4RF0A

Crystal structure of the middle-east respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group p6522)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
318
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF1ab protein
publication title Crystal Structure of the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Papain-like Protease Bound to Ubiquitin Facilitates Targeted Disruption of Deubiquitinating Activity to Demonstrate Its Role in Innate Immune Suppression.
pubmed doi rcsb
source organism Human betacoronavirus 2c jordan-n3/2012
molecule tags Protein binding
total genus 78
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4rf0A02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rf0A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4rf0A03
4WURA 3MJ5A 4MM3B 3E9SA 2FE8A 3MP2A 5KO3A 4RF0A 4M0WA 4OVZA 4REZA 4R3DA 4P16A 4RNAA 4RF1A 4OW0A 4OVZB 5E6JA 4PT5A
chains in the Genus database with same CATH superfamily
5ITUA 4LF9M 5BR8M 3BWUD 5IOIA 3AE6B 2LHDA 2DAEA 2JYEA 4MGKE 2NTTA 1ZDVA 3FE3A 2DCAA 2BJWA 4ZRQA 1R4GA 2RPQA 4OHJA 1GCBA 2KX3A 1QDQA 3FYDA 1SEBD 1AECA 4W9HA 2HJ1A 3CH2X 2JPHA 3L2AA 2Z59B 3W5VB 3Q8AA 3HKPA 2NQ8C 2JY7A 1MU5A 4RFBA 4GDKB 4XX5A 2QHOA 2E00A 3HHXA 2OO9A 3P5UA 3W0LB 1GL6A 4HJKA 4AOFA 1RU3A 5CVNB 4N9F4 3M99A 4MT5A 1PXVA 1N78A 3Q8BA 2VHFA 2QCUA 2RRUA 4LRSA 4GDLB 1YE9A 1H8CA 1YN5A 3A46A 4YHHM 1TS3A 1YLAA 2PVGC 2VRRB 2BKFA 3I51A 3OF9A 4RF1A 3DA1A 4KO8A 1O0EA 3ZNHB 1PJTA 4XZ4A 2EMSA 4CYEA 2DZYA 2D10A 4JWUC 4ASWC 3WCQA 2FNAA 5EP4A 3TJPA 2WXMA 3RUIB 3TMPB 1VDVA 1PDXA 1PGAA 3QC8B 4GSWA 1SNKA 2WXIA 2KK8A 3WIMA 2IY0B 2KNBA 2NCNA 1N5XA 1UNSA 2WSEF 4GGQA 3ZJUA 4HVBA 3C3DA 1KFXL 3GZNB 2J0JA 1KFYB 4DHJB 1Q10A 4FCTA 4IWQA 2K9DA 4BOZB 2CUZA 4CQNA 1GLNA 4CIZA 1R6BX 2AEHA 2JWUA 2V4LA 4HDOA 2V3PA 1Q0WB 3DCGA 4GITA 2K22A 4KGRA 4RGOS 1OEYJ 4YXDB 5IAAC 2JZ1A 2W82A 1MEGA 2B3TA 1VJKA 3USVA 1QVRA 3A1QA 3NVYA 2LD9A 4MI7A 1G71A 1FRDA 1WX9A 2LEKA 4K81A 3J27B 3U30A 1TH4A 2R9MA 3WXFA 3FUUA 4N8WA 4DHZE 4WJOA 3RNAC 5ITTA 3DBSA 4GDKA 1WM2A 2CHXA 2J7OA 3KS8A 2LHGA 1ISNA 3PPAA 4JI2M 3KSXA 3IG8A 1U4AA 2N7DA 1J8CA 1GPXA 5KQ8A 3E46A 2KDIA 4UDUC 2KFKB 2KWVB 2MJ5B 3HHIA 1C1KA 1NSFA 2R9FA 4AWJA 3VTUA 1T0QC 4RM9A 1PIPA 4A9AA 4GDLA 2KRUA 5KQDA 3U7ZA 2JT4B 5CX3A 4PS8A 4M9XA 4FVMA 4QNMA 1N62A 3V61A 3BVZA 3CH3X 2JQFR 1N36M 2BYVE 2N4FA 5AZHA 3ZNHA 2LXCA 2KDLA 2FS1A 3FD9A 3MHSD 1WGNA 5IZ7D 3KOZE 4WQMA 1TS4A 3RULA 1BXTA 5E6PA 1ZKHA 2EJSA 4USAA 4BLCA 3W31A 3EA6A 2R45A 2ZVNA 2F5NA 4FLHA 3W1SA 3TMPA 3GLHE 2KWCA 3E56A 3PNVA 1XCQL 2JTCA 3R66C 1FPYA 5EE3A 2L76A 2Z0DB 4GKKM 2X8AA 2K8HA 2LVOC 1N6ZA 1TLOA 5JH3A 1SB3C 1V2YA 1ZMUA 3ZGZA 4FBJB 1HR0M 2C0YA 2KRKA 4KIKB 1FNWA 1TBEA 1QQRA 1Z6TA 4OVZB 2D3CA 4BOZA 4KLBA 2FFJA 5ITYA 4BSQA 3ILKA 1DKIA 4QRVA 5A24A 1FJGM 1WGYA 5AEKB 4AS1A 2HJ8A 1WR6E 4BKGA 1HQCA 1XMQM 1Y56A 3ZKJC 2ONQA 4NSRA 4K3CA 4PYUA 3P5VA 4LDTB 1K3BB 2K5PA 1PGYA 4HXDB 5EE9A 2VZKB 1IP9A 1CVZA 3AL0C 4WJNA 2R61A 4AP4C 3H8CA 3ZTDA 3NBIA 2VDBB 1K3XA 2Z0EB 8CATA 4JPSA 2OJWA 1G41A 4LNFA 4HPPA 2GBRA 1HNZM 2AWTA 2LWPA 3BK1A 3GO8A 4F7ZA 3CSTA 3ZC7B 3PV1A 4XUIA 2NBVB 1ATKA 4QHSA 1IXSA 2X49A 1N77A 1TL9A 4ICVA 2O6VB 3OAWA 4B95A 4P6GA 3ML9A 2UUCM 3TQSA 3NVWA 5GMVA 4NQKE 3V60A 2LZ6A 2BWES 4LNIA 1YVBA 3TRKA 3U6CA 3L25A 4P1BC 4FCVA 4LFBM 2AL3A 8PCHA 1HNXM 1VQ1A 2I2YA 2FCNA 1N75A 2WXFA 1RLFA 3QK0A 1AYFA 5DYIA 4LJOB 2HTME 2V3NA 4XDCA 3U60B 4WIPA 2Y5BB 3PHXB 3T3OA 4EFOA 1C1YB 5EXSA 3L16A 3RI7C 3HWSA 2L09A 3UJNA 2QSDA 1IPGA 4KIKA 2JZZA 2FAZA 5AZFA 3MTVA 2JY6B 2M4NA 3RFZB 3HHWA 4OVZA 3J9CA 1PJQA 2FOIC 2B3AA 2PBHA 4TUWA 3GQ5A 2WX0A 1HE8A 2JY5A 3M6AA 3FILA 1KXRA 1V86A 2WBFX 5LMNM 3DBLB 2KJRA 4IBBA 3KSEA 2JQGR 1QILA 4WQOB 3T1YM 2VH2A 2QBYB 2EKFA 4NXMM 4HXDA 3IT4B 1Z59A 4I5SA 1EWCA 3SARA 1WM3A 2I1JA 1S3SG 1SJED 2LTUA 1PM5A 3KUZA 2VHSA 3TPZA 2C96A 2KZSA 2DAJA 1MEMA 1TDHA 4JL9A 3M3JA 5ITXE 4GIPA 4WA6A 4LG2A 4W9IA 4OW0A 3FRIA 1MN3A 3ML8A 4KLNA 2KT7A 4BKSA 2CV2A 4WWNA 1HA5A 2KX0A 3BZDB 1IGDA 2VQFM 4DR3M 1TZ1A 1K3WA 2H89B 2O6VA 4I6PA 5G5GA 4X57B 1KHPA 1T6BX 3TNXA 2UUBM 3LVVA 3TEZA 3MHHA 3NRZA 2IZVB 3PREA 4QH6A 2O01F 3APDA 2V1UA 4NRWA 3KXEC 2MWSB 3H89A 2MSED 4GMVA 3E1ZB 2DZOB 2MBQA 3AI5A 4RMAA 5ITQA 1I4QA 2R6NA 3BWKA 2LVNC 4I4LA 3KWBX 2JVCA 4AW4A 3K9PB 2R44A 2D3BA 3UMMA 3U60A 1H4RA 2Y5BA 4DMYA 3PHXA 4MEMA 1XC8A 2DAFA 4YSXB 5IA7A 2QILA 2QNJA 2CV1A 3C58A 3N4CA 4EZKA 2DZMA 2H1RA 2JY6A 2DBYA 3LW5F 3T8MA 4CHTB 1TJEA 2LVAA 1TYGB 2REXA 1F2RC 4M8NA 4XWWA 4LNNA 3TBLD 3NZSA 3NZ3A 4JI7M 1CK1A 2R18A 4GC9A 4X6IA 5IWAM 3J7AS 4MDKE 2IYDB 1IN5A 4DR7M 1GLOA 5AUIA 3C0RA 2JXXA 2YJ2A 1YX5B 1F2CA 2QBYA 2BVCA 4OU7A 1WRIA 2ZAOA 5FTMA 1XLQA 4DDID 3VUXA 1MG8A 3BB7A 2BDLA 1TKEA 1GKIA 4PDIA 2IJ0A 2IO2B 1WXAA 1GJZA 2P86A 2FRQA 3W2DA 1OFIA 3IUTA 2MA9B 2CKHB 2G8JA 1ZW7A 1WH3A 3IHPA 3BPMA 2G5GX 2AQ2B 1WIAA 2WXRA 5FKAC 4WJPA 2NQIA 2J7QC 2LUEA 3B7NA 5IREB 1A70A 4XDDA 2KNAA 2Y5CA 1VEGA 3WAMA 1Q5WB 4KX6B 1I42A 4W9EA 4RKUF 2L1AA 1SSNA 2C98A 4YV8A 1TDZA 1ESFA 2Y20A 3C9EA 3O0UA 1ZXHA 2L0FA 5CVMA 3T38A 2DWMA 1VR9A 3OISA 2PTLA 1N60A 3SASA 1WX8A 2DLBA 1E7VA 3OF8A 5BYSA 4N4ZA 3K9PA 3RGPA 4NPNA 1GMYA 1MIRA 1SJHD 5F3WA 2KW0A 2DHZA 1BVSA 4JQWC 3QWZB 2RR9A 2Q2EB 4IOIE 2WXNA 3K9OB 1NEKB 1ZV1A 2BB5A 4MSXA 3B79A 3LB8C 4G3XB 5E26A 1CUKA 3L27A 3SHQA 3FAHA 2R2QA 4PI3A 2Z3XA 3T15A 5BO4B 4BBAA 4A90A 3L4PA 3NVZA 2KO3A 1OGWA 3D32A 3CMMB 3O1GA 1FD6A 3D8LA 1ET9A 4JWSC 2DCCA 1DO0A 2GOWA 4ZRJA 1I4HA 1UWMA 1ZE3D 3ONSA 3KOWE 5FTJA 1GECE 4X6HA 2KN4A 5D3IB 3HU3A 1XCTL 3I4VA 4K1RB 4DV1M 3PNYA 4KDIC 1C7YA 2GMIC 3AOGA 4OEMA 3W0FA 3WA0A 4XYCA 1WY8A 3Q6BA 1SXJD 4IM2A 1VZ6A 4JI0M 2QIEB 4GHLA 1J19A 2DYBA 1FXAA 5I4DA 4OVUA 1QKZA 2MRPA 1VCBA 4EUTA 3ZTCA 3RNBC 5J2RA 4MELA 1OEYA 2Q5WD 3IG3A 5IP4D 4ARCA 3VK8A 2ZPYA 2NBUA 2ACTA 1NVMA 1PRBA 4YTPB 2KA6B 3URYA 2OOBA 5KPZA 5EP1A 1P0RA 2MHJA 3TL5A 4G4QA 1OQYA 3HHAA 1V9JA 1TY2A 3AN1A 2W3SA 4KV2A 4L23A 5J18A 1E90A 2JUOA 4N58A 2KDMA 2G1EA 2LVPA 4FULA 4JI3M 5KPTA 4N79A 2DC7A 3BY4B 2PW9A 3LQQA 2WXGA 3HVDA 4IP3A 3RNFC 1HQRD 1WXVA 1E5WA 1UBIA 1UUPA 2FUG1 1HTOA 2GFOA 2VQEM 2K8BA 2ATOA 1IN4A 2XEWA 3B9JA 4QBBA 1WJUA 1NENB 2D2QA 4KKJA 3MFGA 3F92A 3U6PA 3VKGA 1L4DB 2YEPB 1SF0A 2FH0A 4E3CA 1L5PA 4O1NA 5DPRA 1C4CA 5IO9A 5G55A 1WE7A 1L1TA 2IGHA 2X38A 3PHUA 2XH9A 4WWMA 4LY6A 3AU4A 4ICUA 4YT0B 2Z4SA 1R4MI 2I38A 4F1SA 3T3NA 2UU9M 4II3B 4TV3A 3W30A 1G6JA 2ZVOA 3MP2A 1SGHA 3X0WA 1L4ZB 4JE3B 3KYCD 4IWOA 5L95C 4B7GA 3W68A 1JALA 2FCSA 1L2NA 3LVWA 3LDZE 1PCIA 1MJDA 4ZUXU 1B9RA 3RD2A 3IAS1 2LJIA 3DOAA 1M4VA 3AFHA 3V3XA 2L4FA 2WQYB 2C5RA 4GIVA 4LRTA 3Q2AC 3RYTA 1JQJC 1NPZA 1F2BA 1VEJA 1KHQA 2KHWB 1KTKA 2K6DB 1WGKA 3EIHA 4KGSA 1YK8A 2RGOA 3CBJA 3LFYA 3R2IA 3E9SA 4G54A 1EU3A 3GPXA 4IBGA 3A4SC 4X64M 1FM0D 4GN1A 1V80A 3NJTA 3PFIA 5FSWA 2IDYA 3TUOA 3I01M 1VG5A 4YYQA 3M7GA 5PADA 4BFRA 4JV5M 4PT5A 1NNJA 1NYRA 4WJQA 3RNVA 2MJ3A 3GQ4A 1FCLA 2D07B 2MBHA 4OZAA 3BY4A 4L16A 3HWNA 2FBWB 4NAWB 1PPOA 1RYJA 2LWXA 2DZLA 4CO7A 3Q8GA 4KODA 5EXPA 4M00A 2PVOD 2FE8A 2WDTB 3O13A 3NG0A 1YK7A 5EGWA 2CIOA 1F0ZA 3ZXRA 1NNUC 3HM3A 4WWPA 3FTFA 4RNAA 3B1LX 3CF2A 3AEGB 4Q2JA 3NOBA 5JHBA 4FJYA 5IT9S 3BBAA 4CDDB 2AUXA 1IN7A 1XWIA 2GBNA 3CBKA 2KXJA 3MC0B 2MBBB 3OTOM 1FXIA 5HKHA 2GNOA 3MJ5A 2KDEB 4XK8F 2EKKA 3VUWA 4BOSC 2JZ3B 1LM8B 2KDFB 3AEBB 3VH3B 2WDVB 3FYCA 3HRDD 3DVGY 1OQRA 4EOYA 3GRVA 4MB7A 4FK5A 1PBHA 4PCZA 2BWFA 4JXJA 1VD2A 2FO5A 1KFVA 2AYNA 3PZDA 3MJWA 2F7DA 3TEXA 2PPHA 3HHYA 3LXSA 1WGDA 3GP1A 1TS2A 2NQGA 1MHXA 3VTVA 2G6DA 4RGMA 4BBNF 5JH5C 2SAKA 1OIZA 2IO3B 3HIZA 1R2YA 3IFWB 3PZ8A 5JZEB 2EELA 2YJCA 4I04A 4DUZM 1WFYA 1VDLA 1CSBB 5FPWA 5GKNA 3GCBA 5JI3E 2J52A 1QAOA 1D0MA 1F1HA 1JRPA 1OKSA 4IBEA 2R4JA 5EJCA 5EQTA 3A4RA 3QCAA 3SHGB 3RVXA 4MZOA 5MPOA 3QSDA 3GRUA 2DZNB 1AARA 3NWLA 9PAPA 2D3AA 3J2PB 1U9QX 1HEZE 2LVOA 1AN8A 4I6NB 2M17A 4NAWA 1UD7A 3GQ3A 3SU8X 4NOOB 4X65M 4IDIA 3EHVA 1YOVB 5EZSA 4HKZE 3DBLI 2GQFA 3ZJVA 2F5PA 2XNAC 4XGAB 4A3PA 3OLMD 3V62A 3VFDA 3DBHB 1Z5SB 1ZUD2 3Q3MC 3P2BA 3U8ZA 3ZLZA 4TQ1A 2Y6EA 3KW9A 4W5BA 1PADA 2C9CA 3N20C 4M02A 3VAWA 4JGHB 2DENB 2WXQA 2DYMA 1WMHB 1K82A 3PRPB 4DV3M 3K92A 3RGSA 3GLHB 2HCBA 4HRSA 2BS4B 3B2GA 4GU2A 2LVQD 4W4UA 1NVID 1ET6A 3L54A 2DWZB 4NJ6A 3SEBA 3ZQ4A 1U5IA 1K52A 5LMUM 3KSJA 1WWTA 2K6BA 4IJFA 4HWYA 4IBKA 4QOZC 3SFEB 1XF5L 4M0WA 1C78A 2LRWA 2FCQA 1J7KA 3TWLA 1YJJA 1NL6A 2MGWA 1EWPA 1IN6A 4Z6YA 1UELA 4YVAA 4QHTA 5BMIA 3AEEB 4ANWA 3SHFA 4FHKA 4N6EB 5J94A 2BYTA 2R2OA 3BIID 1SE4A 4W9CA 3BYYB 2K9XA 5G2NA 5JZEA 3HU1A 1WGGA 1TKYA 3SDLC 2HHHM 1P9DU 5LLIA 1G4AE 3A33B 1SXJC 3QX1A 2XU1A 2FT2A 3GPPA 4ANVA 4RGNA 1OJLA 1YX6B 1K53A 1ROEA 1STFE 5T8IA 1XNQM 1JWAD 2RDBC 4R3DA 4W9GA 2K0BX 4BKTA 4YY3M 2AIMA 2W54A 1DV0A 3H4MA 3OVZA 3KFUG 2L05A 4US8A 1JB0F 4P6VF 2WDRB 3B0AA 4DR4M 3ZO5B 3VXWA 2YNMD 2ZAMA 2F5SA 2K3UA 4MZSA 4WURA 1QOFA 2O25A 2XEPA 2KVZA 2OJRA 4OZBA 1F52A 3KW5B 1AWDA 3EECA 2PMVA 3W9CB 1D0KA 4MGYE 2XSZD 3U6OA 4AXMA 3H8BA 3WHKA 3U4EG 4FA6A 2R0IA 2KAJA 4NC6A 2DENA 1AYVA 3UK6A 3I4YA 4AG6A 1WMHA 3PGEA 5JA7A 3GLHA 4W9FA 1E32A 3APCA 3SMSA 1QUTA 1AYWA 5EXTA 3WALA 3FUTA 2CB5A 2UYZB 1IN8A 3DWGC 1RFKA 3AV0A 2PJHA 1HJPA 3HGIA 3H6NA 1V34A 1GC6A 3SYLA 2UXCM 1QOGA 5EDSA 4JYAM 2BB6A 3JSVB 4BZAA 3D6SA 3JVZX 2HKJA 3DOWA 1E7UA 5L83A 4B7FA 4M8MA 4GH9A 5DYGA 3OQCA 2J7QB 2CV0A 1T43A 4LJ8A 4DR2M 2AX5A 3KWVA 1UWXA 5D6JB 3B7ZA 2DZJA 1UGMA 4AI6A 1KFUL 2BTEA 1YUBA 2JY8A 4BOUA 2KYWA 2BKRB 1ENFA 4NAMA 3KFQA 1EF1A 1CS8A 2C60A 1AIPC 1YQBA 2BYFA 2E5LM 2O6VD 1OFFA 3R3MA 3TWMA 3VDZA 3WXEA 2HXZA 1TGZB 5BMGA 3VK7A 4LF7M 4F1IA 1VSNA 3FC4A 4M0DA 1PFDA 2MCNB 1N33M 1JROA 1Y8GA 1SE2A 1AIMA 1DGJA 3TEYA 1JCKB 4DR5M 1MFWA 1IBMM 3VRAB 1E7PB 3L13A 2P5TA 3AU5A 2XZFA 2DAIA 2AQ3B 2KFKA 2Y5PA 2LUMA 1G8PA 1YZBA 2KANA 2VF8A 4A3OA 3ZUNA 4YYRA 4CDFB 3BOWA 3IV2A 2HH5A 5BMHA 1AUAA 2WSCF 4MM3B 3VR9B 3AI8A 1XT9B 3LXFA 4JX1C 2CHWA 5D94A 1MG4A 2CS4A 2XN9C 1SBBB 4GRIA 4II7A 4K7WA 4K7CA 4BVUC 4LCBA 3EUB2 4M9SA 2QC8A 1PPPA 3E4RA 2F4VM 2LBCA 4RM8A 3KS4A 2P0RA 2MBEA 1TT5B 2QENA 3THGA 3M63B 2CHQA 1GC7A 3R8FA 2CR5A 3DVNV 1YQ3B 2C7NB 1R2ZA 2QPAA 1YD8U 2ZANA 4DV2M 4DQOC 3AMZA 1FNNA 1VLBA 2V4IB 2Y21A 4G4OA 1DGFA 4LGMA 2KMAA 2ZW1A 2J7QA 2AQ1B 2DYOA 3IVFA 4IW0A 3AECB 2L3ZA 2DC6A 3P4PB 5CHVC 3CGWA 3HY5A 3Q8FA 1BMLC 2YJ9A 2RMMA 2N1VA 2M5ZA 5BYQA 3R7RA 1EF7A 2LNHC 1E8WA 4A20A 2M60A 1F9JA 4QAYA 1VRAB 5ITXA 2C7HA 2BF8B 1T6OA 2KQSA 4AJWA 3PDFA 1I35A 1TH2A 2D7EA 3KW6A 4W5WA 2EKEC 3S3QA 1Z2MA 1G59A 4YWGG 2LH0A 3D8BA 3IT6B 1R4NB 2E03A 2OULA 2MP2B 4LJ9A 4LJ7A 4DBGB 3IFUA 5FTLA 4ARIA 3UQBA 1UKFA 4A3VB 1GL7A 2NBWB 4R7GA 1RAXA 1C9FA 2PREA 4TKNA 3OJ3A 1YN4A 1NB5A 4G11A 3V6EB 4MM3A 1LO5D 3V6CB 2L6OA 1IWDA 5E6OA 4B3SM 1Z5BA 1NV8A 1QOBA 4GC5A 1QF6A 1JR3D 2J7NA 3UZUA 3QA8A 4HCNB 1OTRB 3DBRB 4LK0M 2WNMA 2K6QA 1IFYA 2EMTA 3BOSA 4L78A 2WLBA 2JP7A 3AE3B 1AU0A 2DWQA 5EE1A 5KHQA 1ZOYB 3RFWA 2QCZA 1PQSA 1NI3A 3L17A 5ITRA 2UZJA 2YFQA 3RNEC 2BU3A 3ZQJA 2CU1A 1QZEA 3RNGC 2BTWB 2XZUA 5FTKA 3U5ZB 2KACA 4Q8HA 1WJ4A 2KJ6A 2B1NA 4E71A 2D5GA 4BQVA 4MGIE 1UFZA 4A5UA 1I4RA 2AVWA 1I4GA 3PRZA 4NQLB 2MROB 2NVUI 4YTMB 5KPRA 3GPUA 2A4ZA 1GJSA 1KLVA 1T3TA 2AHMA 3U6EA 4YSYB 1IQPA 3FUWA 1R7RA 3PVSA 4W9KA 1Q6KA 1NY6A 4S0RA 1QYRA 2ZW0A 3IXSA 2G4DB 1KF6B 2WXLA 1IM2A 3I9V1 4C4VB 2MLBA 3RE8A 1JWMD 1J09A 3I04M 2UUAM 1OAOC 3QJZA 2MP2A 4ZOHC 4DBGA 4I8OA 1RFAA 2WDQB 2JQRB 1KSFX 4K7SA 4LJPB 3CSFA 3AB5A 4KGTA 2L0TA 1B1ZA 4W9DA 2OQ4A 2JRHA 1EO6A 3M62B 3T1HM 3DDCB 4PS7A 3M0EA 2IPPB 4LNKA 1V5OA 2TSSA 4XZXA 3ERVA 2GBKA 2RSUA 3V6EA 1NHGC 4H2AA 4ITKA 3V6CA 2X8XX 3SC3A 1GAQB 3SATA 2XLJA 3MORA 2C99A 2DCDA 2DI0A 2CHZA 2L32A 4ANUA 3N30A 2KHHA 4LNOA 2ZCBA 1PVJA 2VIIA 1OTRA 3BINA 4KSLC 2H7JA 1NYQA 1FFUA 2L83A 1U9XA 2RDGA 2QMTA 1ZMWA 2WWZA 1YT7A 2KZUA 3L08A 4NJ7A 1FNUA 4MACA 4GEWA 1TGUA 4UN2B 3WAOA 3F5VA 1WX7A 3JYUA 3BPFA 2BTWA 3U5ZA 4KT0F 2J42A 4NRVA 4MGZE 4G3OA 3PW3A 3PNRA 3LMMA 3GLGB 3R7QA 1K51A 4L4UA 1KH0A 4WAFA 2WS3B 3LJ3A 2PIAA 5D7GA 4DV0M 2JWZA 4CJ6A 1PPNA 1MI0A 4P16A 3DBHI 1GB1A 2W55A 3C9PA 2DX5B 2KLCA 1C3TA 1QDRA 2D11A 2C5LC 1ZQ9A 1THEA 1I7HA 2JX5A 2N7JA 2DJFB 1Q39A 3H7PB 3P5XA 1N61A 4C4VA 1AU3A 2L7HA 1MHHE 3OJ4B 4Q7JA 5FLXS 4YYVA 1IY1A 1P98A 2G45B 4C56C 3PT2B 1LFDA 4ZYSA 3MK6A 3Q3FA 2N7EA 1UBQA 1PGXA 1V97A 3AE5B 1JR3E 2KLGA 1I4PA 2ZZPB 2CJNA 1PGBA 3J7BA 3B08A 2M0XA 2XF3A 2G9HD 2GBJA 2V0GA 2CP8A 1NDDA 5F02A 1ZP0B 3AE7B 4G0NB 2LXAA 3HUIA 3JW0X 1N5WA 3DHGC 4HDQA 3KX1A 1QZMA 3GZNI 2BS2B 5H8YE 3KDSE 3FUXA 1TS5A 1A5RA 3Q69A 4IC7B 3MC9A 3ZDTA 1JQPA 4AQYM 2CEAA 3CWIA 1I94M 2W3RA 2ZNVC 5EE0A 1XLOA 4AKGA 2RDHA 4AJYB 1F77A 2KXEA 1BT0A 3H7SA 3VVWB 4GUAA 1JWSD 4E74A 3W67A 3U6SA 2G3QB 3K9OA 4G4RA 3WANA 4ZHOA 1JW9D 1ZMVA 3Q8XA 1SXJB 2VF7A 1LV7A 3U7DA 5HFYA 4P1CC 3GLGA 1EM7A 1EWOA 1Z5CA 1UGJA 1J7AA 1AU2A 2INPE 1W5SA 1PJIA 2WU2B 2R46A 2KJHB 4CISA 2QZ4A 1IY2A 5EXXA 4HLQA 1DGGA 4GOCA 1HQYE 3GLFB 1FCCC 3KUDB 3X23A 2L7IA 4IJEA 2L4EA 4MH8A 3PZ7A 3ZH9B 4B0EA 4CGYB 2DHYA 4K0KM 2HD5B 1E9RA 3BCNA 3GLIE 5DFLA 4ANXA 4NNJB 3H7PA 1WR1B 2LHEA 1GABA 3AEAB 2I7NA 1FIQA 4PYZA 3U61B 4TQ0A 3KP0E 1L0VB 4P17A 1TR8A 2DAGA 1V5TA 3H7DA 3KH0A 2YJ8A 2WP9B 1F4IA 2JZ0A 2UU7A 3B89A 3SBJA 2BWEA 5HI1A 1XHBA 3DQVA 4LJAA 2MX2A 3J81S 4CHKA 4YYSA 4RF0A 3GS2A 4BBNC 4Y28F 3AOEC 3SAWA 2WX1A 1P1AA 3AXCA 3PHWB 2LGYA 4BS6A 1NJGA 2CHGA 3L28A 4J6IA 2R6FA 4KZ0A 1XO3A 3WXGA 3NHEB 3MMPA 1T0RC 1CTEA 4LJ5A 2I7PA 2J0MA 2FUHB 1ZIVA 2RPVA 2LGIA 4TSSA 2HL7A 1A6RA 2CE7A 2C9OA 5C1BA 4PP1A 5AUKA 2M1MA 3ABVB 3ZIMA 3ZVVA 4LFAM 3MHVC 4OELA 2MBOA 2PNSA 1TTEA 1TIFA 3PBHA 2DWNA 3SR6A 3I63C 3QIJA 2G3QA 2O2VB 4HROA 3UF8A 1BY8A 1HZ5A 1Y4HA 3NVVA 1T0YA 3ZNGC 4JI6M 1SXJA 1P7FA 1KLUD 3EFCA 4NJCA 5FR6A 1FO4A 2BBCA 3RZFA 1FMAD 1R7SA 3H9DA 1ME4A 2DOSA 4WH4A 1WJ7A 2UXDM 1FXTB 2AU1A 3T9LA 4K7UA 3MTNB 4LGYA 3U2SC 2WU5B 4FJVB 4FXCA 2GBMA 2QQ8A 4IBCA 4XBOA 2XU3A 4R71A 2E3TA 1E94E 3GLFA 4BS5A 1ITOA 3QWLA 1WIVA 1XMOM 3BK2A 2LHCA 2HE7A 5JI2E 4WW0A 2IGDA 3NS8A 4S17A 1IGCA 2Z8YM 2K8CA 3B21A 3P63A 2MR9A 2MQJA 2E01A 1WR1A 3KKUA 3U6QA 3FRHA 3N9YC 5LXIB 5H92C 1GOZA 1Q3CA 4Z8XA 2BS3B 4AQ7A 3AE9B 3HM6X 3DHHC 3NBXX 4LF5M 3Q3NC 4LF4M 3JAMS 1GG3A 4EIWA 3P1MA 3VHTC 1YALA 4IBJA 1D3ZA 2BWBA 4YYUA 1S4VA 2LVPC 1WGRA 2BYEA 1IYFA 1DOIA 3GOEA 4DHZB 1V92A 1PUTA 2HWKA 3SAVA 1Y08A 1XLNA 4F8CB 3K24A 1MHWA 1C77A 3L10B 4ZRIA 3NHEA 3FTCA 4IG7B 3F75A 3PTFC 4DV7M 1RM6C 3H1UA 4BAXA 2JXNA 2FIDA 2G8EA 2KD0A 4PS3A 3U6LA 2XU5A 2RGHA 2YJBA 1XXHE 2UXBM 2Z84A 5EF4A 2EKIA 2KDBA 2N35A 4A6QA 3A9KB 2ZJDA 1V8CA 4J3OD 2MJDA 2BGFA 2N9KA 1EUVB 3HZJA 1E9SA 1C79A 4B6WA 3SD5A 3B2FA 3OVXA 3A1QB 1TKGA 2QEJC 2AS8A 1FEHA 2D7GA 2O2VA 4NZLB 3ZXVA 2NTSA 4TUUA 4FJCA 2V1CA 4HWIB 1WGHA 1D6EC 3IOQA 1I4WA 4US9A 1QAMA 2N9XA 1R4NI 4DHJD 4DMXA 3QHTA 4DXGA 1WE6A 2A5UA 3A98B 1QMYA 3ZDMC 4XWTA 3KOYE 3MTNA 3ENEA 2FNJB 1HZ6A 1SP4B 3K1JA 4G4NA 4L8RC 1DF0A 4HEOA 1MS6A 1EF5A 1GJTA 1NV9A 4D82A 4MSMB 1MX0A 1VEKA 5L8RF 5BYRA 3UGBB 2MJEA 2LMCA 4FIPA 2KC1A 2R4EA 1QANA 4CDEB 2M19A 2J0KA 2NS5A 3EFUA 2BNKA 3UIOB 4IBIA 3DBRI 3PRMB 1H6UA 4WP2A 2EA0A 1PPDA 5TSSA 3BVGA 1WI0A 3L29A 4JI5M 4HJGE 2K0PA 3B74A 1Q02A 1TZOA 2JA2A 2XK5B 5EZQA 5C18A 3VFKA 1JQ4A 3ALBA 3WAPA 2OZ2A 3HJSA 4IBDA 3K8ZA 1BQIA 1A5TA 2BJVA 1S1QB 3HVZA 2WZJA 3AKZA 4FADA 1AU4A 4X6JA 1I4XA 3AE8B 2PLPA 2DHRA 3J80S 4ZRKA 2IO1B 1N32M 4OVVA 3TIXA 2M56B 2OEDA 3U6MA 1DOXA 5D3DA 3A9KA 4FCWA 2KNZA 3TE6A 3UIPB 3ZNID 5C3JB 4JI8M 5DPTA 1ZPSA 3LYYA 1KOTA 1EWLA 3RT3B 1WJNA 4JLCA 3K8UA 2JWSA 1ORYB 4DV4M 1L0YB 3CTWB 1ZGUB 3WHLA 2YLMA 2LRUA 5CHVA 3VDUA 1KYIA 2V9HA 4I05A 1GVNA 3GE3C 3AM9A 2LASA 3N32A 1C76A 3KUCB 2WSFF 3PRPA 3KVWA 3O65B 5H37D 2KN5A 1R4MB 1D0LA 4MSQB 3TEWA 1E10A 1U9VA 3RMKC 2JZPA 4EE2A 2BW2A 1POPA 3UGJA 2JU6X 3V05A 2K39A 4C80A 1TF0B 4OX9M 4BB9A 1FFVA 3QT4A 1IXSB 1NO1A 4LDTD 2DWLA 4M9ZA 2VZKD 3ZNZB 4WAAA 1X1MA 1YN3A 5C23A 5LXHA 2JRIB 1HTQA 1IXRC 1MJGM 2QP9X 3CF6E 3S2AA 4C7YA 4XE0A 3PRMA 4S12A 3SAUA 2FQ9A 4D8IA 2PE9A 3MP9A 2BT6A 4BKSD 2OOAA 1LXDA 2XK5A 1P3QQ 2V6ZM 5G5HA 3NY5A 3QYBA 3VDPA 1OAIA 4IUMB 1WRDB 2INDC 1SG9A 2AYOB 1XXGA 4DV6M 1WXSA 5FR3A 3H4JA 2YEPF 2VH1A 2DAKA 2QSFX 1M6DA 2V1YA 3KVFB 4GHAA 1HT2E 2RD0A 1D2NA 2OHFA 2FUDA 3EIEA 1C4AA 4FN2A 3AJIB 1LTMA 1ZAEA 1FNVA 3TSSA 2LVQA 3I3TB 3S3RA 2E6XA 2FIFA 1SIJA 3FILB 1XD3B 5FK9C 3RZWC 2M0AA 4LJ6A 4ANRA 3KP1E 3HX3A 4NXNM 1L6VA 2BDZA 1WZ0A 2GLSA 1DYQA 3QAUA 2L8JA 3LCVB 4ZRPA 3AULA 5TR5A 4XR7A 1IBKM 1D5XC 3EC8A 5DPSA 3O65A 4FJZA 1NB3A 4YYWA 5AZGA 2ZTDA 4KZCA 4DR6M 1QUSA 2ON8A 1K8RB 1ZDXA 2O5RA 5C2TB 5D2MB 5JHAA 4HCPB 3E21A 2CJOA 3U8EA 3JSVA 4JI1M 1XLPA 3UQAA 4BOQA 2JRIA 3GRYA 1QLBB 1XB2B 4AG5A 1V33A 2K1FA 2N1WA 4HK2A 1DGHB 1IBXB 1ICFA 1HUCB 1IY0A 3FKYA 2WYQA 4D2KA 2G8LA 2ARYA 2MH8A 4FHJA 1PJSA 2KC2A 3HD3A 3DZDA 2C9WB 1L2BA 4NY0A 2XBBC 5CTRC 4HPMB 4P7IA 3P42A 4IKGA 3VR8B 4LF8M 1QXPA 1F29A 2QDFA 1NQCA 4A8XC 2KMCA 1V81A 4IUMA 4IIWA 4D81A 4ZYNA 4GKJM 5C1ZA 3SFDB 2K47A 1MPEA 2XSZA 2AYOA 3AEDB 2Z4RA 1E6EB 2ZNVB 3FTEA 4YTNB 4BPVA 1YQ4B 2N9EB 2DKLA 3PSEB 2A5YB 3I57A 1K50A 4II2B 1JMLA 3MHSA 1IUEA 3A9JB 2NQAA 4DK5A 1TH3A 3BXWA 1EWYC 2Y0TA 1SIFA 1YJIA 1CB5A 3B9PA 3L26A 3Q8EA 3C3EA 1SE3A 4Q8GA 2V3SA 3I3TA 2M8SA 2YVCA 3BBZA 1GNUA 2CHVA 3UI3A 4ACFA 2N9PC 1NJFA 3C0RB 1T3QA 2WXJA 1L2CA 2FTDA 3L0WB 1YJ1A 3BVMA 2Z8LA 4EZLA 3ETRA 4DWFA 2AGAA 1Q3BA 1P7EA 3W1SC 4DXAB 4D8EA 3TWKA 4GXBA 5DCNA 1SXTA 4DR1M 2ACZB 2AL6A 3R2TA 3QAQA 4LJ4A 1L1ZA 3Q3OC 1EU4A 4HEA1 3W5UB 4DV5M 1NLJA 2HDEA 3MC8A 2KWDA 5JXVA 1ACCA 3DHIC 4M01A 4ITQA 2KOXA 2ZPNA 3ZRFA 1JWBD 3RPFC 1V6EA 3HK0A 3C19A 5CHTA 5CHWA 3V76A 1M94A 1UH6A 1C4PA 3ZYYX 1CJEA 4MGHA 3AEFB 3Q14C 1UF0A 3N1ZC 2CWBA 1WSPA 2GRIA 4IBFA 3PLUA 1XEEA 3SYKA 2WXPA 3R9XB 1IBXA 1DGHA 3CF0A 3OWEB 3P4SB 4I07A 3LCUA 2LGXA 4KSKC 4LZZA 3QQ8B 5IN7A 4P6EA 4EEWA 4C00A 4D8BA 4DXFA 2KWUB 2RKOA 1WYWB 3JR5A 4D80A 1D5ZC 2I1KA 4C7ZA 1QT9A 4JN6A 3ZRCA 2DZIA 1XKGA 4YL8A 2LFIA 4PD2A 4B08A 4AKHA 1E9MA 3Q3JA 3U52E 2KEBA 1YMHE 2Z7JA 3KWLA 1OQQA 3PSEA 6PADA 3I06A 3HU2A 2LGSA 1G3IA 4EKUA 1BP4A 2FRAA 4RKXA 1W5TA 2R65A 2CU3A 2KFJA 4CZWA 3A9JA 4N59A 1V1PB 3PVLA 2O6XA 3VTWA 3U6DA 4B7HA 5E6NA 3GRRA 2L00B 3PXGA 4JIOU 2WHIA 4L15A 3BYTB 3VKHA 1MVKA 4PP2E 3MHZA 3BC3A 5DNYA 2ZTCA 4L1BA 3A42A 1CJLA 4L6V6 2F5OA 1PJJA 1RRBA 2HHNA 3NS1A 4ZHPA 4L2YA 4K3BA 2DC8A 1XNRM 2J4XA 2J53A 2R9NA 1KM7A 3CIRB 1L7YA 4ZPXA 1MDWA 4AKIA 2APLA 2DNFA 3GB1A 3FTDA 1Y8RC 2KZRA 1Q1OA 1VZ7A 1P3QU 2UWQA 1WF9A 4OZCA 2PKOA 2BQQA 3A45A 1VZ8A 2DVWB 2LJ5A 2OOBB 2FCMA 2YQZA 3ECIA 3VRBB 4TMAB 3TCAA 1XQQA 4LZJA 2DAMA 2RGFA 4KDLB 4FD2A 1L6UA 2KMMA 3VH4B 3AOEA 3QARA 3HHMA 1HNWM 1TTNA 2MH7A 1TY0A 5GXGB 1E0ZA 2IBIB 2ZBKB 4HL4A 1JRUA 1AYUA 4AXLA 3FKEA 5KHOA 4X62M 2EO2A 2JUJA 1WZ3A 3DFZA 3RN9C 3TL4X 3GLIB 1J0GA 2JXTA 2FYEA 1NBFC 2ZM6M 4B3TM 1DGBA 1FH0A 2DJGB 4ZDVA 1ME3A 1TU6A 2R9CA 3VLFB 2D3GA 2IGGA 5HG2A 2Y3AA 3VQIA 2L2DA 2F1GA 1E8YA 4ZTBA 7PCKA 2HAKA 5EP3A 3P5WA 4PK1A 1BGOA 3SFZA 1E8ZA 2KTFA 4DUYM 2IPKD 1QOAA 1L0XB 3UINB 1DEUA 3C8YA 2GB1A 2PE6B 4W9JA 1J7BA 1JR3A 1V1PA 1WJ6A 4QRXA 3PS6A 5A2QS 5CVOB 2KVRA 1J7CA 2LGDA 2JYTA 4REZA 1QQWA 1L2DA 1EWMA 2XGNA 1J5EM 1VDDA 4AUQC 4B9KA 2L52A 4FWHA 4HPLB 4NSOB 5FTNA 3RCZA 1VJVA 1WYGA 2IY1B 2ASQA 2WXKA 1CMXB 2KKCA 4XC2A 2B1MA 2DC9A 5EP2A 3IAM1 2INNE 3AV8A 3KQ4A 2N0SB 1RWSA 2H5XA 4BOSA 4FW9A 3FUVA 2OP3A 1QDTA 4A55A 4GMQA 1GUAB 2NMQA 2NR2A 1ZCMA 5CHFA 2Y0QA 1FRRA 2YR0A 3KYDD 4KKIA 2XFSA 4X66M 1S3SA 2H88B 5KO3A 1AW7A 1HT1E 4FWGA 3APFA 1N34M 3GP7A 1CZPA 1PYWD 3M95A 3N1XC 1OIPA 1QOLA 4IWPA 2K25A 3N3KB 3HJ8A 3ZUAA 3DWMA 2AUZA 5LNK1 2DZKA 4B3MM 1OFHA 2J5YA 2R62A 2F5QA 1V1OA 3K9MA 4FWDA 1L8QA 3PO0A 4RCOA 3T6PA 3HHZA 1Z5AA 2DZZA 4PADA 4I81A 2G7YA 3KOXE 2B76B 7CATA 2IBIA 4W5CA 2JSVX 4MH0E 2X4AA 1D5MC 1LQBA 4LLGM 4QRGA 2CRUA 3B7QA 2G4SA 4G50A 1UM8A 2LXEA 1X37A 2NPTB 4DDGD 3GLIA 2P7UA 2WXOA 4KVGB 1F2RI 1UZXB 3IEJA 4MJSB 4B0MA 2C7MB 1ZXIA 3ZW3A 3H6SA 3AE4B 3NZUA 4RH6A 3DF0A 2ZEQA 1IXZA 3PLVA 3IHPC 2KQ7A 4HLEA 2KNVA 4CDCB 3NUHB 3GPYA 3OG5A 3PT2A 1YSYA 4B3RM 3QYEA 2D7HA 2ERCA 3IG5A 1YNTE 2E02A 3GLGE 1EIJA 5IKCM 3SMPA 1WXQA 2L7RA 4HKQA 2NQDB 5K16A 1DO2A 3IBEA 3KWZA 1WHCA 4XGIA 1KLGD 3IMAA 3RVWA 1WXMA 1CQDA 1HXYD 3GE8C 1PE6A 1X9YA 3DVNU 4AZFA 3N3GA 1EE8A 1XXHB 3RNCC 2PEAA 2XU4A 2KTRB 1STEA 2R9OA 2INCC 2KQ4X 4IM3A 4KHPM 1U9WA 1KRHA 3VUYA 2DNAA 1QAQA 1CPJA 4LFCM 1D4BA 2CFOA 1KJTA 3ZCBB 4GLSC 1V49A 3RVVA 4F2LA 1E8XA 3K2LA 3DVGX 3N3KA 3JR4A 2GI9A 2HWJA 1CQVA 4JI4M 1DOYA 3P4RB 1LGRA 4BOPA 4QNRA 3H8HA 2MEKA 5HHDG 3W1YA 2QHOB 4QOSA 2JNHA 4W9LA 3I5JC 2SEBD 4LF6M 1YIWA 4IM0A 3EGRA 4NL4H 1NI2A 1NHWC 3QJ3A 1T0SC 2NPTA 2WXHA 3Q8CA 4WWOA 5J17A 2PADA 2ICIA 3HJQA 2BPSA 2DCBA 1JWUD 2JF5A 4MJSA 4YSZB 3DPDA 2HD5A 3AE2B 2QJLA 2HTHA 1BUIC 3ZJTA 2W9NA 4RY2A 5DPWA 4GB9A 2IO0B 3P4QB 2N9LA 3R8BA 3U61A 4URKA 1SE9A 1WGLA 2XFTA 1SXJE 4EZJA 4G6ZA 1GB4A 4I6LB 1F2AA 1N63A 2MW5A 2ZCCA 2WGSA 1EFUB 3KLSX 3AH7A 2EUCA 3LQRA 1CV8A 3N1YC 1T5XD 3GLFE 1GO5A 5BPVA 1R5LA 2LI5A 3PHWA 4M0WB 1NY5A 4LCDE 5E6JA 2OPFA 4LTUA 4PDGA 3AE1B 2DXIA 4RGTA 1XXHA 2GHUA 1IBLM 3IECA 2KTRA
chains in the Genus database with same CATH topology
5ITUA 4LF9M 5BR8M 3BWUD 3AE6B 2LHDA 2JYEA 4MGKE 2NTTA 1ZDVA 2BJWA 4ZRQA 4OHJA 3FYDA 1SEBD 3L2AA 3W5VB 3Q8AA 3HKPA 2NQ8C 1MU5A 4RFBA 4GDKB 3HHXA 3W0LB 1GL6A 4MT5A 1N78A 3Q8BA 2QCUA 4LRSA 4GDLB 1YE9A 1YN5A 3A46A 4YHHM 1TS3A 2PVGC 3I51A 4RF1A 3DA1A 4KO8A 4JWUC 3WCQA 2FNAA 5EP4A 2WXMA 1VDVA 1PDXA 1PGAA 2WXIA 1N5XA 1UNSA 3ZJUA 1KFYB 1Q10A 4FCTA 2CUZA 4CQNA 1GLNA 1R6BX 2JWUA 2V3PA 4KGRA 4GITA 2K22A 4RGOS 4YXDB 2W82A 1VJKA 1QVRA 3NVYA 4MI7A 1FRDA 2LEKA 3J27B 1TH4A 3FUUA 5ITTA 2J7OA 3KS8A 4JI2M 3KSXA 3IG8A 1GPXA 5KQ8A 4UDUC 1C1KA 1NSFA 4A9AA 2KRUA 5KQDA 3U7ZA 4M9XA 4FVMA 4QNMA 1N62A 3BVZA 1N36M 3ZNHA 3FD9A 5IZ7D 3KOZE 4WQMA 1TS4A 1BXTA 4USAA 4BLCA 3W31A 3EA6A 2R45A 2F5NA 3W1SA 3TMPA 3E56A 3PNVA 1XCQL 2JTCA 5EE3A 4GKKM 2X8AA 1SB3C 3ZGZA 1HR0M 2KRKA 1FNWA 1QQRA 1Z6TA 4OVZB 4BOZA 2FFJA 5ITYA 3ILKA 1DKIA 1FJGM 4AS1A 1HQCA 1XMQM 1Y56A 2ONQA 4NSRA 2K5PA 4HXDB 5EE9A 2VZKB 3AL0C 2R61A 3NBIA 1K3XA 8CATA 4JPSA 1G41A 1HNZM 3BK1A 3GO8A 3ZC7B 4QHSA 1N77A 2X49A 2UUCM 3TQSA 3NVWA 3TRKA 3U6CA 3L25A 4FCVA 4LFBM 1HNXM 2I2YA 1N75A 2WXFA 1AYFA 5DYIA 4XDCA 2HTME 2V3NA 3U60B 4WIPA 3T3OA 5EXSA 3HWSA 2L09A 3UJNA 2QSDA 3MTVA 3RFZB 3HHWA 4OVZA 3J9CA 2FOIC 4TUWA 3GQ5A 3M6AA 3FILA 5LMNM 4IBBA 1QILA 3T1YM 2QBYB 4NXMM 3IT4B 1Z59A 4I5SA 1EWCA 3SARA 1SJED 1PM5A 3TPZA 2C96A 2KZSA 1TDHA 5ITXE 4GIPA 4LG2A 4OW0A 4KLNA 2CV2A 1HA5A 3BZDB 1IGDA 2VQFM 4DR3M 5G5GA 1K3WA 2H89B 1T6BX 2UUBM 3LVVA 3TEZA 3NRZA 2V1UA 4NRWA 3KXEC 2DZOB 5ITQA 1I4QA 4I4LA 4AW4A 3UMMA 3U60A 3PHXA 1XC8A 4YSXB 2QILA 2CV1A 3C58A 2H1RA 2DBYA 4CHTB 1TJEA 1TYGB 1F2RC 4XWWA 3NZ3A 4JI7M 1CK1A 2R18A 4GC9A 5IWAM 3J7AS 1IN5A 4DR7M 5AUIA 3C0RA 2QBYA 4OU7A 1WRIA 2ZAOA 5FTMA 1XLQA 3BB7A 1TKEA 1GKIA 4PDIA 2IJ0A 3W2DA 1OFIA 2G5GX 2AQ2B 2WXRA 5FKAC 2J7QC 1A70A 5IREB 4XDDA 2Y5CA 4KX6B 2L1AA 1SSNA 2C98A 1TDZA 1ESFA 2Y20A 1ZXHA 3T38A 2DWMA 1VR9A 2PTLA 1N60A 3SASA 2DLBA 5BYSA 3RGPA 1SJHD 5F3WA 2KW0A 2Q2EB 4IOIE 2WXNA 1NEKB 2BB5A 3LB8C 5E26A 3L27A 3FAHA 2Z3XA 3T15A 4BBAA 4A90A 3L4PA 3NVZA 1FD6A 3D8LA 1ET9A 4JWSC 1DO0A 1I4HA 1UWMA 1ZE3D 3KOWE 5FTJA 2KN4A 5D3IB 3HU3A 1XCTL 3I4VA 4DV1M 3PNYA 3AOGA 3W0FA 1SXJD 1VZ6A 4JI0M 2QIEB 4GHLA 1FXAA 5I4DA 1QKZA 2Q5WD 4ARCA 3VK8A 1NVMA 4YTPB 2KA6B 3URYA 5KPZA 5EP1A 4G4QA 3AN1A 1TY2A 2W3SA 4L23A 4N58A 2KDMA 2G1EA 4JI3M 5KPTA 2PW9A 3LQQA 2WXGA 3HVDA 4IP3A 1HQRD 1UUPA 2FUG1 2VQEM 1IN4A 3B9JA 1NENB 4KKJA 3MFGA 3U6PA 3VKGA 1L4DB 2YEPB 1SF0A 1L5PA 4O1NA 1C4CA 1L1TA 2IGHA 2X38A 3PHUA 2XH9A 4WWMA 4LY6A 4YT0B 2Z4SA 2I38A 3T3NA 2UU9M 3W30A 3MP2A 1L4ZB 4JE3B 4B7GA 1JALA 3LVWA 1B9RA 3IAS1 2LJIA 3DOAA 1M4VA 3AFHA 3V3XA 2WQYB 2C5RA 4LRTA 1JQJC 1KTKA 1WGKA 3EIHA 4KGSA 2RGOA 3R2IA 3E9SA 1EU3A 3GPXA 4IBGA 4X64M 1FM0D 3PFIA 5FSWA 2IDYA 3TUOA 3M7GA 4JV5M 4PT5A 1NNJA 1NYRA 3RNVA 2MJ3A 3GQ4A 1FCLA 4OZAA 3BY4A 4L16A 2FBWB 4NAWB 1RYJA 2LWXA 4KODA 5EXPA 2PVOD 2FE8A 3O13A 1F0ZA 1NNUC 3FTFA 4RNAA 3CF2A 3AEGB 4Q2JA 5IT9S 3BBAA 1IN7A 1XWIA 3MC0B 3OTOM 1FXIA 3MJ5A 3AEBB 2WDVB 3FYCA 3HRDD 1OQRA 3GRVA 4MB7A 4PCZA 4JXJA 1KFVA 3TEXA 3HHYA 3GP1A 1TS2A 1MHXA 4RGMA 2SAKA 1R2YA 3PZ8A 2EELA 4DUZM 5GKNA 5JI3E 2J52A 1QAOA 1JRPA 4IBEA 2R4JA 5EJCA 5EQTA 3SHGB 5MPOA 3GRUA 2DZNB 3NWLA 3J2PB 1HEZE 1AN8A 3GQ3A 4NOOB 4X65M 4IDIA 5EZSA 4HKZE 3ZJVA 2F5PA 2XNAC 3VFDA 1ZUD2 4TQ1A 2C9CA 2WXQA 2DYMA 1K82A 4DV3M 3K92A 3RGSA 3GLHB 2HCBA 4HRSA 2BS4B 3B2GA 1NVID 1ET6A 2DWZB 3SEBA 3ZQ4A 1K52A 5LMUM 3KSJA 1WWTA 4IJFA 4IBKA 4QOZC 3SFEB 1XF5L 4M0WA 1C78A 1J7KA 3TWLA 1YJJA 1IN6A 4Z6YA 4QHTA 5BMIA 3AEEB 3SHFA 4N6EB 2BYTA 3BIID 1SE4A 3BYYB 2K9XA 5JZEA 3HU1A 1TKYA 2HHHM 1G4AE 1SXJC 3GPPA 4RGNA 1OJLA 1K53A 1ROEA 5T8IA 1XNQM 1JWAD 4R3DA 4YY3M 2W54A 3H4MA 3KFUG 4US8A 4P6VF 2WDRB 4DR4M 2YNMD 2ZAMA 2F5SA 2K3UA 4WURA 1QOFA 2XEPA 4OZBA 1AWDA 2PMVA 3W9CB 4MGYE 2XSZD 3U6OA 3WHKA 3U4EG 2KAJA 3UK6A 3I4YA 4AG6A 3GLHA 1E32A 3SMSA 5EXTA 3FUTA 3DWGC 1IN8A 1RFKA 3AV0A 3HGIA 1QOGA 3SYLA 2UXCM 4JYAM 2BB6A 2HKJA 4B7FA 4GH9A 5DYGA 3OQCA 2CV0A 4LJ8A 4DR2M 2AX5A 3KWVA 1UWXA 4AI6A 2BTEA 1YUBA 4BOUA 1ENFA 4NAMA 2E5LM 1OFFA 3TWMA 5BMGA 3VK7A 4LF7M 3FC4A 4M0DA 1PFDA 1N33M 1JROA 1SE2A 1DGJA 3TEYA 1JCKB 4DR5M 1IBMM 3VRAB 1E7PB 2P5TA 2XZFA 2AQ3B 2Y5PA 2LUMA 1G8PA 1YZBA 5BMHA 3VR9B 4MM3B 3LXFA 4JX1C 2XN9C 1SBBB 4GRIA 4II7A 4LCBA 3EUB2 4M9SA 3E4RA 2F4VM 3KS4A 2QENA 3THGA 2CHQA 3R8FA 1YQ3B 1R2ZA 2QPAA 4DQOC 2ZANA 4DV2M 3AMZA 1FNNA 1VLBA 2V4IB 2Y21A 4G4OA 1DGFA 4LGMA 2ZW1A 2J7QA 2AQ1B 2DYOA 3AECB 3P4PB 3Q8FA 1BMLC 2RMMA 2M5ZA 5BYQA 2LNHC 2M60A 1VRAB 5ITXA 1TH2A 2D7EA 3KW6A 4W5WA 1G59A 4YWGG 2LH0A 3D8BA 3IT6B 4LJ9A 4LJ7A 3IFUA 5FTLA 4ARIA 1UKFA 4A3VB 1GL7A 4R7GA 1C9FA 1YN4A 1LO5D 2L6OA 4B3SM 1Z5BA 1QOBA 4GC5A 1QF6A 1JR3D 2J7NA 3UZUA 4LK0M 2WNMA 3BOSA 4L78A 2WLBA 3AE3B 2DWQA 5EE1A 1ZOYB 3RFWA 1NI3A 5ITRA 2UZJA 2YFQA 2BU3A 2BTWB 2XZUA 5FTKA 3U5ZB 2KACA 2D5GA 4MGIE 4A5UA 1I4RA 1I4GA 4YTMB 5KPRA 3GPUA 1T3TA 2AHMA 3U6EA 4YSYB 1IQPA 3FUWA 1R7RA 3PVSA 1NY6A 1QYRA 2ZW0A 3IXSA 1KF6B 2WXLA 1IM2A 3I9V1 3RE8A 1JWMD 1J09A 2UUAM 4ZOHC 4I8OA 2WDQB 2JQRB 1KSFX 3AB5A 4KGTA 1B1ZA 2OQ4A 3T1HM 3M0EA 4XZXA 2TSSA 1NHGC 4H2AA 4ITKA 3SC3A 1GAQB 3SATA 2XLJA 2C99A 2L32A 1PVJA 2VIIA 1NYQA 1FFUA 2L83A 2RDGA 2QMTA 2KZUA 1FNUA 4MACA 1TGUA 2BTWA 3U5ZA 2J42A 4NRVA 4MGZE 3LMMA 3GLGB 1K51A 4L4UA 1KH0A 4WAFA 2WS3B 2PIAA 5D7GA 4DV0M 1MI0A 4P16A 1GB1A 2W55A 1ZQ9A 1I7HA 2JX5A 2N7JA 1Q39A 1N61A 2L7HA 1MHHE 5FLXS 1IY1A 4C56C 4ZYSA 3MK6A 1PGXA 1V97A 3AE5B 1I4PA 2CJNA 1PGBA 3J7BA 2XF3A 2G9HD 2V0GA 1ZP0B 3AE7B 3HUIA 1N5WA 1QZMA 2BS2B 5H8YE 3KDSE 3FUXA 1TS5A 3Q69A 4AQYM 2CEAA 3CWIA 1I94M 2W3RA 5EE0A 1XLOA 4AKGA 2RDHA 1F77A 2KXEA 4GUAA 1JWSD 3U6SA 4G4RA 4ZHOA 1JW9D 3Q8XA 1SXJB 5HFYA 1LV7A 3GLGA 1EM7A 1Z5CA 1UGJA 1J7AA 2INPE 1W5SA 1PJIA 2WU2B 2R46A 4CISA 2QZ4A 1IY2A 5EXXA 4HLQA 1DGGA 1HQYE 3GLFB 1FCCC 2L7IA 4IJEA 4MH8A 3PZ7A 3ZH9B 4B0EA 4CGYB 4K0KM 1E9RA 2LHEA 3AEAB 2I7NA 1FIQA 3U61B 4TQ0A 3KP0E 1L0VB 2WP9B 3SBJA 5HI1A 1XHBA 4LJAA 3J81S 4RF0A 3GS2A 3AOEC 3SAWA 1NJGA 2CHGA 3L28A 1XO3A 4LJ5A 2I7PA 2RPVA 2LGIA 4TSSA 2HL7A 2CE7A 2C9OA 5C1BA 5AUKA 3ABVB 4LFAM 3MHVC 2DWNA 3SR6A 4HROA 1HZ5A 3NVVA 4JI6M 1SXJA 1P7FA 1KLUD 1FO4A 4NJCA 2BBCA 1FMAD 1R7SA 2DOSA 4WH4A 2UXDM 4LGYA 3U2SC 2WU5B 4FXCA 4IBCA 4XBOA 2E3TA 1E94E 3GLFA 3QWLA 1XMOM 3BK2A 5JI2E 4WW0A 2IGDA 1IGCA 3B21A 3P63A 3U6QA 3N9YC 5H92C 1GOZA 1Q3CA 4Z8XA 2BS3B 4AQ7A 3AE9B 4LF5M 4LF4M 3JAMS 3P1MA 4EIWA 4IBJA 1DOIA 1PUTA 2HWKA 3SAVA 1XLNA 1C77A 3FTCA 4DV7M 1RM6C 3U6LA 2RGHA 2UXBM 2Z84A 2EKIA 4A6QA 4J3OD 1V8CA 2MJDA 2N9KA 1E9SA 1C79A 3B2FA 1TKGA 2QEJC 1FEHA 2D7GA 4NZLB 2NTSA 2V1CA 1D6EC 1I4WA 4US9A 1QAMA 4DXGA 3A98B 4XWTA 3KOYE 1HZ6A 3K1JA 4G4NA 4L8RC 4D82A 1MX0A 5BYRA 2MJEA 2LMCA 2R4EA 1QANA 2M19A 2BNKA 4IBIA 1H6UA 2EA0A 5TSSA 3BVGA 3L29A 4JI5M 4HJGE 2K0PA 1TZOA 2JA2A 5EZQA 5C18A 1JQ4A 3HJSA 4IBDA 3K8ZA 2BJVA 3HVZA 3AKZA 1I4XA 3AE8B 2PLPA 2DHRA 3J80S 1N32M 2M56B 2OEDA 3U6MA 1DOXA 5D3DA 4FCWA 3TE6A 5C3JB 4JI8M 1ZPSA 3LYYA 1ORYB 4DV4M 1L0YB 3CTWB 3WHLA 3VDUA 1KYIA 1GVNA 3AM9A 1C76A 3PRPA 3KVWA 5H37D 3TEWA 1E10A 2JZPA 4EE2A 2BW2A 3UGJA 2JU6X 3V05A 4C80A 4OX9M 4BB9A 1FFVA 1IXSB 2DWLA 4M9ZA 2VZKD 1YN3A 1IXRC 2QP9X 3CF6E 4C7YA 4XE0A 3PRMA 4S12A 3SAUA 4D8IA 3MP9A 2BT6A 2V6ZM 5G5HA 3VDPA 1XXGA 4DV6M 5FR3A 2YEPF 4GHAA 1HT2E 1D2NA 2OHFA 3EIEA 1C4AA 3AJIB 1ZAEA 1FNVA 3TSSA 2E6XA 1SIJA 3FILB 5FK9C 2M0AA 4LJ6A 3KP1E 4NXNM 1L6VA 1DYQA 3QAUA 4ZRPA 1IBKM 1D5XC 3O65A 4DR6M 2ON8A 1ZDXA 2O5RA 5C2TB 2CJOA 4JI1M 1XLPA 4BOQA 2JRIA 3GRYA 1QLBB 4AG5A 1IBXB 1DGHB 1IY0A 4D2KA 2G8LA 3DZDA 1L2BA 3P42A 4IKGA 3VR8B 4LF8M 4A8XC 4IUMA 4IIWA 4D81A 4GKJM 3SFDB 2K47A 1MPEA 2XSZA 3AEDB 2Z4RA 1E6EB 3FTEA 4YTNB 1YQ4B 2A5YB 3I57A 1K50A 1JMLA 1IUEA 1TH3A 1EWYC 2Y0TA 1YJIA 3B9PA 3L26A 3Q8EA 1SE3A 2CHVA 3UI3A 1NJFA 1T3QA 2WXJA 1L2CA 3BVMA 2Z8LA 3ETRA 2AGAA 1Q3BA 1P7EA 4D8EA 3TWKA 1SXTA 4DR1M 2ACZB 3R2TA 4LJ4A 1L1ZA 1EU4A 4HEA1 3W5UB 4DV5M 2HDEA 2KWDA 5JXVA 1ACCA 4ITQA 1JWBD 3RPFC 1C4PA 3ZYYX 1CJEA 4MGHA 3AEFB 1WSPA 2GRIA 4IBFA 1XEEA 3SYKA 2WXPA 3R9XB 1IBXA 1DGHA 3CF0A 3OWEB 3P4SB 4LZZA 4D8BA 4DXFA 2RKOA 3JR5A 4D80A 1D5ZC 4C7ZA 1QT9A 4JN6A 2LFIA 4PD2A 4B08A 4AKHA 1E9MA 3U52E 2KEBA 1YMHE 2Z7JA 3KWLA 1OQQA 3PSEA 3HU2A 1G3IA 4RKXA 1W5TA 2R65A 2CU3A 4N59A 1V1PB 3U6DA 4B7HA 3GRRA 3PXGA 4L15A 3BYTB 3VKHA 1MVKA 3MHZA 5DNYA 4L1BA 3A42A 2F5OA 1PJJA 3NS1A 4ZHPA 4L2YA 1XNRM 2J4XA 2J53A 3CIRB 4ZPXA 4AKIA 3GB1A 3FTDA 1VZ7A 4OZCA 2PKOA 3A45A 1VZ8A 2DVWB 2YQZA 3VRBB 4TMAB 4LZJA 4FD2A 1L6UA 2KMMA 3AOEA 1HNWM 2MH7A 1TY0A 5GXGB 1E0ZA 2ZBKB 4HL4A 3FKEA 4X62M 2EO2A 3DFZA 3TL4X 3GLIB 2JXTA 2ZM6M 4B3TM 1DGBA 3VLFB 2IGGA 5HG2A 2Y3AA 3VQIA 4ZTBA 5EP3A 3SFZA 4DUYM 2IPKD 1QOAA 1L0XB 3C8YA 2GB1A 1J7BA 1JR3A 1V1PA 5A2QS 1J7CA 2JYTA 4REZA 1QQWA 1L2DA 2XGNA 1J5EM 1VDDA 2L52A 4FWHA 4NSOB 5FTNA 1WYGA 2WXKA 5EP2A 3IAM1 3KQ4A 3AV8A 2INNE 2N0SB 1RWSA 4BOSA 4FW9A 3FUVA 4A55A 4GMQA 2NMQA 2Y0QA 1FRRA 2YR0A 4KKIA 2XFSA 4X66M 1S3SA 2H88B 5KO3A 1AW7A 1HT1E 4FWGA 1N34M 3GP7A 1CZPA 1PYWD 3HJ8A 3DWMA 5LNK1 4B3MM 1OFHA 2F5QA 2R62A 1V1OA 4FWDA 1L8QA 3PO0A 4RCOA 3HHZA 1Z5AA 4I81A 3KOXE 2B76B 7CATA 2JSVX 4MH0E 2X4AA 1D5MC 4LLGM 1UM8A 2LXEA 1X37A 3GLIA 2WXOA 1F2RI 4B0MA 1ZXIA 3AE4B 4RH6A 1IXZA 3NUHB 3GPYA 3PT2A 1YSYA 4B3RM 2D7HA 2ERCA 3IG5A 1YNTE 3SMPA 1WXQA 4HKQA 1DO2A 4XGIA 1KLGD 1HXYD 4AZFA 1EE8A 1XXHB 1STEA 2KQ4X 4KHPM 1KRHA 1QAQA 4LFCM 1D4BA 2CFOA 3ZCBB 4GLSC 3K2LA 3JR4A 2GI9A 1CQVA 4JI4M 1DOYA 3P4RB 4BOPA 4QNRA 3H8HA 2MEKA 5HHDG 4QOSA 2SEBD 4LF6M 3EGRA 4NL4H 1NHWC 2WXHA 3Q8CA 2ICIA 3HJQA 1JWUD 4YSZB 3AE2B 2QJLA 1BUIC 3ZJTA 3P4QB 2N9LA 3R8BA 3U61A 2XFTA 1SXJE 4G6ZA 1GB4A 1N63A 3KLSX 3AH7A 2EUCA 3LQRA 1T5XD 5BPVA 3PHWA 5E6JA 2OPFA 4LTUA 4PDGA 3AE1B 2DXIA 4RGTA 1XXHA 1IBLM 1NY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUR A;  3MJ5 A;  4MM3 B;  3E9S A;  2FE8 A;  3MP2 A;  5KO3 A;  4RF0 A;  4M0W A;  4OVZ A;  4REZ A;  4R3D A;  4P16 A;  4RNA A;  4RF1 A;  4OW0 A;  4OVZ B;  5E6J A;  4PT5 A; 
#chains in the Genus database with same CATH topology
 5ITU A;  4LF9 M;  5BR8 M;  3BWU D;  5IOI A;  3AE6 B;  2LHD A;  2DAE A;  2JYE A;  4MGK E;  2NTT A;  1ZDV A;  3FE3 A;  2DCA A;  2BJW A;  4ZRQ A;  1R4G A;  2RPQ A;  4OHJ A;  1GCB A;  2KX3 A;  1QDQ A;  3FYD A;  1SEB D;  1AEC A;  4W9H A;  2HJ1 A;  3CH2 X;  2JPH A;  3L2A A;  2Z59 B;  3W5V B;  3Q8A A;  3HKP A;  2NQ8 C;  2JY7 A;  1MU5 A;  4RFB A;  4GDK B;  4XX5 A;  2QHO A;  2E00 A;  3HHX A;  2OO9 A;  3P5U A;  3W0L B;  1GL6 A;  4HJK A;  4AOF A;  1RU3 A;  5CVN B;  4N9F 4;  3M99 A;  4MT5 A;  1PXV A;  1N78 A;  3Q8B A;  2VHF A;  2QCU A;  2RRU A;  4LRS A;  4GDL B;  1YE9 A;  1H8C A;  1YN5 A;  3A46 A;  4YHH M;  1TS3 A;  1YLA A;  2PVG C;  2VRR B;  2BKF A;  3I51 A;  3OF9 A;  4RF1 A;  3DA1 A;  4KO8 A;  1O0E A;  3ZNH B;  1PJT A;  4XZ4 A;  2EMS A;  4CYE A;  2DZY A;  2D10 A;  4JWU C;  4ASW C;  3WCQ A;  2FNA A;  5EP4 A;  3TJP A;  2WXM A;  3RUI B;  3TMP B;  1VDV A;  1PDX A;  1PGA A;  3QC8 B;  4GSW A;  1SNK A;  2WXI A;  2KK8 A;  3WIM A;  2IY0 B;  2KNB A;  2NCN A;  1N5X A;  1UNS A;  2WSE F;  4GGQ A;  3ZJU A;  4HVB A;  3C3D A;  1KFX L;  3GZN B;  2J0J A;  1KFY B;  4DHJ B;  1Q10 A;  4FCT A;  4IWQ A;  2K9D A;  4BOZ B;  2CUZ A;  4CQN A;  1GLN A;  4CIZ A;  1R6B X;  2AEH A;  2JWU A;  2V4L A;  4HDO A;  2V3P A;  1Q0W B;  3DCG A;  4GIT A;  2K22 A;  4KGR A;  4RGO S;  1OEY J;  4YXD B;  5IAA C;  2JZ1 A;  2W82 A;  1MEG A;  2B3T A;  1VJK A;  3USV A;  1QVR A;  3A1Q A;  3NVY A;  2LD9 A;  4MI7 A;  1G71 A;  1FRD A;  1WX9 A;  2LEK A;  4K81 A;  3J27 B;  3U30 A;  1TH4 A;  2R9M A;  3WXF A;  3FUU A;  4N8W A;  4DHZ E;  4WJO A;  3RNA C;  5ITT A;  3DBS A;  4GDK A;  1WM2 A;  2CHX A;  2J7O A;  3KS8 A;  2LHG A;  1ISN A;  3PPA A;  4JI2 M;  3KSX A;  3IG8 A;  1U4A A;  2N7D A;  1J8C A;  1GPX A;  5KQ8 A;  3E46 A;  2KDI A;  4UDU C;  2KFK B;  2KWV B;  2MJ5 B;  3HHI A;  1C1K A;  1NSF A;  2R9F A;  4AWJ A;  3VTU A;  1T0Q C;  4RM9 A;  1PIP A;  4A9A A;  4GDL A;  2KRU A;  5KQD A;  3U7Z A;  2JT4 B;  5CX3 A;  4PS8 A;  4M9X A;  4FVM A;  4QNM A;  1N62 A;  3V61 A;  3BVZ A;  3CH3 X;  2JQF R;  1N36 M;  2BYV E;  2N4F A;  5AZH A;  3ZNH A;  2LXC A;  2KDL A;  2FS1 A;  3FD9 A;  3MHS D;  1WGN A;  5IZ7 D;  3KOZ E;  4WQM A;  1TS4 A;  3RUL A;  1BXT A;  5E6P A;  1ZKH A;  2EJS A;  4USA A;  4BLC A;  3W31 A;  3EA6 A;  2R45 A;  2ZVN A;  2F5N A;  4FLH A;  3W1S A;  3TMP A;  3GLH E;  2KWC A;  3E56 A;  3PNV A;  1XCQ L;  2JTC A;  3R66 C;  1FPY A;  5EE3 A;  2L76 A;  2Z0D B;  4GKK M;  2X8A A;  2K8H A;  2LVO C;  1N6Z A;  1TLO A;  5JH3 A;  1SB3 C;  1V2Y A;  1ZMU A;  3ZGZ A;  4FBJ B;  1HR0 M;  2C0Y A;  2KRK A;  4KIK B;  1FNW A;  1TBE A;  1QQR A;  1Z6T A;  4OVZ B;  2D3C A;  4BOZ A;  4KLB A;  2FFJ A;  5ITY A;  4BSQ A;  3ILK A;  1DKI A;  4QRV A;  5A24 A;  1FJG M;  1WGY A;  5AEK B;  4AS1 A;  2HJ8 A;  1WR6 E;  4BKG A;  1HQC A;  1XMQ M;  1Y56 A;  3ZKJ C;  2ONQ A;  4NSR A;  4K3C A;  4PYU A;  3P5V A;  4LDT B;  1K3B B;  2K5P A;  1PGY A;  4HXD B;  5EE9 A;  2VZK B;  1IP9 A;  1CVZ A;  3AL0 C;  4WJN A;  2R61 A;  4AP4 C;  3H8C A;  3ZTD A;  3NBI A;  2VDB B;  1K3X A;  2Z0E B;  8CAT A;  4JPS A;  2OJW A;  1G41 A;  4LNF A;  4HPP A;  2GBR A;  1HNZ M;  2AWT A;  2LWP A;  3BK1 A;  3GO8 A;  4F7Z A;  3CST A;  3ZC7 B;  3PV1 A;  4XUI A;  2NBV B;  1ATK A;  4QHS A;  1IXS A;  2X49 A;  1N77 A;  1TL9 A;  4ICV A;  2O6V B;  3OAW A;  4B95 A;  4P6G A;  3ML9 A;  2UUC M;  3TQS A;  3NVW A;  5GMV A;  4NQK E;  3V60 A;  2LZ6 A;  2BWE S;  4LNI A;  1YVB A;  3TRK A;  3U6C A;  3L25 A;  4P1B C;  4FCV A;  4LFB M;  2AL3 A;  8PCH A;  1HNX M;  1VQ1 A;  2I2Y A;  2FCN A;  1N75 A;  2WXF A;  1RLF A;  3QK0 A;  1AYF A;  5DYI A;  4LJO B;  2HTM E;  2V3N A;  4XDC A;  3U60 B;  4WIP A;  2Y5B B;  3PHX B;  3T3O A;  4EFO A;  1C1Y B;  5EXS A;  3L16 A;  3RI7 C;  3HWS A;  2L09 A;  3UJN A;  2QSD A;  1IPG A;  4KIK A;  2JZZ A;  2FAZ A;  5AZF A;  3MTV A;  2JY6 B;  2M4N A;  3RFZ B;  3HHW A;  4OVZ A;  3J9C A;  1PJQ A;  2FOI C;  2B3A A;  2PBH A;  4TUW A;  3GQ5 A;  2WX0 A;  1HE8 A;  2JY5 A;  3M6A A;  3FIL A;  1KXR A;  1V86 A;  2WBF X;  5LMN M;  3DBL B;  2KJR A;  4IBB A;  3KSE A;  2JQG R;  1QIL A;  4WQO B;  3T1Y M;  2VH2 A;  2QBY B;  2EKF A;  4NXM M;  4HXD A;  3IT4 B;  1Z59 A;  4I5S A;  1EWC A;  3SAR A;  1WM3 A;  2I1J A;  1S3S G;  1SJE D;  2LTU A;  1PM5 A;  3KUZ A;  2VHS A;  3TPZ A;  2C96 A;  2KZS A;  2DAJ A;  1MEM A;  1TDH A;  4JL9 A;  3M3J A;  5ITX E;  4GIP A;  4WA6 A;  4LG2 A;  4W9I A;  4OW0 A;  3FRI A;  1MN3 A;  3ML8 A;  4KLN A;  2KT7 A;  4BKS A;  2CV2 A;  4WWN A;  1HA5 A;  2KX0 A;  3BZD B;  1IGD A;  2VQF M;  4DR3 M;  1TZ1 A;  1K3W A;  2H89 B;  2O6V A;  4I6P A;  5G5G A;  4X57 B;  1KHP A;  1T6B X;  3TNX A;  2UUB M;  3LVV A;  3TEZ A;  3MHH A;  3NRZ A;  2IZV B;  3PRE A;  4QH6 A;  2O01 F;  3APD A;  2V1U A;  4NRW A;  3KXE C;  2MWS B;  3H89 A;  2MSE D;  4GMV A;  3E1Z B;  2DZO B;  2MBQ A;  3AI5 A;  4RMA A;  5ITQ A;  1I4Q A;  2R6N A;  3BWK A;  2LVN C;  4I4L A;  3KWB X;  2JVC A;  4AW4 A;  3K9P B;  2R44 A;  2D3B A;  3UMM A;  3U60 A;  1H4R A;  2Y5B A;  4DMY A;  3PHX A;  4MEM A;  1XC8 A;  2DAF A;  4YSX B;  5IA7 A;  2QIL A;  2QNJ A;  2CV1 A;  3C58 A;  3N4C A;  4EZK A;  2DZM A;  2H1R A;  2JY6 A;  2DBY A;  3LW5 F;  3T8M A;  4CHT B;  1TJE A;  2LVA A;  1TYG B;  2REX A;  1F2R C;  4M8N A;  4XWW A;  4LNN A;  3TBL D;  3NZS A;  3NZ3 A;  4JI7 M;  1CK1 A;  2R18 A;  4GC9 A;  4X6I A;  5IWA M;  3J7A S;  4MDK E;  2IYD B;  1IN5 A;  4DR7 M;  1GLO A;  5AUI A;  3C0R A;  2JXX A;  2YJ2 A;  1YX5 B;  1F2C A;  2QBY A;  2BVC A;  4OU7 A;  1WRI A;  2ZAO A;  5FTM A;  1XLQ A;  4DDI D;  3VUX A;  1MG8 A;  3BB7 A;  2BDL A;  1TKE A;  1GKI A;  4PDI A;  2IJ0 A;  2IO2 B;  1WXA A;  1GJZ A;  2P86 A;  2FRQ A;  3W2D A;  1OFI A;  3IUT A;  2MA9 B;  2CKH B;  2G8J A;  1ZW7 A;  1WH3 A;  3IHP A;  3BPM A;  2G5G X;  2AQ2 B;  1WIA A;  2WXR A;  5FKA C;  4WJP A;  2NQI A;  2J7Q C;  2LUE A;  3B7N A;  5IRE B;  1A70 A;  4XDD A;  2KNA A;  2Y5C A;  1VEG A;  3WAM A;  1Q5W B;  4KX6 B;  1I42 A;  4W9E A;  4RKU F;  2L1A A;  1SSN A;  2C98 A;  4YV8 A;  1TDZ A;  1ESF A;  2Y20 A;  3C9E A;  3O0U A;  1ZXH A;  2L0F A;  5CVM A;  3T38 A;  2DWM A;  1VR9 A;  3OIS A;  2PTL A;  1N60 A;  3SAS A;  1WX8 A;  2DLB A;  1E7V A;  3OF8 A;  5BYS A;  4N4Z A;  3K9P A;  3RGP A;  4NPN A;  1GMY A;  1MIR A;  1SJH D;  5F3W A;  2KW0 A;  2DHZ A;  1BVS A;  4JQW C;  3QWZ B;  2RR9 A;  2Q2E B;  4IOI E;  2WXN A;  3K9O B;  1NEK B;  1ZV1 A;  2BB5 A;  4MSX A;  3B79 A;  3LB8 C;  4G3X B;  5E26 A;  1CUK A;  3L27 A;  3SHQ A;  3FAH A;  2R2Q A;  4PI3 A;  2Z3X A;  3T15 A;  5BO4 B;  4BBA A;  4A90 A;  3L4P A;  3NVZ A;  2KO3 A;  1OGW A;  3D32 A;  3CMM B;  3O1G A;  1FD6 A;  3D8L A;  1ET9 A;  4JWS C;  2DCC A;  1DO0 A;  2GOW A;  4ZRJ A;  1I4H A;  1UWM A;  1ZE3 D;  3ONS A;  3KOW E;  5FTJ A;  1GEC E;  4X6H A;  2KN4 A;  5D3I B;  3HU3 A;  1XCT L;  3I4V A;  4K1R B;  4DV1 M;  3PNY A;  4KDI C;  1C7Y A;  2GMI C;  3AOG A;  4OEM A;  3W0F A;  3WA0 A;  4XYC A;  1WY8 A;  3Q6B A;  1SXJ D;  4IM2 A;  1VZ6 A;  4JI0 M;  2QIE B;  4GHL A;  1J19 A;  2DYB A;  1FXA A;  5I4D A;  4OVU A;  1QKZ A;  2MRP A;  1VCB A;  4EUT A;  3ZTC A;  3RNB C;  5J2R A;  4MEL A;  1OEY A;  2Q5W D;  3IG3 A;  5IP4 D;  4ARC A;  3VK8 A;  2ZPY A;  2NBU A;  2ACT A;  1NVM A;  1PRB A;  4YTP B;  2KA6 B;  3URY A;  2OOB A;  5KPZ A;  5EP1 A;  1P0R A;  2MHJ A;  3TL5 A;  4G4Q A;  1OQY A;  3HHA A;  1V9J A;  1TY2 A;  3AN1 A;  2W3S A;  4KV2 A;  4L23 A;  5J18 A;  1E90 A;  2JUO A;  4N58 A;  2KDM A;  2G1E A;  2LVP A;  4FUL A;  4JI3 M;  5KPT A;  4N79 A;  2DC7 A;  3BY4 B;  2PW9 A;  3LQQ A;  2WXG A;  3HVD A;  4IP3 A;  3RNF C;  1HQR D;  1WXV A;  1E5W A;  1UBI A;  1UUP A;  2FUG 1;  1HTO A;  2GFO A;  2VQE M;  2K8B A;  2ATO A;  1IN4 A;  2XEW A;  3B9J A;  4QBB A;  1WJU A;  1NEN B;  2D2Q A;  4KKJ A;  3MFG A;  3F92 A;  3U6P A;  3VKG A;  1L4D B;  2YEP B;  1SF0 A;  2FH0 A;  4E3C A;  1L5P A;  4O1N A;  5DPR A;  1C4C A;  5IO9 A;  5G55 A;  1WE7 A;  1L1T A;  2IGH A;  2X38 A;  3PHU A;  2XH9 A;  4WWM A;  4LY6 A;  3AU4 A;  4ICU A;  4YT0 B;  2Z4S A;  1R4M I;  2I38 A;  4F1S A;  3T3N A;  2UU9 M;  4II3 B;  4TV3 A;  3W30 A;  1G6J A;  2ZVO A;  3MP2 A;  1SGH A;  3X0W A;  1L4Z B;  4JE3 B;  3KYC D;  4IWO A;  5L95 C;  4B7G A;  3W68 A;  1JAL A;  2FCS A;  1L2N A;  3LVW A;  3LDZ E;  1PCI A;  1MJD A;  4ZUX U;  1B9R A;  3RD2 A;  3IAS 1;  2LJI A;  3DOA A;  1M4V A;  3AFH A;  3V3X A;  2L4F A;  2WQY B;  2C5R A;  4GIV A;  4LRT A;  3Q2A C;  3RYT A;  1JQJ C;  1NPZ A;  1F2B A;  1VEJ A;  1KHQ A;  2KHW B;  1KTK A;  2K6D B;  1WGK A;  3EIH A;  4KGS A;  1YK8 A;  2RGO A;  3CBJ A;  3LFY A;  3R2I A;  3E9S A;  4G54 A;  1EU3 A;  3GPX A;  4IBG A;  3A4S C;  4X64 M;  1FM0 D;  4GN1 A;  1V80 A;  3NJT A;  3PFI A;  5FSW A;  2IDY A;  3TUO A;  3I01 M;  1VG5 A;  4YYQ A;  3M7G A;  5PAD A;  4BFR A;  4JV5 M;  4PT5 A;  1NNJ A;  1NYR A;  4WJQ A;  3RNV A;  2MJ3 A;  3GQ4 A;  1FCL A;  2D07 B;  2MBH A;  4OZA A;  3BY4 A;  4L16 A;  3HWN A;  2FBW B;  4NAW B;  1PPO A;  1RYJ A;  2LWX A;  2DZL A;  4CO7 A;  3Q8G A;  4KOD A;  5EXP A;  4M00 A;  2PVO D;  2FE8 A;  2WDT B;  3O13 A;  3NG0 A;  1YK7 A;  5EGW A;  2CIO A;  1F0Z A;  3ZXR A;  1NNU C;  3HM3 A;  4WWP A;  3FTF A;  4RNA A;  3B1L X;  3CF2 A;  3AEG B;  4Q2J A;  3NOB A;  5JHB A;  4FJY A;  5IT9 S;  3BBA A;  4CDD B;  2AUX A;  1IN7 A;  1XWI A;  2GBN A;  3CBK A;  2KXJ A;  3MC0 B;  2MBB B;  3OTO M;  1FXI A;  5HKH A;  2GNO A;  3MJ5 A;  2KDE B;  4XK8 F;  2EKK A;  3VUW A;  4BOS C;  2JZ3 B;  1LM8 B;  2KDF B;  3AEB B;  3VH3 B;  2WDV B;  3FYC A;  3HRD D;  3DVG Y;  1OQR A;  4EOY A;  3GRV A;  4MB7 A;  4FK5 A;  1PBH A;  4PCZ A;  2BWF A;  4JXJ A;  1VD2 A;  2FO5 A;  1KFV A;  2AYN A;  3PZD A;  3MJW A;  2F7D A;  3TEX A;  2PPH A;  3HHY A;  3LXS A;  1WGD A;  3GP1 A;  1TS2 A;  2NQG A;  1MHX A;  3VTV A;  2G6D A;  4RGM A;  4BBN F;  5JH5 C;  2SAK A;  1OIZ A;  2IO3 B;  3HIZ A;  1R2Y A;  3IFW B;  3PZ8 A;  5JZE B;  2EEL A;  2YJC A;  4I04 A;  4DUZ M;  1WFY A;  1VDL A;  1CSB B;  5FPW A;  5GKN A;  3GCB A;  5JI3 E;  2J52 A;  1QAO A;  1D0M A;  1F1H A;  1JRP A;  1OKS A;  4IBE A;  2R4J A;  5EJC A;  5EQT A;  3A4R A;  3QCA A;  3SHG B;  3RVX A;  4MZO A;  5MPO A;  3QSD A;  3GRU A;  2DZN B;  1AAR A;  3NWL A;  9PAP A;  2D3A A;  3J2P B;  1U9Q X;  1HEZ E;  2LVO A;  1AN8 A;  4I6N B;  2M17 A;  4NAW A;  1UD7 A;  3GQ3 A;  3SU8 X;  4NOO B;  4X65 M;  4IDI A;  3EHV A;  1YOV B;  5EZS A;  4HKZ E;  3DBL I;  2GQF A;  3ZJV A;  2F5P A;  2XNA C;  4XGA B;  4A3P A;  3OLM D;  3V62 A;  3VFD A;  3DBH B;  1Z5S B;  1ZUD 2;  3Q3M C;  3P2B A;  3U8Z A;  3ZLZ A;  4TQ1 A;  2Y6E A;  3KW9 A;  4W5B A;  1PAD A;  2C9C A;  3N20 C;  4M02 A;  3VAW A;  4JGH B;  2DEN B;  2WXQ A;  2DYM A;  1WMH B;  1K82 A;  3PRP B;  4DV3 M;  3K92 A;  3RGS A;  3GLH B;  2HCB A;  4HRS A;  2BS4 B;  3B2G A;  4GU2 A;  2LVQ D;  4W4U A;  1NVI D;  1ET6 A;  3L54 A;  2DWZ B;  4NJ6 A;  3SEB A;  3ZQ4 A;  1U5I A;  1K52 A;  5LMU M;  3KSJ A;  1WWT A;  2K6B A;  4IJF A;  4HWY A;  4IBK A;  4QOZ C;  3SFE B;  1XF5 L;  4M0W A;  1C78 A;  2LRW A;  2FCQ A;  1J7K A;  3TWL A;  1YJJ A;  1NL6 A;  2MGW A;  1EWP A;  1IN6 A;  4Z6Y A;  1UEL A;  4YVA A;  4QHT A;  5BMI A;  3AEE B;  4ANW A;  3SHF A;  4FHK A;  4N6E B;  5J94 A;  2BYT A;  2R2O A;  3BII D;  1SE4 A;  4W9C A;  3BYY B;  2K9X A;  5G2N A;  5JZE A;  3HU1 A;  1WGG A;  1TKY A;  3SDL C;  2HHH M;  1P9D U;  5LLI A;  1G4A E;  3A33 B;  1SXJ C;  3QX1 A;  2XU1 A;  2FT2 A;  3GPP A;  4ANV A;  4RGN A;  1OJL A;  1YX6 B;  1K53 A;  1ROE A;  1STF E;  5T8I A;  1XNQ M;  1JWA D;  2RDB C;  4R3D A;  4W9G A;  2K0B X;  4BKT A;  4YY3 M;  2AIM A;  2W54 A;  1DV0 A;  3H4M A;  3OVZ A;  3KFU G;  2L05 A;  4US8 A;  1JB0 F;  4P6V F;  2WDR B;  3B0A A;  4DR4 M;  3ZO5 B;  3VXW A;  2YNM D;  2ZAM A;  2F5S A;  2K3U A;  4MZS A;  4WUR A;  1QOF A;  2O25 A;  2XEP A;  2KVZ A;  2OJR A;  4OZB A;  1F52 A;  3KW5 B;  1AWD A;  3EEC A;  2PMV A;  3W9C B;  1D0K A;  4MGY E;  2XSZ D;  3U6O A;  4AXM A;  3H8B A;  3WHK A;  3U4E G;  4FA6 A;  2R0I A;  2KAJ A;  4NC6 A;  2DEN A;  1AYV A;  3UK6 A;  3I4Y A;  4AG6 A;  1WMH A;  3PGE A;  5JA7 A;  3GLH A;  4W9F A;  1E32 A;  3APC A;  3SMS A;  1QUT A;  1AYW A;  5EXT A;  3WAL A;  3FUT A;  2CB5 A;  2UYZ B;  1IN8 A;  3DWG C;  1RFK A;  3AV0 A;  2PJH A;  1HJP A;  3HGI A;  3H6N A;  1V34 A;  1GC6 A;  3SYL A;  2UXC M;  1QOG A;  5EDS A;  4JYA M;  2BB6 A;  3JSV B;  4BZA A;  3D6S A;  3JVZ X;  2HKJ A;  3DOW A;  1E7U A;  5L83 A;  4B7F A;  4M8M A;  4GH9 A;  5DYG A;  3OQC A;  2J7Q B;  2CV0 A;  1T43 A;  4LJ8 A;  4DR2 M;  2AX5 A;  3KWV A;  1UWX A;  5D6J B;  3B7Z A;  2DZJ A;  1UGM A;  4AI6 A;  1KFU L;  2BTE A;  1YUB A;  2JY8 A;  4BOU A;  2KYW A;  2BKR B;  1ENF A;  4NAM A;  3KFQ A;  1EF1 A;  1CS8 A;  2C60 A;  1AIP C;  1YQB A;  2BYF A;  2E5L M;  2O6V D;  1OFF A;  3R3M A;  3TWM A;  3VDZ A;  3WXE A;  2HXZ A;  1TGZ B;  5BMG A;  3VK7 A;  4LF7 M;  4F1I A;  1VSN A;  3FC4 A;  4M0D A;  1PFD A;  2MCN B;  1N33 M;  1JRO A;  1Y8G A;  1SE2 A;  1AIM A;  1DGJ A;  3TEY A;  1JCK B;  4DR5 M;  1MFW A;  1IBM M;  3VRA B;  1E7P B;  3L13 A;  2P5T A;  3AU5 A;  2XZF A;  2DAI A;  2AQ3 B;  2KFK A;  2Y5P A;  2LUM A;  1G8P A;  1YZB A;  2KAN A;  2VF8 A;  4A3O A;  3ZUN A;  4YYR A;  4CDF B;  3BOW A;  3IV2 A;  2HH5 A;  5BMH A;  1AUA A;  2WSC F;  4MM3 B;  3VR9 B;  3AI8 A;  1XT9 B;  3LXF A;  4JX1 C;  2CHW A;  5D94 A;  1MG4 A;  2CS4 A;  2XN9 C;  1SBB B;  4GRI A;  4II7 A;  4K7W A;  4K7C A;  4BVU C;  4LCB A;  3EUB 2;  4M9S A;  2QC8 A;  1PPP A;  3E4R A;  2F4V M;  2LBC A;  4RM8 A;  3KS4 A;  2P0R A;  2MBE A;  1TT5 B;  2QEN A;  3THG A;  3M63 B;  2CHQ A;  1GC7 A;  3R8F A;  2CR5 A;  3DVN V;  1YQ3 B;  2C7N B;  1R2Z A;  2QPA A;  1YD8 U;  2ZAN A;  4DV2 M;  4DQO C;  3AMZ A;  1FNN A;  1VLB A;  2V4I B;  2Y21 A;  4G4O A;  1DGF A;  4LGM A;  2KMA A;  2ZW1 A;  2J7Q A;  2AQ1 B;  2DYO A;  3IVF A;  4IW0 A;  3AEC B;  2L3Z A;  2DC6 A;  3P4P B;  5CHV C;  3CGW A;  3HY5 A;  3Q8F A;  1BML C;  2YJ9 A;  2RMM A;  2N1V A;  2M5Z A;  5BYQ A;  3R7R A;  1EF7 A;  2LNH C;  1E8W A;  4A20 A;  2M60 A;  1F9J A;  4QAY A;  1VRA B;  5ITX A;  2C7H A;  2BF8 B;  1T6O A;  2KQS A;  4AJW A;  3PDF A;  1I35 A;  1TH2 A;  2D7E A;  3KW6 A;  4W5W A;  2EKE C;  3S3Q A;  1Z2M A;  1G59 A;  4YWG G;  2LH0 A;  3D8B A;  3IT6 B;  1R4N B;  2E03 A;  2OUL A;  2MP2 B;  4LJ9 A;  4LJ7 A;  4DBG B;  3IFU A;  5FTL A;  4ARI A;  3UQB A;  1UKF A;  4A3V B;  1GL7 A;  2NBW B;  4R7G A;  1RAX A;  1C9F A;  2PRE A;  4TKN A;  3OJ3 A;  1YN4 A;  1NB5 A;  4G11 A;  3V6E B;  4MM3 A;  1LO5 D;  3V6C B;  2L6O A;  1IWD A;  5E6O A;  4B3S M;  1Z5B A;  1NV8 A;  1QOB A;  4GC5 A;  1QF6 A;  1JR3 D;  2J7N A;  3UZU A;  3QA8 A;  4HCN B;  1OTR B;  3DBR B;  4LK0 M;  2WNM A;  2K6Q A;  1IFY A;  2EMT A;  3BOS A;  4L78 A;  2WLB A;  2JP7 A;  3AE3 B;  1AU0 A;  2DWQ A;  5EE1 A;  5KHQ A;  1ZOY B;  3RFW A;  2QCZ A;  1PQS A;  1NI3 A;  3L17 A;  5ITR A;  2UZJ A;  2YFQ A;  3RNE C;  2BU3 A;  3ZQJ A;  2CU1 A;  1QZE A;  3RNG C;  2BTW B;  2XZU A;  5FTK A;  3U5Z B;  2KAC A;  4Q8H A;  1WJ4 A;  2KJ6 A;  2B1N A;  4E71 A;  2D5G A;  4BQV A;  4MGI E;  1UFZ A;  4A5U A;  1I4R A;  2AVW A;  1I4G A;  3PRZ A;  4NQL B;  2MRO B;  2NVU I;  4YTM B;  5KPR A;  3GPU A;  2A4Z A;  1GJS A;  1KLV A;  1T3T A;  2AHM A;  3U6E A;  4YSY B;  1IQP A;  3FUW A;  1R7R A;  3PVS A;  4W9K A;  1Q6K A;  1NY6 A;  4S0R A;  1QYR A;  2ZW0 A;  3IXS A;  2G4D B;  1KF6 B;  2WXL A;  1IM2 A;  3I9V 1;  4C4V B;  2MLB A;  3RE8 A;  1JWM D;  1J09 A;  3I04 M;  2UUA M;  1OAO C;  3QJZ A;  2MP2 A;  4ZOH C;  4DBG A;  4I8O A;  1RFA A;  2WDQ B;  2JQR B;  1KSF X;  4K7S A;  4LJP B;  3CSF A;  3AB5 A;  4KGT A;  2L0T A;  1B1Z A;  4W9D A;  2OQ4 A;  2JRH A;  1EO6 A;  3M62 B;  3T1H M;  3DDC B;  4PS7 A;  3M0E A;  2IPP B;  4LNK A;  1V5O A;  2TSS A;  4XZX A;  3ERV A;  2GBK A;  2RSU A;  3V6E A;  1NHG C;  4H2A A;  4ITK A;  3V6C A;  2X8X X;  3SC3 A;  1GAQ B;  3SAT A;  2XLJ A;  3MOR A;  2C99 A;  2DCD A;  2DI0 A;  2CHZ A;  2L32 A;  4ANU A;  3N30 A;  2KHH A;  4LNO A;  2ZCB A;  1PVJ A;  2VII A;  1OTR A;  3BIN A;  4KSL C;  2H7J A;  1NYQ A;  1FFU A;  2L83 A;  1U9X A;  2RDG A;  2QMT A;  1ZMW A;  2WWZ A;  1YT7 A;  2KZU A;  3L08 A;  4NJ7 A;  1FNU A;  4MAC A;  4GEW A;  1TGU A;  4UN2 B;  3WAO A;  3F5V A;  1WX7 A;  3JYU A;  3BPF A;  2BTW A;  3U5Z A;  4KT0 F;  2J42 A;  4NRV A;  4MGZ E;  4G3O A;  3PW3 A;  3PNR A;  3LMM A;  3GLG B;  3R7Q A;  1K51 A;  4L4U A;  1KH0 A;  4WAF A;  2WS3 B;  3LJ3 A;  2PIA A;  5D7G A;  4DV0 M;  2JWZ A;  4CJ6 A;  1PPN A;  1MI0 A;  4P16 A;  3DBH I;  1GB1 A;  2W55 A;  3C9P A;  2DX5 B;  2KLC A;  1C3T A;  1QDR A;  2D11 A;  2C5L C;  1ZQ9 A;  1THE A;  1I7H A;  2JX5 A;  2N7J A;  2DJF B;  1Q39 A;  3H7P B;  3P5X A;  1N61 A;  4C4V A;  1AU3 A;  2L7H A;  1MHH E;  3OJ4 B;  4Q7J A;  5FLX S;  4YYV A;  1IY1 A;  1P98 A;  2G45 B;  4C56 C;  3PT2 B;  1LFD A;  4ZYS A;  3MK6 A;  3Q3F A;  2N7E A;  1UBQ A;  1PGX A;  1V97 A;  3AE5 B;  1JR3 E;  2KLG A;  1I4P A;  2ZZP B;  2CJN A;  1PGB A;  3J7B A;  3B08 A;  2M0X A;  2XF3 A;  2G9H D;  2GBJ A;  2V0G A;  2CP8 A;  1NDD A;  5F02 A;  1ZP0 B;  3AE7 B;  4G0N B;  2LXA A;  3HUI A;  3JW0 X;  1N5W A;  3DHG C;  4HDQ A;  3KX1 A;  1QZM A;  3GZN I;  2BS2 B;  5H8Y E;  3KDS E;  3FUX A;  1TS5 A;  1A5R A;  3Q69 A;  4IC7 B;  3MC9 A;  3ZDT A;  1JQP A;  4AQY M;  2CEA A;  3CWI A;  1I94 M;  2W3R A;  2ZNV C;  5EE0 A;  1XLO A;  4AKG A;  2RDH A;  4AJY B;  1F77 A;  2KXE A;  1BT0 A;  3H7S A;  3VVW B;  4GUA A;  1JWS D;  4E74 A;  3W67 A;  3U6S A;  2G3Q B;  3K9O A;  4G4R A;  3WAN A;  4ZHO A;  1JW9 D;  1ZMV A;  3Q8X A;  1SXJ B;  2VF7 A;  1LV7 A;  3U7D A;  5HFY A;  4P1C C;  3GLG A;  1EM7 A;  1EWO A;  1Z5C A;  1UGJ A;  1J7A A;  1AU2 A;  2INP E;  1W5S A;  1PJI A;  2WU2 B;  2R46 A;  2KJH B;  4CIS A;  2QZ4 A;  1IY2 A;  5EXX A;  4HLQ A;  1DGG A;  4GOC A;  1HQY E;  3GLF B;  1FCC C;  3KUD B;  3X23 A;  2L7I A;  4IJE A;  2L4E A;  4MH8 A;  3PZ7 A;  3ZH9 B;  4B0E A;  4CGY B;  2DHY A;  4K0K M;  2HD5 B;  1E9R A;  3BCN A;  3GLI E;  5DFL A;  4ANX A;  4NNJ B;  3H7P A;  1WR1 B;  2LHE A;  1GAB A;  3AEA B;  2I7N A;  1FIQ A;  4PYZ A;  3U61 B;  4TQ0 A;  3KP0 E;  1L0V B;  4P17 A;  1TR8 A;  2DAG A;  1V5T A;  3H7D A;  3KH0 A;  2YJ8 A;  2WP9 B;  1F4I A;  2JZ0 A;  2UU7 A;  3B89 A;  3SBJ A;  2BWE A;  5HI1 A;  1XHB A;  3DQV A;  4LJA A;  2MX2 A;  3J81 S;  4CHK A;  4YYS A;  4RF0 A;  3GS2 A;  4BBN C;  4Y28 F;  3AOE C;  3SAW A;  2WX1 A;  1P1A A;  3AXC A;  3PHW B;  2LGY A;  4BS6 A;  1NJG A;  2CHG A;  3L28 A;  4J6I A;  2R6F A;  4KZ0 A;  1XO3 A;  3WXG A;  3NHE B;  3MMP A;  1T0R C;  1CTE A;  4LJ5 A;  2I7P A;  2J0M A;  2FUH B;  1ZIV A;  2RPV A;  2LGI A;  4TSS A;  2HL7 A;  1A6R A;  2CE7 A;  2C9O A;  5C1B A;  4PP1 A;  5AUK A;  2M1M A;  3ABV B;  3ZIM A;  3ZVV A;  4LFA M;  3MHV C;  4OEL A;  2MBO A;  2PNS A;  1TTE A;  1TIF A;  3PBH A;  2DWN A;  3SR6 A;  3I63 C;  3QIJ A;  2G3Q A;  2O2V B;  4HRO A;  3UF8 A;  1BY8 A;  1HZ5 A;  1Y4H A;  3NVV A;  1T0Y A;  3ZNG C;  4JI6 M;  1SXJ A;  1P7F A;  1KLU D;  3EFC A;  4NJC A;  5FR6 A;  1FO4 A;  2BBC A;  3RZF A;  1FMA D;  1R7S A;  3H9D A;  1ME4 A;  2DOS A;  4WH4 A;  1WJ7 A;  2UXD M;  1FXT B;  2AU1 A;  3T9L A;  4K7U A;  3MTN B;  4LGY A;  3U2S C;  2WU5 B;  4FJV B;  4FXC A;  2GBM A;  2QQ8 A;  4IBC A;  4XBO A;  2XU3 A;  4R71 A;  2E3T A;  1E94 E;  3GLF A;  4BS5 A;  1ITO A;  3QWL A;  1WIV A;  1XMO M;  3BK2 A;  2LHC A;  2HE7 A;  5JI2 E;  4WW0 A;  2IGD A;  3NS8 A;  4S17 A;  1IGC A;  2Z8Y M;  2K8C A;  3B21 A;  3P63 A;  2MR9 A;  2MQJ A;  2E01 A;  1WR1 A;  3KKU A;  3U6Q A;  3FRH A;  3N9Y C;  5LXI B;  5H92 C;  1GOZ A;  1Q3C A;  4Z8X A;  2BS3 B;  4AQ7 A;  3AE9 B;  3HM6 X;  3DHH C;  3NBX X;  4LF5 M;  3Q3N C;  4LF4 M;  3JAM S;  1GG3 A;  4EIW A;  3P1M A;  3VHT C;  1YAL A;  4IBJ A;  1D3Z A;  2BWB A;  4YYU A;  1S4V A;  2LVP C;  1WGR A;  2BYE A;  1IYF A;  1DOI A;  3GOE A;  4DHZ B;  1V92 A;  1PUT A;  2HWK A;  3SAV A;  1Y08 A;  1XLN A;  4F8C B;  3K24 A;  1MHW A;  1C77 A;  3L10 B;  4ZRI A;  3NHE A;  3FTC A;  4IG7 B;  3F75 A;  3PTF C;  4DV7 M;  1RM6 C;  3H1U A;  4BAX A;  2JXN A;  2FID A;  2G8E A;  2KD0 A;  4PS3 A;  3U6L A;  2XU5 A;  2RGH A;  2YJB A;  1XXH E;  2UXB M;  2Z84 A;  5EF4 A;  2EKI A;  2KDB A;  2N35 A;  4A6Q A;  3A9K B;  2ZJD A;  1V8C A;  4J3O D;  2MJD A;  2BGF A;  2N9K A;  1EUV B;  3HZJ A;  1E9S A;  1C79 A;  4B6W A;  3SD5 A;  3B2F A;  3OVX A;  3A1Q B;  1TKG A;  2QEJ C;  2AS8 A;  1FEH A;  2D7G A;  2O2V A;  4NZL B;  3ZXV A;  2NTS A;  4TUU A;  4FJC A;  2V1C A;  4HWI B;  1WGH A;  1D6E C;  3IOQ A;  1I4W A;  4US9 A;  1QAM A;  2N9X A;  1R4N I;  4DHJ D;  4DMX A;  3QHT A;  4DXG A;  1WE6 A;  2A5U A;  3A98 B;  1QMY A;  3ZDM C;  4XWT A;  3KOY E;  3MTN A;  3ENE A;  2FNJ B;  1HZ6 A;  1SP4 B;  3K1J A;  4G4N A;  4L8R C;  1DF0 A;  4HEO A;  1MS6 A;  1EF5 A;  1GJT A;  1NV9 A;  4D82 A;  4MSM B;  1MX0 A;  1VEK A;  5L8R F;  5BYR A;  3UGB B;  2MJE A;  2LMC A;  4FIP A;  2KC1 A;  2R4E A;  1QAN A;  4CDE B;  2M19 A;  2J0K A;  2NS5 A;  3EFU A;  2BNK A;  3UIO B;  4IBI A;  3DBR I;  3PRM B;  1H6U A;  4WP2 A;  2EA0 A;  1PPD A;  5TSS A;  3BVG A;  1WI0 A;  3L29 A;  4JI5 M;  4HJG E;  2K0P A;  3B74 A;  1Q02 A;  1TZO A;  2JA2 A;  2XK5 B;  5EZQ A;  5C18 A;  3VFK A;  1JQ4 A;  3ALB A;  3WAP A;  2OZ2 A;  3HJS A;  4IBD A;  3K8Z A;  1BQI A;  1A5T A;  2BJV A;  1S1Q B;  3HVZ A;  2WZJ A;  3AKZ A;  4FAD A;  1AU4 A;  4X6J A;  1I4X A;  3AE8 B;  2PLP A;  2DHR A;  3J80 S;  4ZRK A;  2IO1 B;  1N32 M;  4OVV A;  3TIX A;  2M56 B;  2OED A;  3U6M A;  1DOX A;  5D3D A;  3A9K A;  4FCW A;  2KNZ A;  3TE6 A;  3UIP B;  3ZNI D;  5C3J B;  4JI8 M;  5DPT A;  1ZPS A;  3LYY A;  1KOT A;  1EWL A;  3RT3 B;  1WJN A;  4JLC A;  3K8U A;  2JWS A;  1ORY B;  4DV4 M;  1L0Y B;  3CTW B;  1ZGU B;  3WHL A;  2YLM A;  2LRU A;  5CHV A;  3VDU A;  1KYI A;  2V9H A;  4I05 A;  1GVN A;  3GE3 C;  3AM9 A;  2LAS A;  3N32 A;  1C76 A;  3KUC B;  2WSF F;  3PRP A;  3KVW A;  3O65 B;  5H37 D;  2KN5 A;  1R4M B;  1D0L A;  4MSQ B;  3TEW A;  1E10 A;  1U9V A;  3RMK C;  2JZP A;  4EE2 A;  2BW2 A;  1POP A;  3UGJ A;  2JU6 X;  3V05 A;  2K39 A;  4C80 A;  1TF0 B;  4OX9 M;  4BB9 A;  1FFV A;  3QT4 A;  1IXS B;  1NO1 A;  4LDT D;  2DWL A;  4M9Z A;  2VZK D;  3ZNZ B;  4WAA A;  1X1M A;  1YN3 A;  5C23 A;  5LXH A;  2JRI B;  1HTQ A;  1IXR C;  1MJG M;  2QP9 X;  3CF6 E;  3S2A A;  4C7Y A;  4XE0 A;  3PRM A;  4S12 A;  3SAU A;  2FQ9 A;  4D8I A;  2PE9 A;  3MP9 A;  2BT6 A;  4BKS D;  2OOA A;  1LXD A;  2XK5 A;  1P3Q Q;  2V6Z M;  5G5H A;  3NY5 A;  3QYB A;  3VDP A;  1OAI A;  4IUM B;  1WRD B;  2IND C;  1SG9 A;  2AYO B;  1XXG A;  4DV6 M;  1WXS A;  5FR3 A;  3H4J A;  2YEP F;  2VH1 A;  2DAK A;  2QSF X;  1M6D A;  2V1Y A;  3KVF B;  4GHA A;  1HT2 E;  2RD0 A;  1D2N A;  2OHF A;  2FUD A;  3EIE A;  1C4A A;  4FN2 A;  3AJI B;  1LTM A;  1ZAE A;  1FNV A;  3TSS A;  2LVQ A;  3I3T B;  3S3R A;  2E6X A;  2FIF A;  1SIJ A;  3FIL B;  1XD3 B;  5FK9 C;  3RZW C;  2M0A A;  4LJ6 A;  4ANR A;  3KP1 E;  3HX3 A;  4NXN M;  1L6V A;  2BDZ A;  1WZ0 A;  2GLS A;  1DYQ A;  3QAU A;  2L8J A;  3LCV B;  4ZRP A;  3AUL A;  5TR5 A;  4XR7 A;  1IBK M;  1D5X C;  3EC8 A;  5DPS A;  3O65 A;  4FJZ A;  1NB3 A;  4YYW A;  5AZG A;  2ZTD A;  4KZC A;  4DR6 M;  1QUS A;  2ON8 A;  1K8R B;  1ZDX A;  2O5R A;  5C2T B;  5D2M B;  5JHA A;  4HCP B;  3E21 A;  2CJO A;  3U8E A;  3JSV A;  4JI1 M;  1XLP A;  3UQA A;  4BOQ A;  2JRI A;  3GRY A;  1QLB B;  1XB2 B;  4AG5 A;  1V33 A;  2K1F A;  2N1W A;  4HK2 A;  1DGH B;  1IBX B;  1ICF A;  1HUC B;  1IY0 A;  3FKY A;  2WYQ A;  4D2K A;  2G8L A;  2ARY A;  2MH8 A;  4FHJ A;  1PJS A;  2KC2 A;  3HD3 A;  3DZD A;  2C9W B;  1L2B A;  4NY0 A;  2XBB C;  5CTR C;  4HPM B;  4P7I A;  3P42 A;  4IKG A;  3VR8 B;  4LF8 M;  1QXP A;  1F29 A;  2QDF A;  1NQC A;  4A8X C;  2KMC A;  1V81 A;  4IUM A;  4IIW A;  4D81 A;  4ZYN A;  4GKJ M;  5C1Z A;  3SFD B;  2K47 A;  1MPE A;  2XSZ A;  2AYO A;  3AED B;  2Z4R A;  1E6E B;  2ZNV B;  3FTE A;  4YTN B;  4BPV A;  1YQ4 B;  2N9E B;  2DKL A;  3PSE B;  2A5Y B;  3I57 A;  1K50 A;  4II2 B;  1JML A;  3MHS A;  1IUE A;  3A9J B;  2NQA A;  4DK5 A;  1TH3 A;  3BXW A;  1EWY C;  2Y0T A;  1SIF A;  1YJI A;  1CB5 A;  3B9P A;  3L26 A;  3Q8E A;  3C3E A;  1SE3 A;  4Q8G A;  2V3S A;  3I3T A;  2M8S A;  2YVC A;  3BBZ A;  1GNU A;  2CHV A;  3UI3 A;  4ACF A;  2N9P C;  1NJF A;  3C0R B;  1T3Q A;  2WXJ A;  1L2C A;  2FTD A;  3L0W B;  1YJ1 A;  3BVM A;  2Z8L A;  4EZL A;  3ETR A;  4DWF A;  2AGA A;  1Q3B A;  1P7E A;  3W1S C;  4DXA B;  4D8E A;  3TWK A;  4GXB A;  5DCN A;  1SXT A;  4DR1 M;  2ACZ B;  2AL6 A;  3R2T A;  3QAQ A;  4LJ4 A;  1L1Z A;  3Q3O C;  1EU4 A;  4HEA 1;  3W5U B;  4DV5 M;  1NLJ A;  2HDE A;  3MC8 A;  2KWD A;  5JXV A;  1ACC A;  3DHI C;  4M01 A;  4ITQ A;  2KOX A;  2ZPN A;  3ZRF A;  1JWB D;  3RPF C;  1V6E A;  3HK0 A;  3C19 A;  5CHT A;  5CHW A;  3V76 A;  1M94 A;  1UH6 A;  1C4P A;  3ZYY X;  1CJE A;  4MGH A;  3AEF B;  3Q14 C;  1UF0 A;  3N1Z C;  2CWB A;  1WSP A;  2GRI A;  4IBF A;  3PLU A;  1XEE A;  3SYK A;  2WXP A;  3R9X B;  1IBX A;  1DGH A;  3CF0 A;  3OWE B;  3P4S B;  4I07 A;  3LCU A;  2LGX A;  4KSK C;  4LZZ A;  3QQ8 B;  5IN7 A;  4P6E A;  4EEW A;  4C00 A;  4D8B A;  4DXF A;  2KWU B;  2RKO A;  1WYW B;  3JR5 A;  4D80 A;  1D5Z C;  2I1K A;  4C7Z A;  1QT9 A;  4JN6 A;  3ZRC A;  2DZI A;  1XKG A;  4YL8 A;  2LFI A;  4PD2 A;  4B08 A;  4AKH A;  1E9M A;  3Q3J A;  3U52 E;  2KEB A;  1YMH E;  2Z7J A;  3KWL A;  1OQQ A;  3PSE A;  6PAD A;  3I06 A;  3HU2 A;  2LGS A;  1G3I A;  4EKU A;  1BP4 A;  2FRA A;  4RKX A;  1W5T A;  2R65 A;  2CU3 A;  2KFJ A;  4CZW A;  3A9J A;  4N59 A;  1V1P B;  3PVL A;  2O6X A;  3VTW A;  3U6D A;  4B7H A;  5E6N A;  3GRR A;  2L00 B;  3PXG A;  4JIO U;  2WHI A;  4L15 A;  3BYT B;  3VKH A;  1MVK A;  4PP2 E;  3MHZ A;  3BC3 A;  5DNY A;  2ZTC A;  4L1B A;  3A42 A;  1CJL A;  4L6V 6;  2F5O A;  1PJJ A;  1RRB A;  2HHN A;  3NS1 A;  4ZHP A;  4L2Y A;  4K3B A;  2DC8 A;  1XNR M;  2J4X A;  2J53 A;  2R9N A;  1KM7 A;  3CIR B;  1L7Y A;  4ZPX A;  1MDW A;  4AKI A;  2APL A;  2DNF A;  3GB1 A;  3FTD A;  1Y8R C;  2KZR A;  1Q1O A;  1VZ7 A;  1P3Q U;  2UWQ A;  1WF9 A;  4OZC A;  2PKO A;  2BQQ A;  3A45 A;  1VZ8 A;  2DVW B;  2LJ5 A;  2OOB B;  2FCM A;  2YQZ A;  3ECI A;  3VRB B;  4TMA B;  3TCA A;  1XQQ A;  4LZJ A;  2DAM A;  2RGF A;  4KDL B;  4FD2 A;  1L6U A;  2KMM A;  3VH4 B;  3AOE A;  3QAR A;  3HHM A;  1HNW M;  1TTN A;  2MH7 A;  1TY0 A;  5GXG B;  1E0Z A;  2IBI B;  2ZBK B;  4HL4 A;  1JRU A;  1AYU A;  4AXL A;  3FKE A;  5KHO A;  4X62 M;  2EO2 A;  2JUJ A;  1WZ3 A;  3DFZ A;  3RN9 C;  3TL4 X;  3GLI B;  1J0G A;  2JXT A;  2FYE A;  1NBF C;  2ZM6 M;  4B3T M;  1DGB A;  1FH0 A;  2DJG B;  4ZDV A;  1ME3 A;  1TU6 A;  2R9C A;  3VLF B;  2D3G A;  2IGG A;  5HG2 A;  2Y3A A;  3VQI A;  2L2D A;  2F1G A;  1E8Y A;  4ZTB A;  7PCK A;  2HAK A;  5EP3 A;  3P5W A;  4PK1 A;  1BGO A;  3SFZ A;  1E8Z A;  2KTF A;  4DUY M;  2IPK D;  1QOA A;  1L0X B;  3UIN B;  1DEU A;  3C8Y A;  2GB1 A;  2PE6 B;  4W9J A;  1J7B A;  1JR3 A;  1V1P A;  1WJ6 A;  4QRX A;  3PS6 A;  5A2Q S;  5CVO B;  2KVR A;  1J7C A;  2LGD A;  2JYT A;  4REZ A;  1QQW A;  1L2D A;  1EWM A;  2XGN A;  1J5E M;  1VDD A;  4AUQ C;  4B9K A;  2L52 A;  4FWH A;  4HPL B;  4NSO B;  5FTN A;  3RCZ A;  1VJV A;  1WYG A;  2IY1 B;  2ASQ A;  2WXK A;  1CMX B;  2KKC A;  4XC2 A;  2B1M A;  2DC9 A;  5EP2 A;  3IAM 1;  2INN E;  3AV8 A;  3KQ4 A;  2N0S B;  1RWS A;  2H5X A;  4BOS A;  4FW9 A;  3FUV A;  2OP3 A;  1QDT A;  4A55 A;  4GMQ A;  1GUA B;  2NMQ A;  2NR2 A;  1ZCM A;  5CHF A;  2Y0Q A;  1FRR A;  2YR0 A;  3KYD D;  4KKI A;  2XFS A;  4X66 M;  1S3S A;  2H88 B;  5KO3 A;  1AW7 A;  1HT1 E;  4FWG A;  3APF A;  1N34 M;  3GP7 A;  1CZP A;  1PYW D;  3M95 A;  3N1X C;  1OIP A;  1QOL A;  4IWP A;  2K25 A;  3N3K B;  3HJ8 A;  3ZUA A;  3DWM A;  2AUZ A;  5LNK 1;  2DZK A;  4B3M M;  1OFH A;  2J5Y A;  2R62 A;  2F5Q A;  1V1O A;  3K9M A;  4FWD A;  1L8Q A;  3PO0 A;  4RCO A;  3T6P A;  3HHZ A;  1Z5A A;  2DZZ A;  4PAD A;  4I81 A;  2G7Y A;  3KOX E;  2B76 B;  7CAT A;  2IBI A;  4W5C A;  2JSV X;  4MH0 E;  2X4A A;  1D5M C;  1LQB A;  4LLG M;  4QRG A;  2CRU A;  3B7Q A;  2G4S A;  4G50 A;  1UM8 A;  2LXE A;  1X37 A;  2NPT B;  4DDG D;  3GLI A;  2P7U A;  2WXO A;  4KVG B;  1F2R I;  1UZX B;  3IEJ A;  4MJS B;  4B0M A;  2C7M B;  1ZXI A;  3ZW3 A;  3H6S A;  3AE4 B;  3NZU A;  4RH6 A;  3DF0 A;  2ZEQ A;  1IXZ A;  3PLV A;  3IHP C;  2KQ7 A;  4HLE A;  2KNV A;  4CDC B;  3NUH B;  3GPY A;  3OG5 A;  3PT2 A;  1YSY A;  4B3R M;  3QYE A;  2D7H A;  2ERC A;  3IG5 A;  1YNT E;  2E02 A;  3GLG E;  1EIJ A;  5IKC M;  3SMP A;  1WXQ A;  2L7R A;  4HKQ A;  2NQD B;  5K16 A;  1DO2 A;  3IBE A;  3KWZ A;  1WHC A;  4XGI A;  1KLG D;  3IMA A;  3RVW A;  1WXM A;  1CQD A;  1HXY D;  3GE8 C;  1PE6 A;  1X9Y A;  3DVN U;  4AZF A;  3N3G A;  1EE8 A;  1XXH B;  3RNC C;  2PEA A;  2XU4 A;  2KTR B;  1STE A;  2R9O A;  2INC C;  2KQ4 X;  4IM3 A;  4KHP M;  1U9W A;  1KRH A;  3VUY A;  2DNA A;  1QAQ A;  1CPJ A;  4LFC M;  1D4B A;  2CFO A;  1KJT A;  3ZCB B;  4GLS C;  1V49 A;  3RVV A;  4F2L A;  1E8X A;  3K2L A;  3DVG X;  3N3K A;  3JR4 A;  2GI9 A;  2HWJ A;  1CQV A;  4JI4 M;  1DOY A;  3P4R B;  1LGR A;  4BOP A;  4QNR A;  3H8H A;  2MEK A;  5HHD G;  3W1Y A;  2QHO B;  4QOS A;  2JNH A;  4W9L A;  3I5J C;  2SEB D;  4LF6 M;  1YIW A;  4IM0 A;  3EGR A;  4NL4 H;  1NI2 A;  1NHW C;  3QJ3 A;  1T0S C;  2NPT A;  2WXH A;  3Q8C A;  4WWO A;  5J17 A;  2PAD A;  2ICI A;  3HJQ A;  2BPS A;  2DCB A;  1JWU D;  2JF5 A;  4MJS A;  4YSZ B;  3DPD A;  2HD5 A;  3AE2 B;  2QJL A;  2HTH A;  1BUI C;  3ZJT A;  2W9N A;  4RY2 A;  5DPW A;  4GB9 A;  2IO0 B;  3P4Q B;  2N9L A;  3R8B A;  3U61 A;  4URK A;  1SE9 A;  1WGL A;  2XFT A;  1SXJ E;  4EZJ A;  4G6Z A;  1GB4 A;  4I6L B;  1F2A A;  1N63 A;  2MW5 A;  2ZCC A;  2WGS A;  1EFU B;  3KLS X;  3AH7 A;  2EUC A;  3LQR A;  1CV8 A;  3N1Y C;  1T5X D;  3GLF E;  1GO5 A;  5BPV A;  1R5L A;  2LI5 A;  3PHW A;  4M0W B;  1NY5 A;  4LCD E;  5E6J A;  2OPF A;  4LTU A;  4PDG A;  3AE1 B;  2DXI A;  4RGT A;  1XXH A;  2GHU A;  1IBL M;  3IEC A;  2KTR A; 
#chains in the Genus database with same CATH homology
 5ITU A;  4LF9 M;  5BR8 M;  3BWU D;  3AE6 B;  2LHD A;  2JYE A;  4MGK E;  2NTT A;  1ZDV A;  2BJW A;  4ZRQ A;  4OHJ A;  3FYD A;  1SEB D;  3L2A A;  3W5V B;  3Q8A A;  3HKP A;  2NQ8 C;  1MU5 A;  4RFB A;  4GDK B;  3HHX A;  3W0L B;  1GL6 A;  4MT5 A;  1N78 A;  3Q8B A;  2QCU A;  4LRS A;  4GDL B;  1YE9 A;  1YN5 A;  3A46 A;  4YHH M;  1TS3 A;  2PVG C;  3I51 A;  4RF1 A;  3DA1 A;  4KO8 A;  4JWU C;  3WCQ A;  2FNA A;  5EP4 A;  2WXM A;  1VDV A;  1PDX A;  1PGA A;  2WXI A;  1N5X A;  1UNS A;  3ZJU A;  1KFY B;  1Q10 A;  4FCT A;  2CUZ A;  4CQN A;  1GLN A;  1R6B X;  2JWU A;  2V3P A;  4KGR A;  4GIT A;  2K22 A;  4RGO S;  4YXD B;  2W82 A;  1VJK A;  1QVR A;  3NVY A;  4MI7 A;  1FRD A;  2LEK A;  3J27 B;  1TH4 A;  3FUU A;  5ITT A;  2J7O A;  3KS8 A;  4JI2 M;  3KSX A;  3IG8 A;  1GPX A;  5KQ8 A;  4UDU C;  1C1K A;  1NSF A;  4A9A A;  2KRU A;  5KQD A;  3U7Z A;  4M9X A;  4FVM A;  4QNM A;  1N62 A;  3BVZ A;  1N36 M;  3ZNH A;  3FD9 A;  5IZ7 D;  3KOZ E;  4WQM A;  1TS4 A;  1BXT A;  4USA A;  4BLC A;  3W31 A;  3EA6 A;  2R45 A;  2F5N A;  3W1S A;  3TMP A;  3E56 A;  3PNV A;  1XCQ L;  2JTC A;  5EE3 A;  4GKK M;  2X8A A;  1SB3 C;  3ZGZ A;  1HR0 M;  2KRK A;  1FNW A;  1QQR A;  1Z6T A;  4OVZ B;  4BOZ A;  2FFJ A;  5ITY A;  3ILK A;  1DKI A;  1FJG M;  4AS1 A;  1HQC A;  1XMQ M;  1Y56 A;  2ONQ A;  4NSR A;  2K5P A;  4HXD B;  5EE9 A;  2VZK B;  3AL0 C;  2R61 A;  3NBI A;  1K3X A;  8CAT A;  4JPS A;  1G41 A;  1HNZ M;  3BK1 A;  3GO8 A;  3ZC7 B;  4QHS A;  1N77 A;  2X49 A;  2UUC M;  3TQS A;  3NVW A;  3TRK A;  3U6C A;  3L25 A;  4FCV A;  4LFB M;  1HNX M;  2I2Y A;  1N75 A;  2WXF A;  1AYF A;  5DYI A;  4XDC A;  2HTM E;  2V3N A;  3U60 B;  4WIP A;  3T3O A;  5EXS A;  3HWS A;  2L09 A;  3UJN A;  2QSD A;  3MTV A;  3RFZ B;  3HHW A;  4OVZ A;  3J9C A;  2FOI C;  4TUW A;  3GQ5 A;  3M6A A;  3FIL A;  5LMN M;  4IBB A;  1QIL A;  3T1Y M;  2QBY B;  4NXM M;  3IT4 B;  1Z59 A;  4I5S A;  1EWC A;  3SAR A;  1SJE D;  1PM5 A;  3TPZ A;  2C96 A;  2KZS A;  1TDH A;  5ITX E;  4GIP A;  4LG2 A;  4OW0 A;  4KLN A;  2CV2 A;  1HA5 A;  3BZD B;  1IGD A;  2VQF M;  4DR3 M;  5G5G A;  1K3W A;  2H89 B;  1T6B X;  2UUB M;  3LVV A;  3TEZ A;  3NRZ A;  2V1U A;  4NRW A;  3KXE C;  2DZO B;  5ITQ A;  1I4Q A;  4I4L A;  4AW4 A;  3UMM A;  3U60 A;  3PHX A;  1XC8 A;  4YSX B;  2QIL A;  2CV1 A;  3C58 A;  2H1R A;  2DBY A;  4CHT B;  1TJE A;  1TYG B;  1F2R C;  4XWW A;  3NZ3 A;  4JI7 M;  1CK1 A;  2R18 A;  4GC9 A;  5IWA M;  3J7A S;  1IN5 A;  4DR7 M;  5AUI A;  3C0R A;  2QBY A;  4OU7 A;  1WRI A;  2ZAO A;  5FTM A;  1XLQ A;  3BB7 A;  1TKE A;  1GKI A;  4PDI A;  2IJ0 A;  3W2D A;  1OFI A;  2G5G X;  2AQ2 B;  2WXR A;  5FKA C;  2J7Q C;  1A70 A;  5IRE B;  4XDD A;  2Y5C A;  4KX6 B;  2L1A A;  1SSN A;  2C98 A;  1TDZ A;  1ESF A;  2Y20 A;  1ZXH A;  3T38 A;  2DWM A;  1VR9 A;  2PTL A;  1N60 A;  3SAS A;  2DLB A;  5BYS A;  3RGP A;  1SJH D;  5F3W A;  2KW0 A;  2Q2E B;  4IOI E;  2WXN A;  1NEK B;  2BB5 A;  3LB8 C;  5E26 A;  3L27 A;  3FAH A;  2Z3X A;  3T15 A;  4BBA A;  4A90 A;  3L4P A;  3NVZ A;  1FD6 A;  3D8L A;  1ET9 A;  4JWS C;  1DO0 A;  1I4H A;  1UWM A;  1ZE3 D;  3KOW E;  5FTJ A;  2KN4 A;  5D3I B;  3HU3 A;  1XCT L;  3I4V A;  4DV1 M;  3PNY A;  3AOG A;  3W0F A;  1SXJ D;  1VZ6 A;  4JI0 M;  2QIE B;  4GHL A;  1FXA A;  5I4D A;  1QKZ A;  2Q5W D;  4ARC A;  3VK8 A;  1NVM A;  4YTP B;  2KA6 B;  3URY A;  5KPZ A;  5EP1 A;  4G4Q A;  3AN1 A;  1TY2 A;  2W3S A;  4L23 A;  4N58 A;  2KDM A;  2G1E A;  4JI3 M;  5KPT A;  2PW9 A;  3LQQ A;  2WXG A;  3HVD A;  4IP3 A;  1HQR D;  1UUP A;  2FUG 1;  2VQE M;  1IN4 A;  3B9J A;  1NEN B;  4KKJ A;  3MFG A;  3U6P A;  3VKG A;  1L4D B;  2YEP B;  1SF0 A;  1L5P A;  4O1N A;  1C4C A;  1L1T A;  2IGH A;  2X38 A;  3PHU A;  2XH9 A;  4WWM A;  4LY6 A;  4YT0 B;  2Z4S A;  2I38 A;  3T3N A;  2UU9 M;  3W30 A;  3MP2 A;  1L4Z B;  4JE3 B;  4B7G A;  1JAL A;  3LVW A;  1B9R A;  3IAS 1;  2LJI A;  3DOA A;  1M4V A;  3AFH A;  3V3X A;  2WQY B;  2C5R A;  4LRT A;  1JQJ C;  1KTK A;  1WGK A;  3EIH A;  4KGS A;  2RGO A;  3R2I A;  3E9S A;  1EU3 A;  3GPX A;  4IBG A;  4X64 M;  1FM0 D;  3PFI A;  5FSW A;  2IDY A;  3TUO A;  3M7G A;  4JV5 M;  4PT5 A;  1NNJ A;  1NYR A;  3RNV A;  2MJ3 A;  3GQ4 A;  1FCL A;  4OZA A;  3BY4 A;  4L16 A;  2FBW B;  4NAW B;  1RYJ A;  2LWX A;  4KOD A;  5EXP A;  2PVO D;  2FE8 A;  3O13 A;  1F0Z A;  1NNU C;  3FTF A;  4RNA A;  3CF2 A;  3AEG B;  4Q2J A;  5IT9 S;  3BBA A;  1IN7 A;  1XWI A;  3MC0 B;  3OTO M;  1FXI A;  3MJ5 A;  3AEB B;  2WDV B;  3FYC A;  3HRD D;  1OQR A;  3GRV A;  4MB7 A;  4PCZ A;  4JXJ A;  1KFV A;  3TEX A;  3HHY A;  3GP1 A;  1TS2 A;  1MHX A;  4RGM A;  2SAK A;  1R2Y A;  3PZ8 A;  2EEL A;  4DUZ M;  5GKN A;  5JI3 E;  2J52 A;  1QAO A;  1JRP A;  4IBE A;  2R4J A;  5EJC A;  5EQT A;  3SHG B;  5MPO A;  3GRU A;  2DZN B;  3NWL A;  3J2P B;  1HEZ E;  1AN8 A;  3GQ3 A;  4NOO B;  4X65 M;  4IDI A;  5EZS A;  4HKZ E;  3ZJV A;  2F5P A;  2XNA C;  3VFD A;  1ZUD 2;  4TQ1 A;  2C9C A;  2WXQ A;  2DYM A;  1K82 A;  4DV3 M;  3K92 A;  3RGS A;  3GLH B;  2HCB A;  4HRS A;  2BS4 B;  3B2G A;  1NVI D;  1ET6 A;  2DWZ B;  3SEB A;  3ZQ4 A;  1K52 A;  5LMU M;  3KSJ A;  1WWT A;  4IJF A;  4IBK A;  4QOZ C;  3SFE B;  1XF5 L;  4M0W A;  1C78 A;  1J7K A;  3TWL A;  1YJJ A;  1IN6 A;  4Z6Y A;  4QHT A;  5BMI A;  3AEE B;  3SHF A;  4N6E B;  2BYT A;  3BII D;  1SE4 A;  3BYY B;  2K9X A;  5JZE A;  3HU1 A;  1TKY A;  2HHH M;  1G4A E;  1SXJ C;  3GPP A;  4RGN A;  1OJL A;  1K53 A;  1ROE A;  5T8I A;  1XNQ M;  1JWA D;  4R3D A;  4YY3 M;  2W54 A;  3H4M A;  3KFU G;  4US8 A;  4P6V F;  2WDR B;  4DR4 M;  2YNM D;  2ZAM A;  2F5S A;  2K3U A;  4WUR A;  1QOF A;  2XEP A;  4OZB A;  1AWD A;  2PMV A;  3W9C B;  4MGY E;  2XSZ D;  3U6O A;  3WHK A;  3U4E G;  2KAJ A;  3UK6 A;  3I4Y A;  4AG6 A;  3GLH A;  1E32 A;  3SMS A;  5EXT A;  3FUT A;  3DWG C;  1IN8 A;  1RFK A;  3AV0 A;  3HGI A;  1QOG A;  3SYL A;  2UXC M;  4JYA M;  2BB6 A;  2HKJ A;  4B7F A;  4GH9 A;  5DYG A;  3OQC A;  2CV0 A;  4LJ8 A;  4DR2 M;  2AX5 A;  3KWV A;  1UWX A;  4AI6 A;  2BTE A;  1YUB A;  4BOU A;  1ENF A;  4NAM A;  2E5L M;  1OFF A;  3TWM A;  5BMG A;  3VK7 A;  4LF7 M;  3FC4 A;  4M0D A;  1PFD A;  1N33 M;  1JRO A;  1SE2 A;  1DGJ A;  3TEY A;  1JCK B;  4DR5 M;  1IBM M;  3VRA B;  1E7P B;  2P5T A;  2XZF A;  2AQ3 B;  2Y5P A;  2LUM A;  1G8P A;  1YZB A;  5BMH A;  3VR9 B;  4MM3 B;  3LXF A;  4JX1 C;  2XN9 C;  1SBB B;  4GRI A;  4II7 A;  4LCB A;  3EUB 2;  4M9S A;  3E4R A;  2F4V M;  3KS4 A;  2QEN A;  3THG A;  2CHQ A;  3R8F A;  1YQ3 B;  1R2Z A;  2QPA A;  4DQO C;  2ZAN A;  4DV2 M;  3AMZ A;  1FNN A;  1VLB A;  2V4I B;  2Y21 A;  4G4O A;  1DGF A;  4LGM A;  2ZW1 A;  2J7Q A;  2AQ1 B;  2DYO A;  3AEC B;  3P4P B;  3Q8F A;  1BML C;  2RMM A;  2M5Z A;  5BYQ A;  2LNH C;  2M60 A;  1VRA B;  5ITX A;  1TH2 A;  2D7E A;  3KW6 A;  4W5W A;  1G59 A;  4YWG G;  2LH0 A;  3D8B A;  3IT6 B;  4LJ9 A;  4LJ7 A;  3IFU A;  5FTL A;  4ARI A;  1UKF A;  4A3V B;  1GL7 A;  4R7G A;  1C9F A;  1YN4 A;  1LO5 D;  2L6O A;  4B3S M;  1Z5B A;  1QOB A;  4GC5 A;  1QF6 A;  1JR3 D;  2J7N A;  3UZU A;  4LK0 M;  2WNM A;  3BOS A;  4L78 A;  2WLB A;  3AE3 B;  2DWQ A;  5EE1 A;  1ZOY B;  3RFW A;  1NI3 A;  5ITR A;  2UZJ A;  2YFQ A;  2BU3 A;  2BTW B;  2XZU A;  5FTK A;  3U5Z B;  2KAC A;  2D5G A;  4MGI E;  4A5U A;  1I4R A;  1I4G A;  4YTM B;  5KPR A;  3GPU A;  1T3T A;  2AHM A;  3U6E A;  4YSY B;  1IQP A;  3FUW A;  1R7R A;  3PVS A;  1NY6 A;  1QYR A;  2ZW0 A;  3IXS A;  1KF6 B;  2WXL A;  1IM2 A;  3I9V 1;  3RE8 A;  1JWM D;  1J09 A;  2UUA M;  4ZOH C;  4I8O A;  2WDQ B;  2JQR B;  1KSF X;  3AB5 A;  4KGT A;  1B1Z A;  2OQ4 A;  3T1H M;  3M0E A;  4XZX A;  2TSS A;  1NHG C;  4H2A A;  4ITK A;  3SC3 A;  1GAQ B;  3SAT A;  2XLJ A;  2C99 A;  2L32 A;  1PVJ A;  2VII A;  1NYQ A;  1FFU A;  2L83 A;  2RDG A;  2QMT A;  2KZU A;  1FNU A;  4MAC A;  1TGU A;  2BTW A;  3U5Z A;  2J42 A;  4NRV A;  4MGZ E;  3LMM A;  3GLG B;  1K51 A;  4L4U A;  1KH0 A;  4WAF A;  2WS3 B;  2PIA A;  5D7G A;  4DV0 M;  1MI0 A;  4P16 A;  1GB1 A;  2W55 A;  1ZQ9 A;  1I7H A;  2JX5 A;  2N7J A;  1Q39 A;  1N61 A;  2L7H A;  1MHH E;  5FLX S;  1IY1 A;  4C56 C;  4ZYS A;  3MK6 A;  1PGX A;  1V97 A;  3AE5 B;  1I4P A;  2CJN A;  1PGB A;  3J7B A;  2XF3 A;  2G9H D;  2V0G A;  1ZP0 B;  3AE7 B;  3HUI A;  1N5W A;  1QZM A;  2BS2 B;  5H8Y E;  3KDS E;  3FUX A;  1TS5 A;  3Q69 A;  4AQY M;  2CEA A;  3CWI A;  1I94 M;  2W3R A;  5EE0 A;  1XLO A;  4AKG A;  2RDH A;  1F77 A;  2KXE A;  4GUA A;  1JWS D;  3U6S A;  4G4R A;  4ZHO A;  1JW9 D;  3Q8X A;  1SXJ B;  5HFY A;  1LV7 A;  3GLG A;  1EM7 A;  1Z5C A;  1UGJ A;  1J7A A;  2INP E;  1W5S A;  1PJI A;  2WU2 B;  2R46 A;  4CIS A;  2QZ4 A;  1IY2 A;  5EXX A;  4HLQ A;  1DGG A;  1HQY E;  3GLF B;  1FCC C;  2L7I A;  4IJE A;  4MH8 A;  3PZ7 A;  3ZH9 B;  4B0E A;  4CGY B;  4K0K M;  1E9R A;  2LHE A;  3AEA B;  2I7N A;  1FIQ A;  3U61 B;  4TQ0 A;  3KP0 E;  1L0V B;  2WP9 B;  3SBJ A;  5HI1 A;  1XHB A;  4LJA A;  3J81 S;  4RF0 A;  3GS2 A;  3AOE C;  3SAW A;  1NJG A;  2CHG A;  3L28 A;  1XO3 A;  4LJ5 A;  2I7P A;  2RPV A;  2LGI A;  4TSS A;  2HL7 A;  2CE7 A;  2C9O A;  5C1B A;  5AUK A;  3ABV B;  4LFA M;  3MHV C;  2DWN A;  3SR6 A;  4HRO A;  1HZ5 A;  3NVV A;  4JI6 M;  1SXJ A;  1P7F A;  1KLU D;  1FO4 A;  4NJC A;  2BBC A;  1FMA D;  1R7S A;  2DOS A;  4WH4 A;  2UXD M;  4LGY A;  3U2S C;  2WU5 B;  4FXC A;  4IBC A;  4XBO A;  2E3T A;  1E94 E;  3GLF A;  3QWL A;  1XMO M;  3BK2 A;  5JI2 E;  4WW0 A;  2IGD A;  1IGC A;  3B21 A;  3P63 A;  3U6Q A;  3N9Y C;  5H92 C;  1GOZ A;  1Q3C A;  4Z8X A;  2BS3 B;  4AQ7 A;  3AE9 B;  4LF5 M;  4LF4 M;  3JAM S;  3P1M A;  4EIW A;  4IBJ A;  1DOI A;  1PUT A;  2HWK A;  3SAV A;  1XLN A;  1C77 A;  3FTC A;  4DV7 M;  1RM6 C;  3U6L A;  2RGH A;  2UXB M;  2Z84 A;  2EKI A;  4A6Q A;  4J3O D;  1V8C A;  2MJD A;  2N9K A;  1E9S A;  1C79 A;  3B2F A;  1TKG A;  2QEJ C;  1FEH A;  2D7G A;  4NZL B;  2NTS A;  2V1C A;  1D6E C;  1I4W A;  4US9 A;  1QAM A;  4DXG A;  3A98 B;  4XWT A;  3KOY E;  1HZ6 A;  3K1J A;  4G4N A;  4L8R C;  4D82 A;  1MX0 A;  5BYR A;  2MJE A;  2LMC A;  2R4E A;  1QAN A;  2M19 A;  2BNK A;  4IBI A;  1H6U A;  2EA0 A;  5TSS A;  3BVG A;  3L29 A;  4JI5 M;  4HJG E;  2K0P A;  1TZO A;  2JA2 A;  5EZQ A;  5C18 A;  1JQ4 A;  3HJS A;  4IBD A;  3K8Z A;  2BJV A;  3HVZ A;  3AKZ A;  1I4X A;  3AE8 B;  2PLP A;  2DHR A;  3J80 S;  1N32 M;  2M56 B;  2OED A;  3U6M A;  1DOX A;  5D3D A;  4FCW A;  3TE6 A;  5C3J B;  4JI8 M;  1ZPS A;  3LYY A;  1ORY B;  4DV4 M;  1L0Y B;  3CTW B;  3WHL A;  3VDU A;  1KYI A;  1GVN A;  3AM9 A;  1C76 A;  3PRP A;  3KVW A;  5H37 D;  3TEW A;  1E10 A;  2JZP A;  4EE2 A;  2BW2 A;  3UGJ A;  2JU6 X;  3V05 A;  4C80 A;  4OX9 M;  4BB9 A;  1FFV A;  1IXS B;  2DWL A;  4M9Z A;  2VZK D;  1YN3 A;  1IXR C;  2QP9 X;  3CF6 E;  4C7Y A;  4XE0 A;  3PRM A;  4S12 A;  3SAU A;  4D8I A;  3MP9 A;  2BT6 A;  2V6Z M;  5G5H A;  3VDP A;  1XXG A;  4DV6 M;  5FR3 A;  2YEP F;  4GHA A;  1HT2 E;  1D2N A;  2OHF A;  3EIE A;  1C4A A;  3AJI B;  1ZAE A;  1FNV A;  3TSS A;  2E6X A;  1SIJ A;  3FIL B;  5FK9 C;  2M0A A;  4LJ6 A;  3KP1 E;  4NXN M;  1L6V A;  1DYQ A;  3QAU A;  4ZRP A;  1IBK M;  1D5X C;  3O65 A;  4DR6 M;  2ON8 A;  1ZDX A;  2O5R A;  5C2T B;  2CJO A;  4JI1 M;  1XLP A;  4BOQ A;  2JRI A;  3GRY A;  1QLB B;  4AG5 A;  1IBX B;  1DGH B;  1IY0 A;  4D2K A;  2G8L A;  3DZD A;  1L2B A;  3P42 A;  4IKG A;  3VR8 B;  4LF8 M;  4A8X C;  4IUM A;  4IIW A;  4D81 A;  4GKJ M;  3SFD B;  2K47 A;  1MPE A;  2XSZ A;  3AED B;  2Z4R A;  1E6E B;  3FTE A;  4YTN B;  1YQ4 B;  2A5Y B;  3I57 A;  1K50 A;  1JML A;  1IUE A;  1TH3 A;  1EWY C;  2Y0T A;  1YJI A;  3B9P A;  3L26 A;  3Q8E A;  1SE3 A;  2CHV A;  3UI3 A;  1NJF A;  1T3Q A;  2WXJ A;  1L2C A;  3BVM A;  2Z8L A;  3ETR A;  2AGA A;  1Q3B A;  1P7E A;  4D8E A;  3TWK A;  1SXT A;  4DR1 M;  2ACZ B;  3R2T A;  4LJ4 A;  1L1Z A;  1EU4 A;  4HEA 1;  3W5U B;  4DV5 M;  2HDE A;  2KWD A;  5JXV A;  1ACC A;  4ITQ A;  1JWB D;  3RPF C;  1C4P A;  3ZYY X;  1CJE A;  4MGH A;  3AEF B;  1WSP A;  2GRI A;  4IBF A;  1XEE A;  3SYK A;  2WXP A;  3R9X B;  1IBX A;  1DGH A;  3CF0 A;  3OWE B;  3P4S B;  4LZZ A;  4D8B A;  4DXF A;  2RKO A;  3JR5 A;  4D80 A;  1D5Z C;  4C7Z A;  1QT9 A;  4JN6 A;  2LFI A;  4PD2 A;  4B08 A;  4AKH A;  1E9M A;  3U52 E;  2KEB A;  1YMH E;  2Z7J A;  3KWL A;  1OQQ A;  3PSE A;  3HU2 A;  1G3I A;  4RKX A;  1W5T A;  2R65 A;  2CU3 A;  4N59 A;  1V1P B;  3U6D A;  4B7H A;  3GRR A;  3PXG A;  4L15 A;  3BYT B;  3VKH A;  1MVK A;  3MHZ A;  5DNY A;  4L1B A;  3A42 A;  2F5O A;  1PJJ A;  3NS1 A;  4ZHP A;  4L2Y A;  1XNR M;  2J4X A;  2J53 A;  3CIR B;  4ZPX A;  4AKI A;  3GB1 A;  3FTD A;  1VZ7 A;  4OZC A;  2PKO A;  3A45 A;  1VZ8 A;  2DVW B;  2YQZ A;  3VRB B;  4TMA B;  4LZJ A;  4FD2 A;  1L6U A;  2KMM A;  3AOE A;  1HNW M;  2MH7 A;  1TY0 A;  5GXG B;  1E0Z A;  2ZBK B;  4HL4 A;  3FKE A;  4X62 M;  2EO2 A;  3DFZ A;  3TL4 X;  3GLI B;  2JXT A;  2ZM6 M;  4B3T M;  1DGB A;  3VLF B;  2IGG A;  5HG2 A;  2Y3A A;  3VQI A;  4ZTB A;  5EP3 A;  3SFZ A;  4DUY M;  2IPK D;  1QOA A;  1L0X B;  3C8Y A;  2GB1 A;  1J7B A;  1JR3 A;  1V1P A;  5A2Q S;  1J7C A;  2JYT A;  4REZ A;  1QQW A;  1L2D A;  2XGN A;  1J5E M;  1VDD A;  2L52 A;  4FWH A;  4NSO B;  5FTN A;  1WYG A;  2WXK A;  5EP2 A;  3IAM 1;  3KQ4 A;  3AV8 A;  2INN E;  2N0S B;  1RWS A;  4BOS A;  4FW9 A;  3FUV A;  4A55 A;  4GMQ A;  2NMQ A;  2Y0Q A;  1FRR A;  2YR0 A;  4KKI A;  2XFS A;  4X66 M;  1S3S A;  2H88 B;  5KO3 A;  1AW7 A;  1HT1 E;  4FWG A;  1N34 M;  3GP7 A;  1CZP A;  1PYW D;  3HJ8 A;  3DWM A;  5LNK 1;  4B3M M;  1OFH A;  2F5Q A;  2R62 A;  1V1O A;  4FWD A;  1L8Q A;  3PO0 A;  4RCO A;  3HHZ A;  1Z5A A;  4I81 A;  3KOX E;  2B76 B;  7CAT A;  2JSV X;  4MH0 E;  2X4A A;  1D5M C;  4LLG M;  1UM8 A;  2LXE A;  1X37 A;  3GLI A;  2WXO A;  1F2R I;  4B0M A;  1ZXI A;  3AE4 B;  4RH6 A;  1IXZ A;  3NUH B;  3GPY A;  3PT2 A;  1YSY A;  4B3R M;  2D7H A;  2ERC A;  3IG5 A;  1YNT E;  3SMP A;  1WXQ A;  4HKQ A;  1DO2 A;  4XGI A;  1KLG D;  1HXY D;  4AZF A;  1EE8 A;  1XXH B;  1STE A;  2KQ4 X;  4KHP M;  1KRH A;  1QAQ A;  4LFC M;  1D4B A;  2CFO A;  3ZCB B;  4GLS C;  3K2L A;  3JR4 A;  2GI9 A;  1CQV A;  4JI4 M;  1DOY A;  3P4R B;  4BOP A;  4QNR A;  3H8H A;  2MEK A;  5HHD G;  4QOS A;  2SEB D;  4LF6 M;  3EGR A;  4NL4 H;  1NHW C;  2WXH A;  3Q8C A;  2ICI A;  3HJQ A;  1JWU D;  4YSZ B;  3AE2 B;  2QJL A;  1BUI C;  3ZJT A;  3P4Q B;  2N9L A;  3R8B A;  3U61 A;  2XFT A;  1SXJ E;  4G6Z A;  1GB4 A;  1N63 A;  3KLS X;  3AH7 A;  2EUC A;  3LQR A;  1T5X D;  5BPV A;  3PHW A;  5E6J A;  2OPF A;  4LTU A;  4PDG A;  3AE1 B;  2DXI A;  4RGT A;  1XXH A;  1IBL M;  1NY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...