8R C;  1FNW A;  2BTE A;  5KQ8 A;  4XDD A;  2WXF A;  2H88 B;  3IT4 B;  5EP1 A;  5EP3 A;  5AUK A;  4GMQ A;  3FUT A;  4TQ1 A;  2BB5 A;  3NZ3 A;  4DUY M;  4OW0 A;  3AB5 A;  3AOE A;  1L6V A;  4DV1 M;  2Z4S A;  1I4G A;  5FK9 C;  2BJW A;  4A55 A;  1AYF A;  2KAC A;  1SE2 A;  3P4P B;  3MC0 B;  4KX6 B;  1ZAE A;  3W9C B;  3P42 A;  3CF6 E;  4RH6 A;  1SEB D;  3GP1 A;  3PNY A;  4B7H A;  1DGH A;  5FKA C;  2KEB A;  1TY2 A;  2J7Q C;  1Q39 A;  4DV5 M;  4AW4 A;  3B9J A;  2JTC A;  3AEA B;  2CFO A;  4L16 A;  3KP0 E;  2K47 A;  4DUZ M;  4KKI A;  3FTD A;  2FFJ A;  1RM6 C;  4LFC M;  1GPX A;  1N75 A;  1VRA B;  3KWL A;  1QOG A;  1HT2 E;  2W82 A;  4KOD A;  4YTN B;  4YSX B;  3P1M A;  1FD6 A;  2VQE M;  2AQ3 B;  3GPY A;  1DGB A;  2BS3 B;  3W5V B;  2XNA C;  2ONQ A;  1QQW A;  2J7O A;  1QAN A;  2C5R A;  5HG2 A;  1DKI A;  3QAU A;  4AG6 A;  4B0M A;  4DV3 M;  1K53 A;  4A9A A;  4HLQ A;  1RYJ A;  4RF1 A;  3D8L A;  1FRR A;  4M9S A;  1VZ8 A;  1VDD A;  3SAT A;  4PDI A;  3RGP A;  4IUM A;  3SFD B;  1NSF A;  2ICI A;  2IJ0 A;  1GVN A;  2CJO A;  1F2R C;  3J27 B;  1Y56 A;  3SAW A;  1OQQ A;  4KKJ A;  5ITT A;  1MHH E;  5EZQ A;  4UDU C;  4YT0 B;  3FUX A;  2J7Q A;  2PVG C;  3AE4 B;  3PT2 A;  4IP3 A;  2D7H A;  3MFG A;  4AKG A;  1EE8 A;  2BT6 A;  3UGJ A;  4KLN A;  3NVW A;  3TWM A;  4FCT A;  2JU6 X;  2M19 A;  1DO2 A;  3ZJV A;  3PO0 A;  1Q3B A;  3GPU A;  1PVJ A;  5BR8 M;  2PTL A;  3BK1 A;  3WHK A;  1Z5A A;  1PM5 A;  2LUM A;  1YMH E;  4FWG A;  2AQ2 B;  3O65 A;  2GB1 A;  2KN4 A;  1Z5B A;  3SC3 A;  4HJG E;  4DV0 M;  2ZBK B;  1I4X A;  4KGS A;  2F5N A;  2DXI A;  1XLO A;  3NVY A;  3SAU A;  1FNV A;  1GOZ A;  5BYS A;  2KA6 B;  3VQI A;  3HRD D;  5TSS A;  2QCU A;  3SFZ A;  1Z59 A;  1IBX A;  4NSR A;  5JZE A;  1OFI A;  3K1J A;  3HKP A;  3HVZ A;  4NRV A;  1XXH A;  1FM0 D;  5EP4 A;  4LF4 M;  1SXJ D;  4S12 A;  2BB6 A;  1LV7 A;  3UJN A;  4JI2 M;  4MB7 A;  4M0W A;  1VDV A;  1NYR A;  4MI7 A;  2NMQ A;  1N32 M;  4AI6 A;  4D8I A;  3PRP A;  5EE1 A;  4DQO C;  3O13 A;  1IGD A;  3U60 A;  3NBI A;  3GLF B;  3VDP A;  1QKZ A;  4DXF A;  3U7Z A;  3TMP A;  1KRH A;  3HGI A;  2Y0Q A;  5IT9 S;  2Y21 A;  1PJJ A;  4LJ6 A;  3PZ8 A;  1D5Z C;  1ESF A;  4P6V F;  3U6D A;  4KO8 A;  4DR4 M;  1UKF A;  1N5W A;  2PW9 A;  4BB9 A;  3I4V A;  1NEK B;  3VK8 A;  4G4N A;  2ZAM A;  4I81 A;  1ZQ9 A;  1NHW C;  1JWB D;  1ZOY B;  3FC4 A;  4MGZ E;  3NWL A;  3FD9 A;  2L7H A;  2I2Y A;  3W1S A;  5EE0 A;  1QVR A;  2UUB M;  2C9O A;  2CUZ A;  2XFS A;  5I4D A;  4N58 A;  3Q8X A;  2NTT A;  1L4D B;  3HJ8 A;  1ROE A;  4LF6 M;  2WS3 B;  1V1P B;  2PKO A;  2Z4R A;  5EE9 A;  3LVV A;  4Z6Y A;  3U60 B;  3C8Y A;  1E0Z A;  2WXJ A;  2M0A A;  3AV8 A;  2WXK A;  3FUV A;  1JR3 A;  3KLS X;  4B3T M;  3TQS A;  2OQ4 A;  2CJN A;  1J7A A;  4NXN M;  1TDZ A;  2L7I A;  4M9X A;  3R8B A;  4US8 A;  1JQJ C;  5GKN A;  4L2Y A;  4ZYS A;  3C0R A;  2RMM A;  4FCV A;  3FUW A;  2N0S B;  1EU4 A;  2OHF A;  1T3T A;  4B3S M;  3GLG A;  4G4O A;  3TE6 A;  2EKI A;  3ZYY X;  2A5Y B;  2WDQ B;  4LJ7 A;  1F2R I;  2BS2 B;  3BK2 A;  2XGN A;  1D2N A;  1ORY B;  1LO5 D;  2J4X A;  2V4I B;  4MAC A;  2LEK A;  1ZXI A;  4XE0 A;  3HJQ A;  2DYO A;  3AMZ A;  1K82 A;  4A6Q A;  5F3W A;  2CV0 A;  3GLG B;  1SJH D;  2AHM A;  5D3D A;  3ZNH A;  4OVZ A;  3TEZ A;  3MHV C;  5FLX S;  4JXJ A;  1FO4 A;  4GIP A;  3A45 A;  1UWM A;  2EEL A;  4LGY A;  3BBA A;  3PNV A;  2PIA A;  3W31 A;  3Q8E A;  1ENF A;  5KPR A;  3T38 A;  2WDV B;  1FJG M;  4DR7 M;  2XH9 A;  4GH9 A;  1FMA D;  1OJL A;  4DR1 M;  2ZAN A;  1E32 A;  1T5X D;  1KLU D;  3FYD A;  2IGH A;  4JE3 B;  4AKI A;  4XBO A;  2F5S A;  4JI6 M;  1QYR A;  4QNR A;  4N59 A;  1IBL M;  1VR9 A;  4NXM M;  1SXT A;  1IXR C;  2EO2 A;  2ZW1 A;  4D8B A;  5EQT A;  3U2S C;  4ZRQ A;  2X4A A;  7CAT A;  4MGI E;  2HDE A;  4IBD A;  1RFK A;  2RKO A;  4GC5 A;  4NL4 H;  1E9M A;  2KRK A;  1I4R A;  2BTW B;  5HI1 A;  4L1B A;  3FYC A;  1P7F A;  2CE7 A;  5GXG B;  4LJ8 A;  1L4Z B;  3VR9 B;  3J80 S;  4LG2 A;  3J7A S;  2W55 A;  2WDR B;  4JWS C;  2XF3 A;  3A42 A;  2Y20 A;  2MJE A;  1ET9 A;  3TRK A;  3B21 A;  2M60 A;  3JAM S;  3VK7 A;  2N9K A;  1K3W A;  4KHP M;  2HHH M;  1L1Z A;  2J52 A;  4GIT A;  2Z7J A;  2INN E;  1TKG A;  5JXV A;  4OZC A;  1QF6 A;  4GKK M;  4L15 A;  1SXJ A;  2K22 A;  5FTN A;  5LMN M;  1TH4 A;  2FNA A;  3GS2 A;  2XSZ D;  3J9C A;  5EXS A;  2YQZ A;  2L1A A;  3VR8 B;  3KOZ E;  2QJL A;  3GQ3 A;  2YFQ A;  2R61 A;  3N9Y C;  4H2A A;  5FTJ A;  1J7B A;  2LWX A;  1TKE A;  3FTE A;  1T3Q A;  4W5W A;  4JI3 M;  4LK0 M;  2XEP A;  3PHW A;  3AEE B;  2X8A A;  1JML A;  1NNU C;  2KWD A;  3E56 A;  4RNA A;  2FE8 A;  3FIL B;  3VDU A;  3K2L A;  3LVW A;  2Q2E B;  1MU5 A;  4L4U A;  2ACZ B;  5H37 D;  1WRI A;  4CHT B;  1I94 M;  3KP1 E;  1OFF A;  1DGG A;  1M4V A;  1SSN A;  2WXR A;  4QHT A;  3EUB 2;  4M0D A;  1JWA D;  3VKG A;  1K52 A;  3HU2 A;  5IZ7 D;  1V1O A;  2XLJ A;  2G9H D;  1KSF X;  3PHX A;  2IDY A;  2DWQ A;  2XSZ A;  3RE8 A;  2ZW0 A;  4RFB A;  4BOQ A;  1CQV A;  2WU5 B;  2P5T A;  4YY3 M;  2W3R A;  1J7C A;  1QAO A;  3T3O A;  4WH4 A;  4CIS A;  4IBE A;  3BYT B;  1GLN A;  5EXP A;  3PRM A;  2IGG A;  3AJI B;  2Z8L A;  3BII D;  2YR0 A;  1W5S A;  3P4Q B;  4FD2 A;  1DOI A;  4G4Q A;  3TWL A;  1D5X C;  4FXC A;  1L5P A;  3TWK A;  3KS8 A;  1HNZ M;  3EA6 A;  1IY2 A;  4GLS C;  3PZ7 A;  1G8P A;  4B3R M;  4CQN A;  3MJ5 A;  5EE3 A;  3ZJT A;  3AED B;  2YEP B;  4LJ9 A;  2DZN B;  2E6X A;  5C2T B;  4ZHP A;  2LFI A;  4R7G A;  1BUI C;  2Y0T A;  1YJI A;  1XHB A;  4RGN A;  1I4H A;  3U6S A;  2HCB A;  4BBA A;  4YTP B;  1QOB A;  1VLB A;  2Z84 A;  5C3J B;  2K9X A;  1F0Z A;  3SFE B;  2JA2 A;  1EWC A;  5HFY A;  4GDL B;  2C98 A;  2JYT A;  2DWZ B;  1SE4 A;  4L23 A;  4IBB A;  2QZ4 A;  3SAR A;  3U5Z B;  2G8L A;  3GLH B;  2D5G A;  1JAL A;  2KRU A;  4YSZ B;  4US9 A;  5EXX A;  1YN4 A;  2V3N A;  3KSJ A;  3D8B A;  1SBB B;  4WAF A;  1QLB B;  1I4W A;  1C4A A;  3GO8 A;  3IAS 1;  2XZU A;  1C76 A;  1SXJ B;  2LHE A;  5E26 A;  5ITR A;  4PDG A;  1K3X A;  1W5T A;  2V1U A;  1CK1 A;  2DWL A;  4JWU C;  1FCC C;  1N34 M;  3ZJU A;  4C7Y A;  2LHD A;  4LFB M;  3Q8F A;  5BMH A;  2WXP A;  3HHZ A;  1WWT A;  4LJ5 A;  3AFH A;  1FFV A;  3A98 B;  2QMT A;  1QIL A;  3SEB A;  3W0F A;  2RDH A;  4B7F A;  1FEH A;  1V97 A;  5C18 A;  5EP2 A;  5FR3 A;  4X64 M;  1JCK B;  1TGU A;  1OFH A;  4GKJ M;  1G4A E;  1IN5 A;  2F5Q A;  4CGY B;  3SYK A;  2MJD A;  3L27 A;  1AWD A;  1NJG A;  1XMO M;  4JV5 M;  1YQ3 B;  2C9C A;  2ZM6 M;  3UZU A;  3I51 A;  1HQR D;  1KLG D;  4FWD A;  5IRE B;  4QHS A;  5FTK A;  1XWI A;  2F4V M;  1N60 A;  3KWV A;  1C4C A;  4LRT A;  4TQ0 A;  4N6E B;  4GRI A;  2UU9 M;  1IQP A;  2HTM E;  1RWS A;  3GRR A;  1XCT L;  3AE7 B;  1XO3 A;  1NEN B;  2EUC A;  1KTK A;  4HKQ A;  3GQ4 A;  3FTC A;  2B76 B;  4PT5 A;  4QOZ C;  1HA5 A;  2R62 A;  1JWS D;  2SAK A;  3TPZ A;  3AE8 B;  4JX1 C;  5DYG A;  2UUC M;  5JI3 E;  1N61 A;  2H89 B;  2MH7 A;  2QSD A;  4REZ A;  3GPP A;  4P16 A;  3U6M A;  1TS5 A;  3H4M A;  3DWG C;  3TSS A;  1B9R A;  3OWE B;  2BU3 A;  4LFA M;  1CJE A;  3WCQ A;  1PJI A;  4A8X C;  1XXH B;  1ZDX A;  1E6E B;  4WW0 A;  1UM8 A;  1R2Z A;  4D81 A;  3JR5 A;  2DZO B;  3PFI A;  2R45 A;  1QT9 A;  4LJ4 A;  4AQ7 A;  1HQY E;  3V3X A;  2Y5C A;  2OPF A;  4JI5 M;  3UI3 A;  3TEY A;  1DYQ A;  5BMI A;  1EWY C;  3GLF A;  1XNR M;  2E5L M;  2JRI A;  1Z6T A;  3OTO M;  3GRU A;  1L2C A;  2X49 A;  3IFU A;  1V8C A;  1S3S A;  3QWL A;  3HJS A;  2UXB M;  4EE2 A;  3TEW A;  3W2D A;  3KSX A;  4FCW A;  3U6Q A;  1C4P A;  3AE6 B;  4AQY M;  3GPX A;  3SHG B;  4JI4 M;  4AG5 A;  4GUA A;  4D80 A;  1QQR A;  1NJF A;  4LGM A;  2V3P A;  4LRS A;  2WQY B;  2LH0 A;  2HL7 A;  1YJJ A;  4AS1 A;  1GB1 A;  4IJE A;  1N36 M;  4D82 A;  2UUA M;  2FOI C;  3THG A;  1A70 A;  4AKH A;  3LMM A;  2L52 A;  1KF6 B;  2CV2 A;  4FW9 A;  4JI1 M;  5C1B A;  3H8H A;  2AGA A;  1STE A;  3L2A A;  3BY4 A;  4QNM A;  4MGY E;  2V6Z M;  3K8Z A;  3TL4 X;  3V05 A;  5ITU A;  3CTW B;  1XLN A;  1WSP A;  2JQR B;  5ITY A;  5FTL A;  4K0K M;  2JZP A;  3W30 A;  3T1H M;  3DA1 A;  3U5Z A;  5D3I B;  1DOY A;  1TH2 A;  1NVI D;  4O1N A;  3BB7 A;  1HNX M;  4C56 C;  1IN4 A;  2QBY B;  2DLB A;  3PXG A;  3VKH A;  1IXS B;  3B2G A;  3ZQ4 A;  2LXE A;  4IJF A;  3AE5 B;  2H1R A;  3W5U B;  1MI0 A;  3Q8B A;  4DV2 M;  2GRI A;  2Y3A A;  1DGH B;  1MX0 A;  2HKJ A;  2DOS A;  3SHF A;  2RGO A;  1ZE3 D;  4OU7 A;  2J7N A;  3I4Y A;  3MTV A;  3RGS A;  3EIE A;  1IN7 A;  5FTM A;  1C78 A;  1L1T A;  5EJC A;  2ZAO A;  4D2K A;  2QIL A;  4DR5 M;  2R18 A;  3L25 A;  3VRA B;  1L2D A;  1Q3C A;  2G5G X;  4IBC A;  1YQ4 B;  4DV6 M;  4HEA 1;  3Q8C A;  1NNJ A;  4XWW A;  4ZPX A;  3TEX A;  1TJE A;  4KGT A;  1N78 A;  2JYE A;  1FIQ A;  3DZD A;  1TKY A;  5ITX E;  1HZ6 A;  4LY6 A;  4LF7 M;  1IUE A;  3AKZ A;  1L0Y B;  2R4E A;  8CAT A;  1WYG A;  5D7G A;  1K50 A;  4DR3 M;  2KZU A;  3LYY A;  1ZXH A;  3FKE A;  3HHW A;  3EGR A;  3LXF A;  3AM9 A;  4KGR A;  3E4R A;  3J2P B;  2W3S A;  1GB4 A;  1IBK M;  4B3M M;  1KYI A;  3AEF B;  4HXD B;  2E3T A;  3AE3 B;  3ZGZ A;  2QPA A;  2I7N A;  1TZO A;  2WLB A;  5G5H A;  1YN3 A;  2PMV A;  4RCO A;  4TSS A;  1N62 A;  4LF8 M;  1DO0 A;  5EXT A;  3IAM 1;  4II7 A;  2PLP A;  1UNS A;  4LF9 M;  2C96 A;  1BML C;  2DVW B;  2VQF M;  3PSE A;  2L32 A;  1F77 A;  1D4B A;  3CWI A;  1QZM A;  4EIW A;  4B08 A;  3W0L B;  4IBJ A;  1NHG C;  2INP E;  2LMC A;  1I4Q A;  1C1K A;  1R2Y A;  4I5S A;  2KMM A;  2QP9 X;  3U6C A;  1D5M C;  1PGB A;  3GLH A;  2PVO D;  4DV7 M;  2L09 A;  4C7Z A;  1VJK A;  1IY1 A;  1FXA A;  4JI8 M;  4WQM A;  4TUW A;  1R7S A;  2Q5W D;  5EZS A;  2R4J A;  4B7G A;  3BWU D;  4HRO A;  1YSY A;  5FSW A;  4Z8X A;  3MP2 A;  4ZTB A;  4A90 A;  4BOZ A;  1IBX B;  4A3V B;  1DGJ A;  3MP9 A;  2KDM A;  5H8Y E;  2OED A;  1NYQ A;  1L0V B;  3ILK A;  4YHH M;  3Q69 A;  1KFV A;  4LCB A;  1FXI A;  1X37 A;  2I7P A;  3U6E A;  2UZJ A;  4IBG A;  2BS4 B;  1N63 A;  3DOA A;  1I4P A;  3T15 A;  4D8E A;  3URY A;  3KQ4 A;  1WGK A;  2F5O A;  1L8Q A;  3KFU G;  4YSY B;  1L0X B;  1E9S A;  2RDG A;  3ETR A;  4IDI A;  1PGA A;  3GRY A;  3AOE C;  3RFW A;  4IIW A;  1NY5 A;  4FVM A;  2WXM A;  3AN1 A;  4X65 M;  4GDK B;  2Y5P A;  2C99 A;  2FBW B;  2WXH A;  3GLI B;  1NVM A;  1JQ4 A;  4YTM B;  2L6O A;  3E9S A;  2CEA A;  3L29 A;  1L6U A;  3PHU A;  5LMU M;  1AW7 A;  3U52 E;  4RF0 A;  3VFD A;  1BXT A;  4BOS A;  1N77 A;  1SE3 A;  3KS4 A;  1ET6 A;  3HU3 A;  5BYR A;  1SXJ E;  3I9V 1;  3GRV A;  5DNY A;  1ZPS A;  2TSS A;  3LQR A;  1HZ5 A;  3TUO A;  1UGJ A;  2YEP F;  2NQ8 C;  3HWS A;  1IY0 A;  4OVZ B;  4X62 M;  3L4P A;  2CHQ A;  4ZHO A;  1G3I A;  3P63 A;  3IT6 B;  3JR4 A;  4NAM A;  1IGC A;  2MJ3 A;  4DR2 M;  4MGH A;  3KDS E;  3IG8 A;  1Q10 A;  2W54 A;  1MHX A;  4OHJ A;  2XZF A;  4OZB A;  2X38 A;  3I57 A;  4RGT A;  1TH3 A;  3BZD B;  1XLP A;  4DXG A;  4LJA A;  1HQC A;  3R2T A;  1ZP0 B;  1MVK A;  3GQ5 A;  3FAH A;  2R46 A;  2KZS A;  4YXD B;  2AX5 A;  3ABV B;  2BW2 A;  3DFZ A;  2I38 A;  2RPV A;  4G6Z A;  3KOY E;  1QOF A;  3BVM A;  4WUR A;  1XC8 A;  2QBY A;  4OZA A;  3CF2 A;  1ZUD 2;  4TMA B;  4XDC A;  4NSO B;  1NI3 A;  4RGO S;  1G41 A;  4DR6 M;  2WXQ A;  4XGI A;  4IBI A;  3VLF B;  3HUI A;  4IBK A;  1UWX A;  4ITK A;  1DGF A;  5KO3 A;  2F5P A;  3AEC B;  3M7G A;  2CHG A;  2KXE A;  4OX9 M;  4R3D A;  4IOI E;  1XCQ L;  3U6L A;  1JW9 D;  4IKG A;  4JN6 A;  2KW0 A;  1VZ6 A;  2DBY A;  3R2I A;  1E7P B;  3OQC A;  3AL0 C;  3B9P A;  3BVG A;  2CU3 A;  1UUP A;  4HRS A;  3Q8A A;  1EM7 A;  1YNT E;  4RGM A;  3DWM A;  1SB3 C;  4HKZ E;  4MM3 B;  1JR3 D;  3HU1 A;  3KOX E;  3MHZ A;  1QOA A;  4G4R A;  3T1Y M;  1PGX A;  3SBJ A;  4LF5 M;  3AEG B;  4ZOH C;  4GHL A;  3L28 A;  3SYL A;  1FNN A;  3BOS A;  1XEE A;  3U6O A;  2JX5 A;  1V1P A;  1P7E A;  4Q2J A;  2N9L A;  3U61 B;  4LZJ A;  1WXQ A;  3KXE C;  1FNU A;  3R8F A;  2WXL A;  2V0G A;  3NUH B;  1PYW D;  2DHR A;  1TY0 A;  2RGH A;  1IN6 A;  2JSV X;  4FWH A;  3CIR B;  5ITQ A;  2MEK A;  1IM2 A;  2KAJ A;  2D7E A;  2K0P A;  3KOW E;  1HT1 E;  4LLG M;  2Z3X A;  2WXN A;  3M6A A;  3HHX A;  2VII A;  5G5G A;  1C79 A;  1I7H A;  4WWM A;  4NAW B;  4BOU A;  5JI2 E;  1J5E M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...