4QH6A

Crystal structure of cruzain with nitrile inhibitor n-(2-aminoethyl)-nalpha-benzoyl-l-phenylalaninamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Molecular Design, Synthesis and Trypanocidal Activity of Dipeptidyl Nitriles as Cruzain Inhibitors.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qh6A00
7PCKA 1GMYA 2YJ9A 1AU4A 4X6IA 1IWDA 3IOQA 5CVOB 1PPPA 2PADA 3H8BA 4G54A 3BWKA 4ZUXU 2G8EA 2FT2A 4YV8A 3IEJA 3USVA 2BDLA 2B1NA 5EGWA 1PPOA 1AU3A 1GECE 1MIRA 5K16A 1QOLA 1AIMA 5CVMA 1EWLA 1PPNA 2OZ2A 3K24A 2IPPB 1KFXL 2AU1A 2IBIA 2NQDB 2FYEA 1CJLA 1EF7A 2DZZA 4BQVA 3K8UA 2AS8A 3WXEA 2H7JA 4KLBA 1PIPA 1MDWA 4CDEB 6PADA 3U8EA 5CHVA 1TLOA 3OVZA 1AU2A 3CBJA 2AUZA 3GCBA 1TL9A 3O1GA 1NPZA 3IV2A 1U9QX 1AYUA 4YYSA 3BC3A 3IHPA 3E1ZB 3LXSA 3MORA 3BPMA 4N8WA 4P6GA 2DJFB 3KSEA 3MHSA 4N4ZA 1ME3A 3O0UA 2HHNA 3B79A 3P5WA 3M99A 3ERVA 2O6XA 3QT4A 1AYVA 4W5CA 2P86A 5JH3A 1S4VA 3OISA 1Y08A 1CVZA 2FRAA 2JQGR 1EWPA 2G8JA 3RVVA 4QRXA 3KFQA 2ACTA 4FJCA 8PCHA 1ZIVA 2G7YA 1F2CA 2FRQA 1ATKA 2P0RA 2NQAA 4PP2E 4FIPA 3DF0A 3S3RA 3KW9A 4YYQA 4QRVA 4QRGA 1Q6KA 1O0EA 1MS6A 1PXVA 1GLOA 2AYNA 4Q8GA 1U5IA 2DJGB 2R9FA 2FTDA 2XU5A 4K7CA 1U9XA 5J94A 3I3TA 2FUDA 3K9MA 1MHWA 1A6RA 3HHAA 5PADA 4OEMA 5FPWA 3BCNA 3MTNA 4N79A 1NQCA 3I06A 5CHTA 3ZUAA 2DC9A 2ATOA 3RVWA 3TNXA 3D6SA 1X9YA 2YJ2A 2HD5A 4YYUA 5A24A 4BPVA 5EF4A 1F29A 2XU1A 1AYWA 4DMXA 3KX1A 2DC8A 4YVAA 2R9CA 1HUCB 5JA7A 1YT7A 3QJ3A 3N3KA 2HH5A 3P5VA 2C0YA 2XU3A 1U9WA 4YYVA 1Y4HA 3BPFA 2DC6A 3CH2X 3QSDA 4PP1A 2BDZA 1NB3A 4CDCB 2DCAA 3IUTA 2Y6EA 3PBHA 3OF9A 1M6DA 2ARYA 1F2BA 3CH3X 1NB5A 1CS8A 4P6EA 4FK5A 2DCDA 1YALA 2CB5A 2AIMA 2AVWA 4CDFB 2XU4A 3AI8A 1DF0A 3N4CA 4BS5A 2FO5A 1VJVA 2AUXA 2R9MA 3H6SA 3HD3A 1NL6A 1EWMA 3WXFA 1YK8A 1KFUL 4BSQA 1DEUA 1BY8A 3OVXA 3PDFA 1ZCMA 1KHPA 4W4UA 3P5UA 2YJBA 3V6CA 1NLJA 1POPA 4RY2A 4XUIA 3PNRA 2R9OA 4HWYA 1EWOA 3H89A 2E01A 2VHFA 4W5BA 1PE6A 3HHIA 1JQPA 3LFYA 1CSBB 3C9EA 2E00A 1XKGA 1CV8A 4MZOA 2VHSA 2PNSA 3S3QA 4DMYA 1PPDA 3H7DA 4Q8HA 1SP4B 2PBHA 3OF8A 3KKUA 1SNKA 3RVXA 3KWBX 1YK7A 3BOWA 2R9NA 2WBFX 2DZYA 1YVBA 5CVNB 5F02A 1CB5A 4I05A 4XR7A 2GFOA 3N3GA 3HWNA 1BGOA 2OP3A 1ICFA 4OELA 4MSXA 2P7UA 1CPJA 2B1MA 1KXRA 1CQDA 1GCBA 4MZSA 4AXMA 1QDQA 2F7DA 4I04A 1QMYA 1F2AA 2NQIA 4AXLA 3KWZA 1KHQA 2PREA 1CTEA 4BS6A 2GHUA 2AYOA 4X6JA 3F5VA 1STFE 4CDDB 3NHEA 2JQFR 4QH6A 4QBBA 1PADA 4YYWA 1ME4A 2E02A 2R6NA 1THEA 3WXGA 1PBHA 1ITOA 2DCBA 2CIOA 3V6EA 2DCCA 4PADA 2NQGA 1PCIA 1QXPA 2G6DA 4YYRA 1AU0A 2YJ8A 3CBKA 2YJCA 4PI3A 2E03A 3IMAA 1MEGA 1U9VA 2FQ9A 3F75A 1FH0A 4X6HA 2DC7A 2HXZA 3PW3A 4WA6A 1K3BB 1BQIA 1TU6A 9PAPA 2OULA 3H8CA 4I07A 1MEMA 2Y5BA 2F1GA 4CZWA 1BP4A 3MHHA 3P5XA 1AECA 1VSNA
chains in the Genus database with same CATH superfamily
7PCKA 1GMYA 2YJ9A 1AU4A 4X6IA 1IWDA 3IOQA 5CVOB 4D8IA 4BOSA 1PPPA 2PADA 3H8BA 4G54A 3BWKA 5KO3A 3PHWA 4ZUXU 2G8EA 2FT2A 4YV8A 3IEJA 3USVA 2BDLA 2B1NA 3MJ5A 5EGWA 1PPOA 1AU3A 1GECE 1MIRA 5K16A 1QOLA 1AIMA 5CVMA 1EWLA 1PPNA 2OZ2A 3K24A 2IPPB 1KFXL 2AU1A 2IBIA 2NQDB 2FYEA 1CJLA 3BB7A 1EF7A 2DZZA 4BQVA 2UZJA 3K8UA 2AS8A 2J7QA 3WXEA 4OVZB 2H7JA 4REZA 4KLBA 1PIPA 1MDWA 4CDEB 6PADA 3U8EA 5CHVA 1TLOA 3OVZA 1AU2A 3CBJA 2AUZA 3GCBA 1TL9A 1YZBA 3O1GA 1NPZA 2JTCA 3IV2A 1U9QX 1AYUA 4YYSA 3BC3A 3IHPA 4ZTBA 3E1ZB 3LXSA 4RKXA 3MORA 3BPMA 4N8WA 4P6GA 2DJFB 3KSEA 3PRPA 3MHSA 4N4ZA 1ME3A 3O0UA 2HHNA 3B79A 3P5WA 2JRIA 3M99A 3ERVA 2O6XA 3QT4A 1AYVA 4W5CA 2P86A 5JH3A 3BY4A 1S4VA 3OISA 1Y08A 1CVZA 2FRAA 2JQGR 1EWPA 2G8JA 3RVVA 4QRXA 3KFQA 2ACTA 2BTWA 4FJCA 8PCHA 3O65A 3W30A 4HXDB 1ZIVA 4GUAA 2G7YA 4MI7A 1F2CA 2FRQA 1ATKA 2P0RA 4A5UA 2NQAA 4PP2E 2AGAA 4FIPA 4XZXA 3DF0A 3S3RA 3KW9A 4YYQA 4QRVA 4QRGA 1Q6KA 1O0EA 1MS6A 1PXVA 1GLOA 2AYNA 4Q8GA 1U5IA 2DJGB 2R9FA 2FTDA 2XU5A 4BOQA 4K7CA 1U9XA 5J94A 3I3TA 2FUDA 2BU3A 3K9MA 3PT2A 4RNAA 1MHWA 1A6RA 3HHAA 5PADA 4OEMA 5FPWA 3BCNA 3MTNA 4N79A 1NQCA 3I06A 5CHTA 3ZUAA 2DC9A 2ATOA 3RVWA 3TNXA 3D6SA 1X9YA 2YJ2A 2HD5A 4YYUA 5A24A 4BPVA 5EF4A 2BTWB 1F29A 2XU1A 1AYWA 4DMXA 2DOSA 4R3DA 3KX1A 4WURA 2DC8A 3C0RA 4BOUA 4YVAA 2R9CA 2FE8A 1HUCB 5JA7A 1YT7A 3QJ3A 3N3KA 2HH5A 3P5VA 2C0YA 2XU3A 4OW0A 1U9WA 3TRKA 4YYVA 1Y4HA 3BPFA 3BBAA 2DC6A 3CH2X 3QSDA 4PP1A 2BDZA 1NB3A 4CDCB 2DCAA 5E6JA 4BOZA 3IUTA 2Y6EA 3PBHA 3OF9A 2J7QC 1M6DA 2ARYA 1F2BA 4RF0A 3CH3X 1NB5A 1CS8A 4P6EA 2Z84A 4FK5A 2DCDA 1YALA 2CB5A 2AIMA 2AVWA 4CDFB 2XU4A 3AI8A 1DF0A 3N4CA 4BS5A 2FO5A 1VJVA 1UKFA 2AUXA 2R9MA 3H6SA 3HD3A 1NL6A 1EWMA 3WXFA 3W31A 1YK8A 1KFUL 4BSQA 1DEUA 4PT5A 4D8BA 3OQCA 1BY8A 3OVXA 3PDFA 1ZCMA 1KHPA 4W4UA 3P5UA 3ZNHA 2YJBA 3V6CA 3E9SA 1NLJA 1POPA 4M0WA 4RY2A 4XUIA 3PNRA 2R9OA 4HWYA 1EWOA 3H89A 2E01A 2VHFA 4W5BA 1PE6A 3HHIA 1JQPA 3LFYA 1CSBB 3C9EA 2E00A 1XKGA 4BOPA 1CV8A 3MTVA 4IP3A 4MZOA 2VHSA 2PNSA 3S3QA 4DMYA 1PPDA 3H7DA 4Q8HA 1SP4B 2PBHA 3OF8A 3KKUA 1SNKA 3RVXA 3KWBX 1YK7A 3BOWA 2R9NA 3B21A 1DKIA 2WBFX 2DZYA 1YVBA 5CVNB 5F02A 1CB5A 4I05A 4D8EA 4XR7A 2GFOA 3N3GA 3HWNA 1BGOA 2OP3A 3TMPA 1ICFA 4OELA 4MSXA 3PHUA 2P7UA 1CPJA 2B1MA 1KXRA 1CQDA 1GCBA 4MZSA 4AXMA 1QDQA 2HWKA 2F7DA 4I04A 1QMYA 1F2AA 2NQIA 5EZQA 5EZSA 4AXLA 3KWZA 3IFUA 1KHQA 2PREA 1CTEA 4BS6A 2GHUA 2AYOA 4X6JA 3F5VA 1STFE 4CDDB 4P16A 3NHEA 2JQFR 4QH6A 4QBBA 1PADA 4YYWA 1ME4A 2E02A 5JZEA 2R6NA 1THEA 3WXGA 1PVJA 1PBHA 1ITOA 2DCBA 2CIOA 3PSEA 3V6EA 3PHXA 2DCCA 4PADA 2NQGA 4MM3B 1PCIA 1QXPA 2G6DA 3PRMA 4YYRA 1AU0A 2YJ8A 3CBKA 2YJCA 4PI3A 2E03A 3IMAA 4OVZA 1MEGA 1U9VA 2FQ9A 3F75A 1FH0A 3RNVA 4X6HA 2DC7A 4IUMA 2HXZA 3PW3A 4WA6A 1K3BB 1BQIA 1TU6A 9PAPA 2OULA 3H8CA 4RF1A 4I07A 1MEMA 2Y5BA 2F1GA 4CZWA 1BP4A 3MHHA 3P5XA 3MP2A 1AECA 1VSNA
chains in the Genus database with same CATH topology
7PCKA 1GMYA 2YJ9A 1AU4A 4X6IA 1IWDA 3IOQA 5CVOB 4NV8A 1PPPA 2PADA 3H8BA 4G54A 3BWKA 4ZUXU 2G8EA 2FT2A 4YV8A 3IEJA 3USVA 2BDLA 2B1NA 5EGWA 1PPOA 1AU3A 1GECE 1MIRA 5K16A 1QOLA 1AIMA 5CVMA 1EWLA 1PPNA 2OZ2A 3K24A 2IPPB 1KFXL 2AU1A 2IBIA 2NQDB 2FYEA 1CJLA 1EF7A 2DZZA 4BQVA 3K8UA 2AS8A 3WXEA 2H7JA 4KLBA 1PIPA 1MDWA 4CDEB 6PADA 3U8EA 5CHVA 1TLOA 3OVZA 1AU2A 3CBJA 2AUZA 3GCBA 1TL9A 3O1GA 1NPZA 2BSZA 3IV2A 1U9QX 1AYUA 4YYSA 3BC3A 4BGFA 3IHPA 3E1ZB 3LXSA 3MORA 3BPMA 4N8WA 4P6GA 2DJFB 3KSEA 3MHSA 4N4ZA 1ME3A 3O0UA 2HHNA 3B79A 3P5WA 3M99A 3ERVA 2O6XA 3QT4A 1AYVA 4GUZA 4W5CA 2P86A 5JH3A 1S4VA 3OISA 1Y08A 1CVZA 2FRAA 2JQGR 1EWPA 2G8JA 3RVVA 4QRXA 3KFQA 2ACTA 4FJCA 8PCHA 1ZIVA 2G7YA 1F2CA 2FRQA 1ATKA 2P0RA 2NQAA 4PP2E 4FIPA 3DF0A 3S3RA 3KW9A 4YYQA 4QRVA 4QRGA 2VFCA 1Q6KA 1O0EA 1MS6A 1PXVA 3LTWA 1GLOA 2AYNA 4Q8GA 1U5IA 2DJGB 2R9FA 2FTDA 2XU5A 4K7CA 1U9XA 5J94A 3I3TA 2FUDA 3K9MA 1MHWA 1A6RA 3HHAA 5PADA 4OEMA 5FPWA 3BCNA 3MTNA 4N79A 1NQCA 3I06A 5CHTA 3ZUAA 2DC9A 2ATOA 3RVWA 3TNXA 3D6SA 1X9YA 2YJ2A 2HD5A 4YYUA 5A24A 1W4TA 4BPVA 5EF4A 1F29A 2XU1A 1AYWA 4DMXA 3KX1A 2DC8A 4YVAA 2R9CA 1HUCB 5JA7A 1YT7A 3QJ3A 3N3KA 2HH5A 3P5VA 2C0YA 2XU3A 1U9WA 4YYVA 1Y4HA 3BPFA 2VFBA 2DC6A 3CH2X 3QSDA 4PP1A 2BDZA 1NB3A 4CDCB 2DCAA 3IUTA 2Y6EA 4B55A 3PBHA 3OF9A 1M6DA 2ARYA 1F2BA 3CH3X 1NB5A 1CS8A 4P6EA 4FK5A 2DCDA 1YALA 2CB5A 2AIMA 2AVWA 4CDFB 2XU4A 3AI8A 1DF0A 3N4CA 4BS5A 2FO5A 1VJVA 2AUXA 2R9MA 3H6SA 3HD3A 1NL6A 1EWMA 3WXFA 1YK8A 1KFUL 4BSQA 1DEUA 1BY8A 3OVXA 3PDFA 1ZCMA 1KHPA 4W4UA 1W5RA 3P5UA 2YJBA 3V6CA 1NLJA 1POPA 4RY2A 4XUIA 3PNRA 2R9OA 4HWYA 1EWOA 3H89A 2E01A 4NV7A 2VHFA 4W5BA 1PE6A 3HHIA 1JQPA 3LFYA 1CSBB 3C9EA 2E00A 1XKGA 1CV8A 4MZOA 2VHSA 2PNSA 3S3QA 4DMYA 1PPDA 3H7DA 4Q8HA 1SP4B 2PBHA 3OF8A 3KKUA 1SNKA 3RVXA 3KWBX 1YK7A 3BOWA 2R9NA 2WBFX 2DZYA 1YVBA 5CVNB 5F02A 1CB5A 4I05A 4XR7A 2GFOA 3N3GA 3HWNA 1E2TA 1BGOA 2OP3A 1ICFA 4OELA 4MSXA 2P7UA 1W6FA 1CPJA 2B1MA 1KXRA 1CQDA 1GCBA 4MZSA 4AXMA 1QDQA 2F7DA 4I04A 1QMYA 1F2AA 2NQIA 4AXLA 3KWZA 1KHQA 2PREA 1CTEA 4BS6A 2GHUA 2AYOA 4X6JA 3F5VA 1STFE 4CDDB 4C5PA 3NHEA 2JQFR 4QH6A 4QBBA 1PADA 4YYWA 1ME4A 2E02A 2R6NA 1THEA 3WXGA 1PBHA 1ITOA 3D9WA 2DCBA 2CIOA 3V6EA 1GX3A 2DCCA 4PADA 2NQGA 1PCIA 1QXPA 2G6DA 4YYRA 1AU0A 2YJ8A 3CBKA 2YJCA 4PI3A 2E03A 3IMAA 1MEGA 1U9VA 2FQ9A 3F75A 1FH0A 4X6HA 2DC7A 2HXZA 3PW3A 4WA6A 1K3BB 1BQIA 1TU6A 9PAPA 2OULA 3H8CA 4I07A 1MEMA 2Y5BA 2F1GA 4CZWA 1BP4A 3MHHA 3P5XA 1AECA 1VSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7PCK A;  1GMY A;  2YJ9 A;  1AU4 A;  4X6I A;  1IWD A;  3IOQ A;  5CVO B;  1PPP A;  2PAD A;  3H8B A;  4G54 A;  3BWK A;  4ZUX U;  2G8E A;  2FT2 A;  4YV8 A;  3IEJ A;  3USV A;  2BDL A;  2B1N A;  5EGW A;  1PPO A;  1AU3 A;  1GEC E;  1MIR A;  5K16 A;  1QOL A;  1AIM A;  5CVM A;  1EWL A;  1PPN A;  2OZ2 A;  3K24 A;  2IPP B;  1KFX L;  2AU1 A;  2IBI A;  2NQD B;  2FYE A;  1CJL A;  1EF7 A;  2DZZ A;  4BQV A;  3K8U A;  2AS8 A;  3WXE A;  2H7J A;  4KLB A;  1PIP A;  1MDW A;  4CDE B;  6PAD A;  3U8E A;  5CHV A;  1TLO A;  3OVZ A;  1AU2 A;  3CBJ A;  2AUZ A;  3GCB A;  1TL9 A;  3O1G A;  1NPZ A;  3IV2 A;  1U9Q X;  1AYU A;  4YYS A;  3BC3 A;  3IHP A;  3E1Z B;  3LXS A;  3MOR A;  3BPM A;  4N8W A;  4P6G A;  2DJF B;  3KSE A;  3MHS A;  4N4Z A;  1ME3 A;  3O0U A;  2HHN A;  3B79 A;  3P5W A;  3M99 A;  3ERV A;  2O6X A;  3QT4 A;  1AYV A;  4W5C A;  2P86 A;  5JH3 A;  1S4V A;  3OIS A;  1Y08 A;  1CVZ A;  2FRA A;  2JQG R;  1EWP A;  2G8J A;  3RVV A;  4QRX A;  3KFQ A;  2ACT A;  4FJC A;  8PCH A;  1ZIV A;  2G7Y A;  1F2C A;  2FRQ A;  1ATK A;  2P0R A;  2NQA A;  4PP2 E;  4FIP A;  3DF0 A;  3S3R A;  3KW9 A;  4YYQ A;  4QRV A;  4QRG A;  1Q6K A;  1O0E A;  1MS6 A;  1PXV A;  1GLO A;  2AYN A;  4Q8G A;  1U5I A;  2DJG B;  2R9F A;  2FTD A;  2XU5 A;  4K7C A;  1U9X A;  5J94 A;  3I3T A;  2FUD A;  3K9M A;  1MHW A;  1A6R A;  3HHA A;  5PAD A;  4OEM A;  5FPW A;  3BCN A;  3MTN A;  4N79 A;  1NQC A;  3I06 A;  5CHT A;  3ZUA A;  2DC9 A;  2ATO A;  3RVW A;  3TNX A;  3D6S A;  1X9Y A;  2YJ2 A;  2HD5 A;  4YYU A;  5A24 A;  4BPV A;  5EF4 A;  1F29 A;  2XU1 A;  1AYW A;  4DMX A;  3KX1 A;  2DC8 A;  4YVA A;  2R9C A;  1HUC B;  5JA7 A;  1YT7 A;  3QJ3 A;  3N3K A;  2HH5 A;  3P5V A;  2C0Y A;  2XU3 A;  1U9W A;  4YYV A;  1Y4H A;  3BPF A;  2DC6 A;  3CH2 X;  3QSD A;  4PP1 A;  2BDZ A;  1NB3 A;  4CDC B;  2DCA A;  3IUT A;  2Y6E A;  3PBH A;  3OF9 A;  1M6D A;  2ARY A;  1F2B A;  3CH3 X;  1NB5 A;  1CS8 A;  4P6E A;  4FK5 A;  2DCD A;  1YAL A;  2CB5 A;  2AIM A;  2AVW A;  4CDF B;  2XU4 A;  3AI8 A;  1DF0 A;  3N4C A;  4BS5 A;  2FO5 A;  1VJV A;  2AUX A;  2R9M A;  3H6S A;  3HD3 A;  1NL6 A;  1EWM A;  3WXF A;  1YK8 A;  1KFU L;  4BSQ A;  1DEU A;  1BY8 A;  3OVX A;  3PDF A;  1ZCM A;  1KHP A;  4W4U A;  3P5U A;  2YJB A;  3V6C A;  1NLJ A;  1POP A;  4RY2 A;  4XUI A;  3PNR A;  2R9O A;  4HWY A;  1EWO A;  3H89 A;  2E01 A;  2VHF A;  4W5B A;  1PE6 A;  3HHI A;  1JQP A;  3LFY A;  1CSB B;  3C9E A;  2E00 A;  1XKG A;  1CV8 A;  4MZO A;  2VHS A;  2PNS A;  3S3Q A;  4DMY A;  1PPD A;  3H7D A;  4Q8H A;  1SP4 B;  2PBH A;  3OF8 A;  3KKU A;  1SNK A;  3RVX A;  3KWB X;  1YK7 A;  3BOW A;  2R9N A;  2WBF X;  2DZY A;  1YVB A;  5CVN B;  5F02 A;  1CB5 A;  4I05 A;  4XR7 A;  2GFO A;  3N3G A;  3HWN A;  1BGO A;  2OP3 A;  1ICF A;  4OEL A;  4MSX A;  2P7U A;  1CPJ A;  2B1M A;  1KXR A;  1CQD A;  1GCB A;  4MZS A;  4AXM A;  1QDQ A;  2F7D A;  4I04 A;  1QMY A;  1F2A A;  2NQI A;  4AXL A;  3KWZ A;  1KHQ A;  2PRE A;  1CTE A;  4BS6 A;  2GHU A;  2AYO A;  4X6J A;  3F5V A;  1STF E;  4CDD B;  3NHE A;  2JQF R;  4QH6 A;  4QBB A;  1PAD A;  4YYW A;  1ME4 A;  2E02 A;  2R6N A;  1THE A;  3WXG A;  1PBH A;  1ITO A;  2DCB A;  2CIO A;  3V6E A;  2DCC A;  4PAD A;  2NQG A;  1PCI A;  1QXP A;  2G6D A;  4YYR A;  1AU0 A;  2YJ8 A;  3CBK A;  2YJC A;  4PI3 A;  2E03 A;  3IMA A;  1MEG A;  1U9V A;  2FQ9 A;  3F75 A;  1FH0 A;  4X6H A;  2DC7 A;  2HXZ A;  3PW3 A;  4WA6 A;  1K3B B;  1BQI A;  1TU6 A;  9PAP A;  2OUL A;  3H8C A;  4I07 A;  1MEM A;  2Y5B A;  2F1G A;  4CZW A;  1BP4 A;  3MHH A;  3P5X A;  1AEC A;  1VSN A; 
#chains in the Genus database with same CATH topology
 7PCK A;  1GMY A;  2YJ9 A;  1AU4 A;  4X6I A;  1IWD A;  3IOQ A;  5CVO B;  4D8I A;  4BOS A;  1PPP A;  2PAD A;  3H8B A;  4G54 A;  3BWK A;  5KO3 A;  3PHW A;  4ZUX U;  2G8E A;  2FT2 A;  4YV8 A;  3IEJ A;  3USV A;  2BDL A;  2B1N A;  3MJ5 A;  5EGW A;  1PPO A;  1AU3 A;  1GEC E;  1MIR A;  5K16 A;  1QOL A;  1AIM A;  5CVM A;  1EWL A;  1PPN A;  2OZ2 A;  3K24 A;  2IPP B;  1KFX L;  2AU1 A;  2IBI A;  2NQD B;  2FYE A;  1CJL A;  3BB7 A;  1EF7 A;  2DZZ A;  4BQV A;  2UZJ A;  3K8U A;  2AS8 A;  2J7Q A;  3WXE A;  4OVZ B;  2H7J A;  4REZ A;  4KLB A;  1PIP A;  1MDW A;  4CDE B;  6PAD A;  3U8E A;  5CHV A;  1TLO A;  3OVZ A;  1AU2 A;  3CBJ A;  2AUZ A;  3GCB A;  1TL9 A;  1YZB A;  3O1G A;  1NPZ A;  2JTC A;  3IV2 A;  1U9Q X;  1AYU A;  4YYS A;  3BC3 A;  3IHP A;  4ZTB A;  3E1Z B;  3LXS A;  4RKX A;  3MOR A;  3BPM A;  4N8W A;  4P6G A;  2DJF B;  3KSE A;  3PRP A;  3MHS A;  4N4Z A;  1ME3 A;  3O0U A;  2HHN A;  3B79 A;  3P5W A;  2JRI A;  3M99 A;  3ERV A;  2O6X A;  3QT4 A;  1AYV A;  4W5C A;  2P86 A;  5JH3 A;  3BY4 A;  1S4V A;  3OIS A;  1Y08 A;  1CVZ A;  2FRA A;  2JQG R;  1EWP A;  2G8J A;  3RVV A;  4QRX A;  3KFQ A;  2ACT A;  2BTW A;  4FJC A;  8PCH A;  3O65 A;  3W30 A;  4HXD B;  1ZIV A;  4GUA A;  2G7Y A;  4MI7 A;  1F2C A;  2FRQ A;  1ATK A;  2P0R A;  4A5U A;  2NQA A;  4PP2 E;  2AGA A;  4FIP A;  4XZX A;  3DF0 A;  3S3R A;  3KW9 A;  4YYQ A;  4QRV A;  4QRG A;  1Q6K A;  1O0E A;  1MS6 A;  1PXV A;  1GLO A;  2AYN A;  4Q8G A;  1U5I A;  2DJG B;  2R9F A;  2FTD A;  2XU5 A;  4BOQ A;  4K7C A;  1U9X A;  5J94 A;  3I3T A;  2FUD A;  2BU3 A;  3K9M A;  3PT2 A;  4RNA A;  1MHW A;  1A6R A;  3HHA A;  5PAD A;  4OEM A;  5FPW A;  3BCN A;  3MTN A;  4N79 A;  1NQC A;  3I06 A;  5CHT A;  3ZUA A;  2DC9 A;  2ATO A;  3RVW A;  3TNX A;  3D6S A;  1X9Y A;  2YJ2 A;  2HD5 A;  4YYU A;  5A24 A;  4BPV A;  5EF4 A;  2BTW B;  1F29 A;  2XU1 A;  1AYW A;  4DMX A;  2DOS A;  4R3D A;  3KX1 A;  4WUR A;  2DC8 A;  3C0R A;  4BOU A;  4YVA A;  2R9C A;  2FE8 A;  1HUC B;  5JA7 A;  1YT7 A;  3QJ3 A;  3N3K A;  2HH5 A;  3P5V A;  2C0Y A;  2XU3 A;  4OW0 A;  1U9W A;  3TRK A;  4YYV A;  1Y4H A;  3BPF A;  3BBA A;  2DC6 A;  3CH2 X;  3QSD A;  4PP1 A;  2BDZ A;  1NB3 A;  4CDC B;  2DCA A;  5E6J A;  4BOZ A;  3IUT A;  2Y6E A;  3PBH A;  3OF9 A;  2J7Q C;  1M6D A;  2ARY A;  1F2B A;  4RF0 A;  3CH3 X;  1NB5 A;  1CS8 A;  4P6E A;  2Z84 A;  4FK5 A;  2DCD A;  1YAL A;  2CB5 A;  2AIM A;  2AVW A;  4CDF B;  2XU4 A;  3AI8 A;  1DF0 A;  3N4C A;  4BS5 A;  2FO5 A;  1VJV A;  1UKF A;  2AUX A;  2R9M A;  3H6S A;  3HD3 A;  1NL6 A;  1EWM A;  3WXF A;  3W31 A;  1YK8 A;  1KFU L;  4BSQ A;  1DEU A;  4PT5 A;  4D8B A;  3OQC A;  1BY8 A;  3OVX A;  3PDF A;  1ZCM A;  1KHP A;  4W4U A;  3P5U A;  3ZNH A;  2YJB A;  3V6C A;  3E9S A;  1NLJ A;  1POP A;  4M0W A;  4RY2 A;  4XUI A;  3PNR A;  2R9O A;  4HWY A;  1EWO A;  3H89 A;  2E01 A;  2VHF A;  4W5B A;  1PE6 A;  3HHI A;  1JQP A;  3LFY A;  1CSB B;  3C9E A;  2E00 A;  1XKG A;  4BOP A;  1CV8 A;  3MTV A;  4IP3 A;  4MZO A;  2VHS A;  2PNS A;  3S3Q A;  4DMY A;  1PPD A;  3H7D A;  4Q8H A;  1SP4 B;  2PBH A;  3OF8 A;  3KKU A;  1SNK A;  3RVX A;  3KWB X;  1YK7 A;  3BOW A;  2R9N A;  3B21 A;  1DKI A;  2WBF X;  2DZY A;  1YVB A;  5CVN B;  5F02 A;  1CB5 A;  4I05 A;  4D8E A;  4XR7 A;  2GFO A;  3N3G A;  3HWN A;  1BGO A;  2OP3 A;  3TMP A;  1ICF A;  4OEL A;  4MSX A;  3PHU A;  2P7U A;  1CPJ A;  2B1M A;  1KXR A;  1CQD A;  1GCB A;  4MZS A;  4AXM A;  1QDQ A;  2HWK A;  2F7D A;  4I04 A;  1QMY A;  1F2A A;  2NQI A;  5EZQ A;  5EZS A;  4AXL A;  3KWZ A;  3IFU A;  1KHQ A;  2PRE A;  1CTE A;  4BS6 A;  2GHU A;  2AYO A;  4X6J A;  3F5V A;  1STF E;  4CDD B;  4P16 A;  3NHE A;  2JQF R;  4QH6 A;  4QBB A;  1PAD A;  4YYW A;  1ME4 A;  2E02 A;  5JZE A;  2R6N A;  1THE A;  3WXG A;  1PVJ A;  1PBH A;  1ITO A;  2DCB A;  2CIO A;  3PSE A;  3V6E A;  3PHX A;  2DCC A;  4PAD A;  2NQG A;  4MM3 B;  1PCI A;  1QXP A;  2G6D A;  3PRM A;  4YYR A;  1AU0 A;  2YJ8 A;  3CBK A;  2YJC A;  4PI3 A;  2E03 A;  3IMA A;  4OVZ A;  1MEG A;  1U9V A;  2FQ9 A;  3F75 A;  1FH0 A;  3RNV A;  4X6H A;  2DC7 A;  4IUM A;  2HXZ A;  3PW3 A;  4WA6 A;  1K3B B;  1BQI A;  1TU6 A;  9PAP A;  2OUL A;  3H8C A;  4RF1 A;  4I07 A;  1MEM A;  2Y5B A;  2F1G A;  4CZW A;  1BP4 A;  3MHH A;  3P5X A;  3MP2 A;  1AEC A;  1VSN A; 
#chains in the Genus database with same CATH homology
 7PCK A;  1GMY A;  2YJ9 A;  1AU4 A;  4X6I A;  1IWD A;  3IOQ A;  5CVO B;  4NV8 A;  1PPP A;  2PAD A;  3H8B A;  4G54 A;  3BWK A;  4ZUX U;  2G8E A;  2FT2 A;  4YV8 A;  3IEJ A;  3USV A;  2BDL A;  2B1N A;  5EGW A;  1PPO A;  1AU3 A;  1GEC E;  1MIR A;  5K16 A;  1QOL A;  1AIM A;  5CVM A;  1EWL A;  1PPN A;  2OZ2 A;  3K24 A;  2IPP B;  1KFX L;  2AU1 A;  2IBI A;  2NQD B;  2FYE A;  1CJL A;  1EF7 A;  2DZZ A;  4BQV A;  3K8U A;  2AS8 A;  3WXE A;  2H7J A;  4KLB A;  1PIP A;  1MDW A;  4CDE B;  6PAD A;  3U8E A;  5CHV A;  1TLO A;  3OVZ A;  1AU2 A;  3CBJ A;  2AUZ A;  3GCB A;  1TL9 A;  3O1G A;  1NPZ A;  2BSZ A;  3IV2 A;  1U9Q X;  1AYU A;  4YYS A;  3BC3 A;  4BGF A;  3IHP A;  3E1Z B;  3LXS A;  3MOR A;  3BPM A;  4N8W A;  4P6G A;  2DJF B;  3KSE A;  3MHS A;  4N4Z A;  1ME3 A;  3O0U A;  2HHN A;  3B79 A;  3P5W A;  3M99 A;  3ERV A;  2O6X A;  3QT4 A;  1AYV A;  4GUZ A;  4W5C A;  2P86 A;  5JH3 A;  1S4V A;  3OIS A;  1Y08 A;  1CVZ A;  2FRA A;  2JQG R;  1EWP A;  2G8J A;  3RVV A;  4QRX A;  3KFQ A;  2ACT A;  4FJC A;  8PCH A;  1ZIV A;  2G7Y A;  1F2C A;  2FRQ A;  1ATK A;  2P0R A;  2NQA A;  4PP2 E;  4FIP A;  3DF0 A;  3S3R A;  3KW9 A;  4YYQ A;  4QRV A;  4QRG A;  2VFC A;  1Q6K A;  1O0E A;  1MS6 A;  1PXV A;  3LTW A;  1GLO A;  2AYN A;  4Q8G A;  1U5I A;  2DJG B;  2R9F A;  2FTD A;  2XU5 A;  4K7C A;  1U9X A;  5J94 A;  3I3T A;  2FUD A;  3K9M A;  1MHW A;  1A6R A;  3HHA A;  5PAD A;  4OEM A;  5FPW A;  3BCN A;  3MTN A;  4N79 A;  1NQC A;  3I06 A;  5CHT A;  3ZUA A;  2DC9 A;  2ATO A;  3RVW A;  3TNX A;  3D6S A;  1X9Y A;  2YJ2 A;  2HD5 A;  4YYU A;  5A24 A;  1W4T A;  4BPV A;  5EF4 A;  1F29 A;  2XU1 A;  1AYW A;  4DMX A;  3KX1 A;  2DC8 A;  4YVA A;  2R9C A;  1HUC B;  5JA7 A;  1YT7 A;  3QJ3 A;  3N3K A;  2HH5 A;  3P5V A;  2C0Y A;  2XU3 A;  1U9W A;  4YYV A;  1Y4H A;  3BPF A;  2VFB A;  2DC6 A;  3CH2 X;  3QSD A;  4PP1 A;  2BDZ A;  1NB3 A;  4CDC B;  2DCA A;  3IUT A;  2Y6E A;  4B55 A;  3PBH A;  3OF9 A;  1M6D A;  2ARY A;  1F2B A;  3CH3 X;  1NB5 A;  1CS8 A;  4P6E A;  4FK5 A;  2DCD A;  1YAL A;  2CB5 A;  2AIM A;  2AVW A;  4CDF B;  2XU4 A;  3AI8 A;  1DF0 A;  3N4C A;  4BS5 A;  2FO5 A;  1VJV A;  2AUX A;  2R9M A;  3H6S A;  3HD3 A;  1NL6 A;  1EWM A;  3WXF A;  1YK8 A;  1KFU L;  4BSQ A;  1DEU A;  1BY8 A;  3OVX A;  3PDF A;  1ZCM A;  1KHP A;  4W4U A;  1W5R A;  3P5U A;  2YJB A;  3V6C A;  1NLJ A;  1POP A;  4RY2 A;  4XUI A;  3PNR A;  2R9O A;  4HWY A;  1EWO A;  3H89 A;  2E01 A;  4NV7 A;  2VHF A;  4W5B A;  1PE6 A;  3HHI A;  1JQP A;  3LFY A;  1CSB B;  3C9E A;  2E00 A;  1XKG A;  1CV8 A;  4MZO A;  2VHS A;  2PNS A;  3S3Q A;  4DMY A;  1PPD A;  3H7D A;  4Q8H A;  1SP4 B;  2PBH A;  3OF8 A;  3KKU A;  1SNK A;  3RVX A;  3KWB X;  1YK7 A;  3BOW A;  2R9N A;  2WBF X;  2DZY A;  1YVB A;  5CVN B;  5F02 A;  1CB5 A;  4I05 A;  4XR7 A;  2GFO A;  3N3G A;  3HWN A;  1E2T A;  1BGO A;  2OP3 A;  1ICF A;  4OEL A;  4MSX A;  2P7U A;  1W6F A;  1CPJ A;  2B1M A;  1KXR A;  1CQD A;  1GCB A;  4MZS A;  4AXM A;  1QDQ A;  2F7D A;  4I04 A;  1QMY A;  1F2A A;  2NQI A;  4AXL A;  3KWZ A;  1KHQ A;  2PRE A;  1CTE A;  4BS6 A;  2GHU A;  2AYO A;  4X6J A;  3F5V A;  1STF E;  4CDD B;  4C5P A;  3NHE A;  2JQF R;  4QH6 A;  4QBB A;  1PAD A;  4YYW A;  1ME4 A;  2E02 A;  2R6N A;  1THE A;  3WXG A;  1PBH A;  1ITO A;  3D9W A;  2DCB A;  2CIO A;  3V6E A;  1GX3 A;  2DCC A;  4PAD A;  2NQG A;  1PCI A;  1QXP A;  2G6D A;  4YYR A;  1AU0 A;  2YJ8 A;  3CBK A;  2YJC A;  4PI3 A;  2E03 A;  3IMA A;  1MEG A;  1U9V A;  2FQ9 A;  3F75 A;  1FH0 A;  4X6H A;  2DC7 A;  2HXZ A;  3PW3 A;  4WA6 A;  1K3B B;  1BQI A;  1TU6 A;  9PAP A;  2OUL A;  3H8C A;  4I07 A;  1MEM A;  2Y5B A;  2F1G A;  4CZW A;  1BP4 A;  3MHH A;  3P5X A;  1AEC A;  1VSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...