4QH6A

Crystal structure of cruzain with nitrile inhibitor n-(2-aminoethyl)-nalpha-benzoyl-l-phenylalaninamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Molecular Design, Synthesis and Trypanocidal Activity of Dipeptidyl Nitriles as Cruzain Inhibitors.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qh6A00
1PPDA 1GCBA 4YYRA 4QH6A 1VJVA 3WXGA 1U9QX 1YK7A 1ME4A 2E03A 1MHWA 4N4ZA 4YV8A 1ICFA 3HHIA 1EF7A 1U9WA 4YYVA 2YJCA 2IBIA 3HWNA 3IUTA 4W5CA 5F02A 4QRGA 2C0YA 3KKUA 3KWZA 4OELA 5PADA 4DMXA 2DC8A 1MDWA 1QOLA 3BOWA 2XU1A 4ZUXU 1BY8A 2NQGA 2G8JA 3V6EA 3KW9A 1PPNA 1PXVA 1NB3A 4WA6A 5A24A 2G8EA 1CQDA 1KFUL 3IOQA 4YVAA 1F2AA 4YYQA 3DF0A 1PPPA 1MS6A 1GECE 3OF8A 4PI3A 2B1MA 2PADA 1TL9A 3USVA 1CJLA 5FPWA 3MTNA 2BDLA 1ZCMA 2DC7A 2AUZA 2FO5A 3NHEA 4N79A 3WXEA 4OEMA 2NQIA 1S4VA 1AECA 2O6XA 4I07A 1CPJA 2JQFR 4YYUA 1NL6A 3BPFA 5J94A 1CSBB 4Q8HA 4MZOA 4QRXA 3KWBX 3D6SA 2DC9A 2JQGR 2B1NA 1BP4A 2DZYA 4AXMA 3OVXA 1CV8A 4FK5A 4MSXA 3IHPA 2AUXA 1X9YA 3F5VA 2HH5A 4FIPA 1PE6A 2HXZA 9PAPA 3M99A 3K8UA 4PP1A 2AYNA 3RVWA 1POPA 4RY2A 1YVBA 1AU2A 4MZSA 4AXLA 1CB5A 1F2BA 2AIMA 2FTDA 1YALA 2G7YA 1FH0A 2DJFB 2DZZA 3OF9A 3P5WA 3QJ3A 2R9FA 3LFYA 4CDCB 4CDEB 7PCKA 3OVZA 3IMAA 3KSEA 3KX1A 1XKGA 3O0UA 1CTEA 1TLOA 3H89A 2E01A 1NB5A 1DEUA 2CB5A 5CVOB 1HUCB 3PDFA 2FRQA 1BGOA 2FT2A 2FYEA 3PW3A 1KFXL 1PADA 2VHFA 3IV2A 3I3TA 3MHSA 3QT4A 3H6SA 1STFE 1K3BB 3P5UA 2YJBA 1AYWA 3BPMA 2CIOA 4BS6A 3CBKA 3HD3A 3ZUAA 1AU0A 2XU3A 3LXSA 2GHUA 1DF0A 4FJCA 3OISA 5JA7A 1ZIVA 2DJGB 2R9CA 4BSQA 4YYSA 3HHAA 3AI8A 3N3GA 3CBJA 3PNRA 3O1GA 1AYVA 2FRAA 8PCHA 1YT7A 2NQAA 4XR7A 3K24A 1SNKA 4XUIA 1U9XA 4K7CA 1MEGA 3KFQA 3H8CA 2NQDB 4BS5A 4X6IA 2DCDA 6PADA 2R6NA 4CDFB 2XU4A 2XU5A 1PCIA 3S3QA 2R9OA 2AS8A 4I04A 2OULA 1QXPA 1Y08A 4BPVA 2E00A 2P7UA 1BQIA 2G6DA 1CS8A 2AU1A 5JH3A 1QDQA 2FUDA 1VSNA 1O0EA 4CZWA 4X6HA 4X6JA 4I05A 4N8WA 1ME3A 1A6RA 1EWPA 1Y4HA 3U8EA 2DCCA 1AIMA 2YJ2A 1JQPA 2F1GA 4QBBA 3E1ZB 2E02A 2ARYA 1AU4A 3PBHA 3QSDA 4P6GA 2ATOA 1PBHA 2YJ9A 2AVWA 1AU3A 4P6EA 3V6CA 4W5BA 1ATKA 2PNSA 3RVVA 3RVXA 1NQCA 2R9MA 2VHSA 2HHNA 4KLBA 1NLJA 1ITOA 2IPPB 2HD5A 2YJ8A 2OP3A 2PREA 4G54A 2F7DA 3MORA 4PP2E 1EWMA 5CVMA 3N4CA 3F75A 2FQ9A 3S3RA 2WBFX 2DCAA 3BCNA 1NPZA 1TU6A 1KHPA 2ACTA 1F2CA 3BWKA 3CH2X 1GMYA 3MHHA 3WXFA 1KHQA 5CHTA 2Y6EA 1GLOA 2OZ2A 3TNXA 2R9NA 1PPOA 4HWYA 4W4UA 1M6DA 3P5XA 2P86A 3CH3X 3H8BA 1U5IA 2BDZA 4BQVA 3BC3A 5CHVA 1U9VA 2AYOA 3IEJA 2DCBA 5EGWA 1PIPA 1AYUA 2DC6A 4YYWA 1MEMA 1QMYA 1EWLA 3B79A 3GCBA 2Y5BA 1IWDA 1CVZA 3C9EA 2H7JA 3K9MA 3P5VA 4CDDB 4QRVA 1F29A 3ERVA 1SP4B 3N3KA 5K16A 2GFOA 1MIRA 1Q6KA 2PBHA 2P0RA 4DMYA 4Q8GA 1YK8A 5EF4A 1THEA 3H7DA 3I06A 1EWOA 1KXRA 5CVNB 4PADA
chains in the Genus database with same CATH superfamily
1PPDA 1GCBA 4YYRA 3RNVA 4QH6A 1VJVA 3WXGA 1U9QX 1YK7A 1ME4A 2E03A 1MHWA 4N4ZA 3MJ5A 4YV8A 1ICFA 3HHIA 1EF7A 1U9WA 4YYVA 2YJCA 2IBIA 3HWNA 3IUTA 4W5CA 5F02A 2UZJA 4QRGA 4BOSA 2C0YA 3KKUA 3KWZA 4OELA 5PADA 4BOZA 2DOSA 4DMXA 2DC8A 1MDWA 1QOLA 3BOWA 4IP3A 2XU1A 4ZUXU 1BY8A 2NQGA 2G8JA 3V6EA 3KW9A 1PPNA 3PRMA 1PXVA 1YZBA 1NB3A 5E6JA 4WA6A 5A24A 2G8EA 1CQDA 4D8EA 1KFUL 3IOQA 4YVAA 1F2AA 4YYQA 5KO3A 3DF0A 3W31A 1PPPA 4P16A 3PT2A 1MS6A 4MM3B 4D8BA 1GECE 3OF8A 4PI3A 2B1MA 2PADA 5EZQA 1TL9A 3USVA 1CJLA 4OW0A 5FPWA 3MTNA 1UKFA 2BDLA 1ZCMA 2BU3A 3IFUA 2DC7A 2AUZA 2FO5A 3NHEA 4N79A 3WXEA 4OEMA 2NQIA 1S4VA 1AECA 2JTCA 2O6XA 4I07A 1CPJA 2JQFR 4YYUA 1NL6A 3BPFA 4WURA 3PHWA 5J94A 1CSBB 4Q8HA 4MZOA 4QRXA 3KWBX 3D6SA 2DC9A 2JQGR 2B1NA 3C0RA 1BP4A 4BOQA 2DZYA 4AXMA 3OVXA 1CV8A 4FK5A 4MSXA 3IHPA 2AUXA 3OQCA 1X9YA 3F5VA 4RKXA 2HH5A 4FIPA 1PE6A 2HXZA 9PAPA 3M99A 4IUMA 3K8UA 4HXDB 4PP1A 2AYNA 3RVWA 1POPA 4RY2A 1YVBA 1AU2A 4MZSA 4ZTBA 3BBAA 4AXLA 1CB5A 1F2BA 2AIMA 2FTDA 1YALA 2G7YA 1FH0A 4XZXA 2DJFB 2DZZA 3OF9A 3P5WA 3QJ3A 2R9FA 3LFYA 4CDCB 4CDEB 7PCKA 3OVZA 3IMAA 3KSEA 3KX1A 1XKGA 3O0UA 1CTEA 4D8IA 1TLOA 3H89A 2E01A 1NB5A 1DEUA 2CB5A 5CVOB 1HUCB 3PDFA 2FRQA 1BGOA 2FT2A 2FYEA 3PW3A 1KFXL 1PADA 2VHFA 3IV2A 3I3TA 3MHSA 3BB7A 3QT4A 3H6SA 1STFE 4REZA 1K3BB 3P5UA 2YJBA 2JRIA 1AYWA 3BPMA 2CIOA 4BS6A 4BOPA 3CBKA 3HD3A 3ZUAA 2BTWA 1AU0A 2XU3A 4PT5A 3LXSA 2GHUA 1DF0A 4FJCA 5EZSA 3OISA 5JZEA 5JA7A 1ZIVA 2DJGB 2R9CA 4BSQA 3O65A 4YYSA 4RNAA 3HHAA 3AI8A 3N3GA 3CBJA 3PNRA 3PSEA 3O1GA 1AYVA 2FRAA 8PCHA 1YT7A 2NQAA 4XR7A 3K24A 1SNKA 4XUIA 1U9XA 4K7CA 1MEGA 3KFQA 3H8CA 2NQDB 3PHUA 4BS5A 4M0WA 4X6IA 2DCDA 6PADA 2R6NA 4CDFB 2XU4A 1PVJA 2BTWB 2XU5A 1PCIA 3S3QA 2R9OA 2AS8A 4I04A 2OULA 1QXPA 1Y08A 4BPVA 2E00A 2P7UA 1BQIA 2G6DA 1CS8A 2AU1A 5JH3A 1QDQA 2FUDA 1VSNA 3PRPA 1O0EA 4CZWA 4X6HA 4X6JA 4I05A 4N8WA 1ME3A 1A6RA 1EWPA 1Y4HA 2Z84A 3U8EA 2DCCA 1AIMA 4BOUA 2YJ2A 1JQPA 2F1GA 4QBBA 3E1ZB 2E02A 2ARYA 1AU4A 3PBHA 3QSDA 4P6GA 2ATOA 1PBHA 2YJ9A 2AVWA 1AU3A 4P6EA 3V6CA 4W5BA 1ATKA 2PNSA 3RVVA 3RVXA 1NQCA 2R9MA 2VHSA 2HHNA 4KLBA 1NLJA 3E9SA 1ITOA 2FE8A 2IPPB 4OVZB 2HD5A 2YJ8A 3MP2A 2OP3A 2HWKA 2PREA 4RF1A 2J7QA 3B21A 4G54A 2F7DA 3MORA 4PP2E 1EWMA 5CVMA 3N4CA 3F75A 2FQ9A 3S3RA 2WBFX 2DCAA 3BCNA 1NPZA 1TU6A 1KHPA 2ACTA 1F2CA 3BWKA 3CH2X 1GMYA 3MHHA 3WXFA 1KHQA 5CHTA 2Y6EA 1GLOA 2OZ2A 3TNXA 2R9NA 1PPOA 4HWYA 4W4UA 1M6DA 4A5UA 3P5XA 2P86A 3CH3X 3H8BA 1U5IA 2AGAA 3TMPA 2BDZA 4BQVA 3BC3A 2J7QC 5CHVA 1U9VA 2AYOA 3IEJA 2DCBA 5EGWA 4R3DA 1PIPA 1AYUA 2DC6A 3PHXA 4YYWA 4GUAA 1MEMA 1QMYA 4MI7A 1EWLA 3B79A 3GCBA 2Y5BA 3MTVA 1IWDA 1CVZA 3C9EA 3ZNHA 3TRKA 2H7JA 3P5VA 3K9MA 4CDDB 4QRVA 1F29A 4RF0A 3ERVA 3BY4A 1DKIA 1SP4B 3N3KA 5K16A 2GFOA 4OVZA 1MIRA 1Q6KA 2PBHA 2P0RA 4DMYA 4Q8GA 1YK8A 5EF4A 1THEA 3H7DA 3I06A 1EWOA 3W30A 1KXRA 5CVNB 4PADA
chains in the Genus database with same CATH topology
1PPDA 1GCBA 4YYRA 4QH6A 1VJVA 3WXGA 1U9QX 1YK7A 1ME4A 2E03A 1MHWA 4N4ZA 4YV8A 1ICFA 3HHIA 1EF7A 1U9WA 4BGFA 4YYVA 2YJCA 2IBIA 3HWNA 3IUTA 4W5CA 5F02A 4QRGA 2C0YA 3KKUA 3KWZA 4OELA 5PADA 4DMXA 2DC8A 1MDWA 1QOLA 3BOWA 2XU1A 4ZUXU 1BY8A 2NQGA 2G8JA 3V6EA 3KW9A 1PPNA 1PXVA 1NB3A 4WA6A 5A24A 2G8EA 1CQDA 1KFUL 3IOQA 4YVAA 1F2AA 4YYQA 3DF0A 1PPPA 1MS6A 1GECE 3OF8A 4PI3A 2B1MA 2PADA 1TL9A 3USVA 1CJLA 5FPWA 3MTNA 2BDLA 4GUZA 1ZCMA 2DC7A 2AUZA 2FO5A 3NHEA 1GX3A 4N79A 3WXEA 4OEMA 2NQIA 1S4VA 1AECA 2O6XA 4I07A 1CPJA 2JQFR 4YYUA 1NL6A 3BPFA 5J94A 1CSBB 4Q8HA 4MZOA 4QRXA 3KWBX 3D6SA 2DC9A 2JQGR 2B1NA 1BP4A 2DZYA 4AXMA 3OVXA 1CV8A 4FK5A 4MSXA 3IHPA 2AUXA 1X9YA 3F5VA 2HH5A 4FIPA 1PE6A 2HXZA 9PAPA 3M99A 3K8UA 4PP1A 2AYNA 3RVWA 1POPA 4RY2A 1YVBA 1AU2A 4MZSA 4AXLA 1CB5A 1F2BA 2AIMA 2FTDA 1YALA 2G7YA 1FH0A 1W5RA 2DJFB 2DZZA 3OF9A 3P5WA 3QJ3A 2R9FA 3LFYA 4CDCB 4CDEB 7PCKA 3OVZA 3IMAA 3KSEA 3KX1A 1XKGA 3O0UA 1CTEA 1TLOA 3H89A 2E01A 1NB5A 1DEUA 2CB5A 5CVOB 1HUCB 3PDFA 2FRQA 1BGOA 2FT2A 2FYEA 3PW3A 1KFXL 1PADA 2VHFA 3IV2A 3I3TA 3MHSA 3QT4A 4B55A 3H6SA 1STFE 1K3BB 3P5UA 2YJBA 1AYWA 3BPMA 2CIOA 4BS6A 3CBKA 3HD3A 3ZUAA 1AU0A 2XU3A 3LXSA 2GHUA 1DF0A 4FJCA 3OISA 5JA7A 1ZIVA 2DJGB 2R9CA 4BSQA 4YYSA 3HHAA 3AI8A 3N3GA 3LTWA 3CBJA 3PNRA 3O1GA 1AYVA 2FRAA 8PCHA 1YT7A 2NQAA 4XR7A 3K24A 1SNKA 4XUIA 1U9XA 4K7CA 1MEGA 2VFBA 3KFQA 3H8CA 2NQDB 4BS5A 4X6IA 2DCDA 6PADA 2R6NA 1W4TA 4CDFB 2XU4A 2XU5A 1PCIA 3S3QA 2R9OA 2AS8A 4I04A 2OULA 1E2TA 1QXPA 1Y08A 4BPVA 2E00A 2P7UA 1BQIA 2G6DA 1CS8A 2AU1A 5JH3A 1QDQA 2FUDA 1VSNA 1O0EA 4CZWA 4X6HA 4X6JA 4I05A 4N8WA 1ME3A 1A6RA 1EWPA 1Y4HA 3U8EA 2DCCA 1AIMA 2YJ2A 1JQPA 2F1GA 4QBBA 3E1ZB 2E02A 2ARYA 1AU4A 3PBHA 3QSDA 4P6GA 2ATOA 1PBHA 4C5PA 2YJ9A 2AVWA 1AU3A 4P6EA 3V6CA 4W5BA 1ATKA 2PNSA 3RVVA 3RVXA 1NQCA 2R9MA 2VHSA 2HHNA 4NV7A 4KLBA 1NLJA 1ITOA 2IPPB 2HD5A 2YJ8A 2OP3A 2PREA 4G54A 2F7DA 3MORA 3D9WA 4PP2E 1EWMA 5CVMA 3N4CA 3F75A 2FQ9A 3S3RA 2WBFX 2DCAA 3BCNA 1NPZA 1TU6A 1KHPA 2ACTA 1F2CA 3BWKA 3CH2X 1GMYA 3MHHA 3WXFA 1KHQA 5CHTA 2Y6EA 1GLOA 2OZ2A 3TNXA 2R9NA 1PPOA 4HWYA 4W4UA 1M6DA 3P5XA 2P86A 3CH3X 3H8BA 1U5IA 2BSZA 2BDZA 4NV8A 4BQVA 3BC3A 5CHVA 1U9VA 2AYOA 3IEJA 2DCBA 5EGWA 1PIPA 2VFCA 1AYUA 2DC6A 4YYWA 1MEMA 1QMYA 1EWLA 3B79A 3GCBA 2Y5BA 1IWDA 1CVZA 3C9EA 2H7JA 3K9MA 3P5VA 4CDDB 4QRVA 1F29A 3ERVA 1SP4B 3N3KA 5K16A 2GFOA 1MIRA 1Q6KA 2PBHA 2P0RA 4DMYA 4Q8GA 1YK8A 5EF4A 1THEA 3H7DA 1W6FA 3I06A 1EWOA 1KXRA 5CVNB 4PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPD A;  1GCB A;  4YYR A;  4QH6 A;  1VJV A;  3WXG A;  1U9Q X;  1YK7 A;  1ME4 A;  2E03 A;  1MHW A;  4N4Z A;  4YV8 A;  1ICF A;  3HHI A;  1EF7 A;  1U9W A;  4YYV A;  2YJC A;  2IBI A;  3HWN A;  3IUT A;  4W5C A;  5F02 A;  4QRG A;  2C0Y A;  3KKU A;  3KWZ A;  4OEL A;  5PAD A;  4DMX A;  2DC8 A;  1MDW A;  1QOL A;  3BOW A;  2XU1 A;  4ZUX U;  1BY8 A;  2NQG A;  2G8J A;  3V6E A;  3KW9 A;  1PPN A;  1PXV A;  1NB3 A;  4WA6 A;  5A24 A;  2G8E A;  1CQD A;  1KFU L;  3IOQ A;  4YVA A;  1F2A A;  4YYQ A;  3DF0 A;  1PPP A;  1MS6 A;  1GEC E;  3OF8 A;  4PI3 A;  2B1M A;  2PAD A;  1TL9 A;  3USV A;  1CJL A;  5FPW A;  3MTN A;  2BDL A;  1ZCM A;  2DC7 A;  2AUZ A;  2FO5 A;  3NHE A;  4N79 A;  3WXE A;  4OEM A;  2NQI A;  1S4V A;  1AEC A;  2O6X A;  4I07 A;  1CPJ A;  2JQF R;  4YYU A;  1NL6 A;  3BPF A;  5J94 A;  1CSB B;  4Q8H A;  4MZO A;  4QRX A;  3KWB X;  3D6S A;  2DC9 A;  2JQG R;  2B1N A;  1BP4 A;  2DZY A;  4AXM A;  3OVX A;  1CV8 A;  4FK5 A;  4MSX A;  3IHP A;  2AUX A;  1X9Y A;  3F5V A;  2HH5 A;  4FIP A;  1PE6 A;  2HXZ A;  9PAP A;  3M99 A;  3K8U A;  4PP1 A;  2AYN A;  3RVW A;  1POP A;  4RY2 A;  1YVB A;  1AU2 A;  4MZS A;  4AXL A;  1CB5 A;  1F2B A;  2AIM A;  2FTD A;  1YAL A;  2G7Y A;  1FH0 A;  2DJF B;  2DZZ A;  3OF9 A;  3P5W A;  3QJ3 A;  2R9F A;  3LFY A;  4CDC B;  4CDE B;  7PCK A;  3OVZ A;  3IMA A;  3KSE A;  3KX1 A;  1XKG A;  3O0U A;  1CTE A;  1TLO A;  3H89 A;  2E01 A;  1NB5 A;  1DEU A;  2CB5 A;  5CVO B;  1HUC B;  3PDF A;  2FRQ A;  1BGO A;  2FT2 A;  2FYE A;  3PW3 A;  1KFX L;  1PAD A;  2VHF A;  3IV2 A;  3I3T A;  3MHS A;  3QT4 A;  3H6S A;  1STF E;  1K3B B;  3P5U A;  2YJB A;  1AYW A;  3BPM A;  2CIO A;  4BS6 A;  3CBK A;  3HD3 A;  3ZUA A;  1AU0 A;  2XU3 A;  3LXS A;  2GHU A;  1DF0 A;  4FJC A;  3OIS A;  5JA7 A;  1ZIV A;  2DJG B;  2R9C A;  4BSQ A;  4YYS A;  3HHA A;  3AI8 A;  3N3G A;  3CBJ A;  3PNR A;  3O1G A;  1AYV A;  2FRA A;  8PCH A;  1YT7 A;  2NQA A;  4XR7 A;  3K24 A;  1SNK A;  4XUI A;  1U9X A;  4K7C A;  1MEG A;  3KFQ A;  3H8C A;  2NQD B;  4BS5 A;  4X6I A;  2DCD A;  6PAD A;  2R6N A;  4CDF B;  2XU4 A;  2XU5 A;  1PCI A;  3S3Q A;  2R9O A;  2AS8 A;  4I04 A;  2OUL A;  1QXP A;  1Y08 A;  4BPV A;  2E00 A;  2P7U A;  1BQI A;  2G6D A;  1CS8 A;  2AU1 A;  5JH3 A;  1QDQ A;  2FUD A;  1VSN A;  1O0E A;  4CZW A;  4X6H A;  4X6J A;  4I05 A;  4N8W A;  1ME3 A;  1A6R A;  1EWP A;  1Y4H A;  3U8E A;  2DCC A;  1AIM A;  2YJ2 A;  1JQP A;  2F1G A;  4QBB A;  3E1Z B;  2E02 A;  2ARY A;  1AU4 A;  3PBH A;  3QSD A;  4P6G A;  2ATO A;  1PBH A;  2YJ9 A;  2AVW A;  1AU3 A;  4P6E A;  3V6C A;  4W5B A;  1ATK A;  2PNS A;  3RVV A;  3RVX A;  1NQC A;  2R9M A;  2VHS A;  2HHN A;  4KLB A;  1NLJ A;  1ITO A;  2IPP B;  2HD5 A;  2YJ8 A;  2OP3 A;  2PRE A;  4G54 A;  2F7D A;  3MOR A;  4PP2 E;  1EWM A;  5CVM A;  3N4C A;  3F75 A;  2FQ9 A;  3S3R A;  2WBF X;  2DCA A;  3BCN A;  1NPZ A;  1TU6 A;  1KHP A;  2ACT A;  1F2C A;  3BWK A;  3CH2 X;  1GMY A;  3MHH A;  3WXF A;  1KHQ A;  5CHT A;  2Y6E A;  1GLO A;  2OZ2 A;  3TNX A;  2R9N A;  1PPO A;  4HWY A;  4W4U A;  1M6D A;  3P5X A;  2P86 A;  3CH3 X;  3H8B A;  1U5I A;  2BDZ A;  4BQV A;  3BC3 A;  5CHV A;  1U9V A;  2AYO A;  3IEJ A;  2DCB A;  5EGW A;  1PIP A;  1AYU A;  2DC6 A;  4YYW A;  1MEM A;  1QMY A;  1EWL A;  3B79 A;  3GCB A;  2Y5B A;  1IWD A;  1CVZ A;  3C9E A;  2H7J A;  3K9M A;  3P5V A;  4CDD B;  4QRV A;  1F29 A;  3ERV A;  1SP4 B;  3N3K A;  5K16 A;  2GFO A;  1MIR A;  1Q6K A;  2PBH A;  2P0R A;  4DMY A;  4Q8G A;  1YK8 A;  5EF4 A;  1THE A;  3H7D A;  3I06 A;  1EWO A;  1KXR A;  5CVN B;  4PAD A; 
#chains in the Genus database with same CATH topology
 1PPD A;  1GCB A;  4YYR A;  3RNV A;  4QH6 A;  1VJV A;  3WXG A;  1U9Q X;  1YK7 A;  1ME4 A;  2E03 A;  1MHW A;  4N4Z A;  3MJ5 A;  4YV8 A;  1ICF A;  3HHI A;  1EF7 A;  1U9W A;  4YYV A;  2YJC A;  2IBI A;  3HWN A;  3IUT A;  4W5C A;  5F02 A;  2UZJ A;  4QRG A;  4BOS A;  2C0Y A;  3KKU A;  3KWZ A;  4OEL A;  5PAD A;  4BOZ A;  2DOS A;  4DMX A;  2DC8 A;  1MDW A;  1QOL A;  3BOW A;  4IP3 A;  2XU1 A;  4ZUX U;  1BY8 A;  2NQG A;  2G8J A;  3V6E A;  3KW9 A;  1PPN A;  3PRM A;  1PXV A;  1YZB A;  1NB3 A;  5E6J A;  4WA6 A;  5A24 A;  2G8E A;  1CQD A;  4D8E A;  1KFU L;  3IOQ A;  4YVA A;  1F2A A;  4YYQ A;  5KO3 A;  3DF0 A;  3W31 A;  1PPP A;  4P16 A;  3PT2 A;  1MS6 A;  4MM3 B;  4D8B A;  1GEC E;  3OF8 A;  4PI3 A;  2B1M A;  2PAD A;  5EZQ A;  1TL9 A;  3USV A;  1CJL A;  4OW0 A;  5FPW A;  3MTN A;  1UKF A;  2BDL A;  1ZCM A;  2BU3 A;  3IFU A;  2DC7 A;  2AUZ A;  2FO5 A;  3NHE A;  4N79 A;  3WXE A;  4OEM A;  2NQI A;  1S4V A;  1AEC A;  2JTC A;  2O6X A;  4I07 A;  1CPJ A;  2JQF R;  4YYU A;  1NL6 A;  3BPF A;  4WUR A;  3PHW A;  5J94 A;  1CSB B;  4Q8H A;  4MZO A;  4QRX A;  3KWB X;  3D6S A;  2DC9 A;  2JQG R;  2B1N A;  3C0R A;  1BP4 A;  4BOQ A;  2DZY A;  4AXM A;  3OVX A;  1CV8 A;  4FK5 A;  4MSX A;  3IHP A;  2AUX A;  3OQC A;  1X9Y A;  3F5V A;  4RKX A;  2HH5 A;  4FIP A;  1PE6 A;  2HXZ A;  9PAP A;  3M99 A;  4IUM A;  3K8U A;  4HXD B;  4PP1 A;  2AYN A;  3RVW A;  1POP A;  4RY2 A;  1YVB A;  1AU2 A;  4MZS A;  4ZTB A;  3BBA A;  4AXL A;  1CB5 A;  1F2B A;  2AIM A;  2FTD A;  1YAL A;  2G7Y A;  1FH0 A;  4XZX A;  2DJF B;  2DZZ A;  3OF9 A;  3P5W A;  3QJ3 A;  2R9F A;  3LFY A;  4CDC B;  4CDE B;  7PCK A;  3OVZ A;  3IMA A;  3KSE A;  3KX1 A;  1XKG A;  3O0U A;  1CTE A;  4D8I A;  1TLO A;  3H89 A;  2E01 A;  1NB5 A;  1DEU A;  2CB5 A;  5CVO B;  1HUC B;  3PDF A;  2FRQ A;  1BGO A;  2FT2 A;  2FYE A;  3PW3 A;  1KFX L;  1PAD A;  2VHF A;  3IV2 A;  3I3T A;  3MHS A;  3BB7 A;  3QT4 A;  3H6S A;  1STF E;  4REZ A;  1K3B B;  3P5U A;  2YJB A;  2JRI A;  1AYW A;  3BPM A;  2CIO A;  4BS6 A;  4BOP A;  3CBK A;  3HD3 A;  3ZUA A;  2BTW A;  1AU0 A;  2XU3 A;  4PT5 A;  3LXS A;  2GHU A;  1DF0 A;  4FJC A;  5EZS A;  3OIS A;  5JZE A;  5JA7 A;  1ZIV A;  2DJG B;  2R9C A;  4BSQ A;  3O65 A;  4YYS A;  4RNA A;  3HHA A;  3AI8 A;  3N3G A;  3CBJ A;  3PNR A;  3PSE A;  3O1G A;  1AYV A;  2FRA A;  8PCH A;  1YT7 A;  2NQA A;  4XR7 A;  3K24 A;  1SNK A;  4XUI A;  1U9X A;  4K7C A;  1MEG A;  3KFQ A;  3H8C A;  2NQD B;  3PHU A;  4BS5 A;  4M0W A;  4X6I A;  2DCD A;  6PAD A;  2R6N A;  4CDF B;  2XU4 A;  1PVJ A;  2BTW B;  2XU5 A;  1PCI A;  3S3Q A;  2R9O A;  2AS8 A;  4I04 A;  2OUL A;  1QXP A;  1Y08 A;  4BPV A;  2E00 A;  2P7U A;  1BQI A;  2G6D A;  1CS8 A;  2AU1 A;  5JH3 A;  1QDQ A;  2FUD A;  1VSN A;  3PRP A;  1O0E A;  4CZW A;  4X6H A;  4X6J A;  4I05 A;  4N8W A;  1ME3 A;  1A6R A;  1EWP A;  1Y4H A;  2Z84 A;  3U8E A;  2DCC A;  1AIM A;  4BOU A;  2YJ2 A;  1JQP A;  2F1G A;  4QBB A;  3E1Z B;  2E02 A;  2ARY A;  1AU4 A;  3PBH A;  3QSD A;  4P6G A;  2ATO A;  1PBH A;  2YJ9 A;  2AVW A;  1AU3 A;  4P6E A;  3V6C A;  4W5B A;  1ATK A;  2PNS A;  3RVV A;  3RVX A;  1NQC A;  2R9M A;  2VHS A;  2HHN A;  4KLB A;  1NLJ A;  3E9S A;  1ITO A;  2FE8 A;  2IPP B;  4OVZ B;  2HD5 A;  2YJ8 A;  3MP2 A;  2OP3 A;  2HWK A;  2PRE A;  4RF1 A;  2J7Q A;  3B21 A;  4G54 A;  2F7D A;  3MOR A;  4PP2 E;  1EWM A;  5CVM A;  3N4C A;  3F75 A;  2FQ9 A;  3S3R A;  2WBF X;  2DCA A;  3BCN A;  1NPZ A;  1TU6 A;  1KHP A;  2ACT A;  1F2C A;  3BWK A;  3CH2 X;  1GMY A;  3MHH A;  3WXF A;  1KHQ A;  5CHT A;  2Y6E A;  1GLO A;  2OZ2 A;  3TNX A;  2R9N A;  1PPO A;  4HWY A;  4W4U A;  1M6D A;  4A5U A;  3P5X A;  2P86 A;  3CH3 X;  3H8B A;  1U5I A;  2AGA A;  3TMP A;  2BDZ A;  4BQV A;  3BC3 A;  2J7Q C;  5CHV A;  1U9V A;  2AYO A;  3IEJ A;  2DCB A;  5EGW A;  4R3D A;  1PIP A;  1AYU A;  2DC6 A;  3PHX A;  4YYW A;  4GUA A;  1MEM A;  1QMY A;  4MI7 A;  1EWL A;  3B79 A;  3GCB A;  2Y5B A;  3MTV A;  1IWD A;  1CVZ A;  3C9E A;  3ZNH A;  3TRK A;  2H7J A;  3P5V A;  3K9M A;  4CDD B;  4QRV A;  1F29 A;  4RF0 A;  3ERV A;  3BY4 A;  1DKI A;  1SP4 B;  3N3K A;  5K16 A;  2GFO A;  4OVZ A;  1MIR A;  1Q6K A;  2PBH A;  2P0R A;  4DMY A;  4Q8G A;  1YK8 A;  5EF4 A;  1THE A;  3H7D A;  3I06 A;  1EWO A;  3W30 A;  1KXR A;  5CVN B;  4PAD A; 
#chains in the Genus database with same CATH homology
 1PPD A;  1GCB A;  4YYR A;  4QH6 A;  1VJV A;  3WXG A;  1U9Q X;  1YK7 A;  1ME4 A;  2E03 A;  1MHW A;  4N4Z A;  4YV8 A;  1ICF A;  3HHI A;  1EF7 A;  1U9W A;  4BGF A;  4YYV A;  2YJC A;  2IBI A;  3HWN A;  3IUT A;  4W5C A;  5F02 A;  4QRG A;  2C0Y A;  3KKU A;  3KWZ A;  4OEL A;  5PAD A;  4DMX A;  2DC8 A;  1MDW A;  1QOL A;  3BOW A;  2XU1 A;  4ZUX U;  1BY8 A;  2NQG A;  2G8J A;  3V6E A;  3KW9 A;  1PPN A;  1PXV A;  1NB3 A;  4WA6 A;  5A24 A;  2G8E A;  1CQD A;  1KFU L;  3IOQ A;  4YVA A;  1F2A A;  4YYQ A;  3DF0 A;  1PPP A;  1MS6 A;  1GEC E;  3OF8 A;  4PI3 A;  2B1M A;  2PAD A;  1TL9 A;  3USV A;  1CJL A;  5FPW A;  3MTN A;  2BDL A;  4GUZ A;  1ZCM A;  2DC7 A;  2AUZ A;  2FO5 A;  3NHE A;  1GX3 A;  4N79 A;  3WXE A;  4OEM A;  2NQI A;  1S4V A;  1AEC A;  2O6X A;  4I07 A;  1CPJ A;  2JQF R;  4YYU A;  1NL6 A;  3BPF A;  5J94 A;  1CSB B;  4Q8H A;  4MZO A;  4QRX A;  3KWB X;  3D6S A;  2DC9 A;  2JQG R;  2B1N A;  1BP4 A;  2DZY A;  4AXM A;  3OVX A;  1CV8 A;  4FK5 A;  4MSX A;  3IHP A;  2AUX A;  1X9Y A;  3F5V A;  2HH5 A;  4FIP A;  1PE6 A;  2HXZ A;  9PAP A;  3M99 A;  3K8U A;  4PP1 A;  2AYN A;  3RVW A;  1POP A;  4RY2 A;  1YVB A;  1AU2 A;  4MZS A;  4AXL A;  1CB5 A;  1F2B A;  2AIM A;  2FTD A;  1YAL A;  2G7Y A;  1FH0 A;  1W5R A;  2DJF B;  2DZZ A;  3OF9 A;  3P5W A;  3QJ3 A;  2R9F A;  3LFY A;  4CDC B;  4CDE B;  7PCK A;  3OVZ A;  3IMA A;  3KSE A;  3KX1 A;  1XKG A;  3O0U A;  1CTE A;  1TLO A;  3H89 A;  2E01 A;  1NB5 A;  1DEU A;  2CB5 A;  5CVO B;  1HUC B;  3PDF A;  2FRQ A;  1BGO A;  2FT2 A;  2FYE A;  3PW3 A;  1KFX L;  1PAD A;  2VHF A;  3IV2 A;  3I3T A;  3MHS A;  3QT4 A;  4B55 A;  3H6S A;  1STF E;  1K3B B;  3P5U A;  2YJB A;  1AYW A;  3BPM A;  2CIO A;  4BS6 A;  3CBK A;  3HD3 A;  3ZUA A;  1AU0 A;  2XU3 A;  3LXS A;  2GHU A;  1DF0 A;  4FJC A;  3OIS A;  5JA7 A;  1ZIV A;  2DJG B;  2R9C A;  4BSQ A;  4YYS A;  3HHA A;  3AI8 A;  3N3G A;  3LTW A;  3CBJ A;  3PNR A;  3O1G A;  1AYV A;  2FRA A;  8PCH A;  1YT7 A;  2NQA A;  4XR7 A;  3K24 A;  1SNK A;  4XUI A;  1U9X A;  4K7C A;  1MEG A;  2VFB A;  3KFQ A;  3H8C A;  2NQD B;  4BS5 A;  4X6I A;  2DCD A;  6PAD A;  2R6N A;  1W4T A;  4CDF B;  2XU4 A;  2XU5 A;  1PCI A;  3S3Q A;  2R9O A;  2AS8 A;  4I04 A;  2OUL A;  1E2T A;  1QXP A;  1Y08 A;  4BPV A;  2E00 A;  2P7U A;  1BQI A;  2G6D A;  1CS8 A;  2AU1 A;  5JH3 A;  1QDQ A;  2FUD A;  1VSN A;  1O0E A;  4CZW A;  4X6H A;  4X6J A;  4I05 A;  4N8W A;  1ME3 A;  1A6R A;  1EWP A;  1Y4H A;  3U8E A;  2DCC A;  1AIM A;  2YJ2 A;  1JQP A;  2F1G A;  4QBB A;  3E1Z B;  2E02 A;  2ARY A;  1AU4 A;  3PBH A;  3QSD A;  4P6G A;  2ATO A;  1PBH A;  4C5P A;  2YJ9 A;  2AVW A;  1AU3 A;  4P6E A;  3V6C A;  4W5B A;  1ATK A;  2PNS A;  3RVV A;  3RVX A;  1NQC A;  2R9M A;  2VHS A;  2HHN A;  4NV7 A;  4KLB A;  1NLJ A;  1ITO A;  2IPP B;  2HD5 A;  2YJ8 A;  2OP3 A;  2PRE A;  4G54 A;  2F7D A;  3MOR A;  3D9W A;  4PP2 E;  1EWM A;  5CVM A;  3N4C A;  3F75 A;  2FQ9 A;  3S3R A;  2WBF X;  2DCA A;  3BCN A;  1NPZ A;  1TU6 A;  1KHP A;  2ACT A;  1F2C A;  3BWK A;  3CH2 X;  1GMY A;  3MHH A;  3WXF A;  1KHQ A;  5CHT A;  2Y6E A;  1GLO A;  2OZ2 A;  3TNX A;  2R9N A;  1PPO A;  4HWY A;  4W4U A;  1M6D A;  3P5X A;  2P86 A;  3CH3 X;  3H8B A;  1U5I A;  2BSZ A;  2BDZ A;  4NV8 A;  4BQV A;  3BC3 A;  5CHV A;  1U9V A;  2AYO A;  3IEJ A;  2DCB A;  5EGW A;  1PIP A;  2VFC A;  1AYU A;  2DC6 A;  4YYW A;  1MEM A;  1QMY A;  1EWL A;  3B79 A;  3GCB A;  2Y5B A;  1IWD A;  1CVZ A;  3C9E A;  2H7J A;  3K9M A;  3P5V A;  4CDD B;  4QRV A;  1F29 A;  3ERV A;  1SP4 B;  3N3K A;  5K16 A;  2GFO A;  1MIR A;  1Q6K A;  2PBH A;  2P0R A;  4DMY A;  4Q8G A;  1YK8 A;  5EF4 A;  1THE A;  3H7D A;  1W6F A;  3I06 A;  1EWO A;  1KXR A;  5CVN B;  4PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...