4QH6A

Crystal structure of cruzain with nitrile inhibitor n-(2-aminoethyl)-nalpha-benzoyl-l-phenylalaninamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Design, Synthesis and Trypanocidal Activity of Dipeptidyl Nitriles as Cruzain Inhibitors.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cruzipain
total genus 67
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qh6A00
2DJFB 2OP3A 1CSBB 5A24A 2YJ2A 5F02A 1QDQA 1NPZA 6PADA 2DZZA 2G8EA 1VSNA 1AYWA 2HH5A 1U9VA 1ZCMA 3KKUA 1NL6A 4P6GA 2FO5A 4AXLA 3S3QA 2DCAA 1CPJA 1DF0A 1KFUL 2Y5BA 3HWNA 4YVAA 1POPA 1PCIA 1CV8A 4W4UA 3CBKA 3BPMA 3F5VA 2R9OA 3P5WA 4X6IA 3QT4A 2PREA 2E00A 2E01A 4YYVA 2B1MA 2JQGR 2DC6A 3HHAA 2OZ2A 2DJGB 1YVBA 1U5IA 1CVZA 2YJBA 3V6EA 5CVMA 2G8JA 3KW9A 3NHEA 2HXZA 2NQDB 3LFYA 2IBIA 4N8WA 5CVOB 2WBFX 2HHNA 7PCKA 4BPVA 2PBHA 2AYOA 4WA6A 1PBHA 4I04A 2AYNA 1AU2A 1X9YA 1BP4A 3IOQA 1IWDA 4CDCB 2VHSA 1MIRA 3RVVA 1YK7A 3KFQA 3QJ3A 3C9EA 2FTDA 1U9XA 2P86A 2R9FA 1GCBA 1CTEA 2ATOA 3WXGA 4QH6A 4YYRA 4OELA 3KX1A 1Y08A 5JH3A 1TU6A 2R9MA 1MS6A 4N79A 4CDDB 8PCHA 3I3TA 3MTNA 2DCBA 1BY8A 3M99A 2YJ9A 1GMYA 2DC9A 4W5CA 4I07A 2FT2A 1FH0A 2FRAA 5K16A 2IPPB 3F75A 5EF4A 1GECE 2CB5A 2DCDA 3IEJA 5CHTA 4YYUA 3OVZA 3KSEA 3K9MA 1KFXL 2AVWA 4CZWA 3K24A 1EWOA 4Q8HA 2H7JA 4PI3A 4XR7A 2JQFR 1MDWA 4YYWA 1F2AA 1ATKA 2AU1A 1YT7A 4XUIA 1ZIVA 2NQGA 5CVNB 2PADA 1MHWA 1CJLA 4P6EA 1KHQA 1NB5A 3CH3X 3O0UA 1NQCA 1BGOA 1CB5A 3BPFA 2AIMA 1EF7A 2CIOA 1ITOA 2P7UA 2P0RA 1QMYA 3AI8A 3P5VA 4OEMA 1EWPA 1PPNA 5JA7A 4G54A 3IMAA 3OVXA 4BSQA 3H8CA 2E03A 2GFOA 2OULA 2G6DA 3BC3A 2XU5A 2R6NA 5EGWA 3OF9A 2F7DA 2R9NA 2YJ8A 3I06A 4QBBA 2G7YA 2PNSA 4DMXA 3RVWA 3K8UA 3KWBX 4FJCA 2GHUA 1Q6KA 1QXPA 1TLOA 1TL9A 2ACTA 1QOLA 2DCCA 5FPWA 4YV8A 4MSXA 4DMYA 4BS5A 2FRQA 1PE6A 3H89A 1F2BA 3USVA 4X6JA 3BWKA 1SP4B 3DF0A 4MZSA 1PXVA 2B1NA 4X6HA 4FIPA 1GLOA 3B79A 5PADA 3PNRA 3P5XA 3GCBA 3LXSA 2YJCA 1PPPA 3H7DA 1THEA 2AS8A 2Y6EA 3P5UA 2O6XA 3CBJA 1PIPA 3OF8A 2VHFA 3D6SA 2F1GA 1JQPA 4YYQA 1SNKA 1K3BB 2NQIA 2R9CA 1CQDA 3H6SA 3WXEA 3MHSA 2NQAA 2BDZA 3IHPA 1EWLA 2AUZA 1PPOA 3MHHA 2BDLA 4PP2E 2C0YA 3BCNA 9PAPA 2ARYA 1PPDA 4N4ZA 1KHPA 4BQVA 1AYVA 1ME4A 1CS8A 4Q8GA 1XKGA 2DC8A 4HWYA 3O1GA 3N4CA 1S4VA 4QRXA 3HHIA 3U8EA 1STFE 1AYUA 4I05A 4K7CA 3ZUAA 3V6CA 2AUXA 3CH2X 5CHVA 3WXFA 1PADA 1NLJA 1AU0A 1O0EA 4RY2A 1YK8A 2XU1A 1ME3A 2DC7A 3N3KA 3PDFA 2FUDA 4FK5A 5J94A 1AECA 4YYSA 1AIMA 1BQIA 3OISA 3RVXA 4MZOA 2DZYA 1YALA 1EWMA 3KWZA 1M6DA 3IV2A 4KLBA 4CDFB 1F2CA 1KXRA 1VJVA 4W5BA 1DEUA 3ERVA 4PADA 2FYEA 1MEGA 3E1ZB 2XU3A 3QSDA 2E02A 4AXMA 2HD5A 1F29A 2XU4A 2FQ9A 1U9QX 1AU3A 3S3RA 4QRVA 4BS6A 3H8BA 1NB3A 3MORA 3N3GA 1Y4HA 1MEMA 3IUTA 1ICFA 4CDEB 3PW3A 4PP1A 1HUCB 1AU4A 1U9WA 3HD3A 4ZUXU 3BOWA 1A6RA 3PBHA 3TNXA 4QRGA
chains in the Genus database with same CATH superfamily
2DJFB 2OP3A 1CSBB 5A24A 2YJ2A 3C0RA 5F02A 1QDQA 1NPZA 6PADA 2DZZA 3B21A 2G8EA 1VSNA 1AYWA 2HH5A 1U9VA 3O65A 5JZEA 1ZCMA 3KKUA 3PHUA 1NL6A 2UZJA 4P6GA 2FO5A 4P16A 4AXLA 3S3QA 2DCAA 1CPJA 1DF0A 1KFUL 2Y5BA 3HWNA 4YVAA 1POPA 1PCIA 1CV8A 4W4UA 3CBKA 3BPMA 3OQCA 3F5VA 2R9OA 3P5WA 4X6IA 3QT4A 2PREA 2E00A 2E01A 4YYVA 2B1MA 2JQGR 4RKXA 2DC6A 4BOUA 3HHAA 1PVJA 2OZ2A 4IP3A 2DJGB 1YVBA 1U5IA 1CVZA 2YJBA 3V6EA 5CVMA 2G8JA 3KW9A 3NHEA 2HXZA 2NQDB 4BOSA 3LFYA 2IBIA 4N8WA 5CVOB 3RNVA 3PHWA 2WBFX 2HHNA 7PCKA 4BPVA 2PBHA 2AYOA 4WA6A 1PBHA 4I04A 4A5UA 2AYNA 2Z84A 1AU2A 1X9YA 1BP4A 3IOQA 1IWDA 4CDCB 2VHSA 1MIRA 3RVVA 1YK7A 3KFQA 3QJ3A 3C9EA 4GUAA 3BBAA 2FTDA 1U9XA 2P86A 2R9FA 1GCBA 1CTEA 2ATOA 3WXGA 4QH6A 4YYRA 4OELA 3W31A 3KX1A 1Y08A 5JH3A 1TU6A 2R9MA 4BOZA 4OW0A 1MS6A 4N79A 2JRIA 4CDDB 8PCHA 3I3TA 3MTNA 2DCBA 4WURA 1BY8A 3M99A 2YJ9A 1GMYA 2DC9A 4W5CA 4I07A 2FT2A 4RNAA 1FH0A 2FRAA 5K16A 2IPPB 3F75A 5EF4A 1GECE 2CB5A 2DCDA 3IEJA 5CHTA 4YYUA 4OVZB 3OVZA 3KSEA 4BOQA 3K9MA 1KFXL 2AVWA 4CZWA 3K24A 1EWOA 4PT5A 4Q8HA 2H7JA 4PI3A 4XR7A 2JQFR 1MDWA 4YYWA 1F2AA 1ATKA 3MP2A 2AU1A 1UKFA 1YT7A 4XUIA 1ZIVA 4IUMA 2NQGA 5CVNB 3E9SA 2PADA 1MHWA 1CJLA 4P6EA 1KHQA 1NB5A 3CH3X 3O0UA 1NQCA 1BGOA 1CB5A 3BPFA 2AIMA 1EF7A 2CIOA 1ITOA 2P7UA 2P0RA 1QMYA 3AI8A 3P5VA 3PSEA 4OEMA 1EWPA 1PPNA 5JA7A 4G54A 3IMAA 4OVZA 3OVXA 4BSQA 3H8CA 2E03A 2GFOA 2OULA 2G6DA 3BC3A 2XU5A 2R6NA 5EGWA 4RF0A 3OF9A 2F7DA 2R9NA 2YJ8A 3I06A 4QBBA 2G7YA 2PNSA 4DMXA 3RVWA 3K8UA 3KWBX 4MI7A 3PT2A 4FJCA 2DOSA 2GHUA 1Q6KA 1QXPA 1TLOA 2J7QA 1TL9A 2ACTA 1QOLA 2DCCA 5FPWA 4YV8A 4MSXA 4DMYA 4R3DA 4BS5A 2FRQA 4HXDB 2BTWB 5EZSA 1PE6A 3H89A 1F2BA 3USVA 4X6JA 3BWKA 1SP4B 5E6JA 3DF0A 4MZSA 1PXVA 2B1NA 4X6HA 4D8BA 4FIPA 1GLOA 3B79A 5PADA 3PNRA 2AGAA 3P5XA 3GCBA 3LXSA 2YJCA 1PPPA 3H7DA 1THEA 2AS8A 2Y6EA 3P5UA 2O6XA 3CBJA 3ZNHA 1PIPA 3OF8A 3TMPA 2VHFA 3D6SA 2F1GA 3PRMA 1JQPA 4ZTBA 3TRKA 4YYQA 1SNKA 1K3BB 2NQIA 2R9CA 4RF1A 1CQDA 3H6SA 3WXEA 3MHSA 2NQAA 2BDZA 3IHPA 1DKIA 1EWLA 3MJ5A 2AUZA 1PPOA 3MHHA 2BDLA 4PP2E 3W30A 2C0YA 3BCNA 9PAPA 2ARYA 1PPDA 4XZXA 4N4ZA 1KHPA 4BQVA 1AYVA 1ME4A 1CS8A 4Q8GA 1XKGA 2DC8A 4HWYA 3MTVA 3O1GA 3N4CA 1S4VA 4QRXA 3HHIA 3U8EA 1STFE 5EZQA 1AYUA 4I05A 4K7CA 3ZUAA 3V6CA 2AUXA 3BY4A 3CH2X 5CHVA 3WXFA 2JTCA 1PADA 1NLJA 1AU0A 2BTWA 4BOPA 1O0EA 5KO3A 4RY2A 1YK8A 2FE8A 2XU1A 1ME3A 2DC7A 3N3KA 3PDFA 2FUDA 4FK5A 5J94A 1AECA 4YYSA 1AIMA 4MM3B 1BQIA 1YZBA 3OISA 3RVXA 4MZOA 3PRPA 2DZYA 1YALA 1EWMA 3KWZA 1M6DA 3IV2A 4KLBA 4CDFB 1F2CA 3PHXA 1KXRA 4REZA 2BU3A 2HWKA 1VJVA 4D8IA 4W5BA 1DEUA 3ERVA 4PADA 2FYEA 1MEGA 3E1ZB 2XU3A 3QSDA 2E02A 4AXMA 3IFUA 2HD5A 1F29A 2XU4A 2FQ9A 1U9QX 1AU3A 3S3RA 2J7QC 4QRVA 4BS6A 3H8BA 1NB3A 3MORA 3N3GA 1Y4HA 1MEMA 3IUTA 3BB7A 1ICFA 4CDEB 4M0WA 3PW3A 4D8EA 4PP1A 1HUCB 1AU4A 1U9WA 3HD3A 4ZUXU 3BOWA 1A6RA 3PBHA 3TNXA 4QRGA
chains in the Genus database with same CATH topology
2DJFB 2OP3A 1CSBB 5A24A 2YJ2A 5F02A 1QDQA 1W5RA 1NPZA 6PADA 2DZZA 2G8EA 1VSNA 1AYWA 2HH5A 1U9VA 1ZCMA 3KKUA 1NL6A 4P6GA 2FO5A 4AXLA 3S3QA 2DCAA 1CPJA 1DF0A 1KFUL 2Y5BA 3HWNA 4YVAA 1POPA 1PCIA 1CV8A 4W4UA 3CBKA 3BPMA 3F5VA 2R9OA 3P5WA 4BGFA 4X6IA 3QT4A 2PREA 2E00A 2E01A 4YYVA 2B1MA 2JQGR 2DC6A 3HHAA 2OZ2A 2DJGB 4NV8A 1YVBA 1U5IA 1CVZA 2YJBA 3V6EA 5CVMA 2G8JA 3KW9A 3NHEA 2HXZA 2NQDB 3LFYA 2IBIA 4N8WA 5CVOB 2WBFX 2HHNA 7PCKA 4BPVA 2PBHA 2AYOA 4WA6A 1PBHA 4I04A 2AYNA 1AU2A 1X9YA 1BP4A 3LTWA 3IOQA 1IWDA 4CDCB 2VHSA 1E2TA 1MIRA 3RVVA 1YK7A 3KFQA 3QJ3A 3C9EA 2FTDA 1U9XA 2P86A 2R9FA 1GCBA 1CTEA 2ATOA 3WXGA 4QH6A 4YYRA 4OELA 2VFCA 3KX1A 1Y08A 5JH3A 1TU6A 2R9MA 1MS6A 4N79A 4CDDB 8PCHA 3I3TA 3MTNA 2DCBA 1BY8A 3M99A 2YJ9A 1GMYA 2DC9A 4W5CA 4I07A 2FT2A 1FH0A 2FRAA 3D9WA 5K16A 2IPPB 3F75A 5EF4A 1GECE 2CB5A 2DCDA 3IEJA 5CHTA 4YYUA 3OVZA 3KSEA 3K9MA 1KFXL 2AVWA 4CZWA 3K24A 1EWOA 4Q8HA 2H7JA 4PI3A 4XR7A 2JQFR 1MDWA 4YYWA 1F2AA 1ATKA 2AU1A 1YT7A 4XUIA 1ZIVA 2NQGA 5CVNB 2PADA 1MHWA 1CJLA 4P6EA 1KHQA 1NB5A 3CH3X 3O0UA 1GX3A 1NQCA 1BGOA 1CB5A 3BPFA 2AIMA 1EF7A 2CIOA 1ITOA 2P7UA 2P0RA 1QMYA 3AI8A 3P5VA 4OEMA 1EWPA 1PPNA 5JA7A 4G54A 3IMAA 3OVXA 4BSQA 3H8CA 2VFBA 2E03A 2GFOA 2OULA 2G6DA 3BC3A 2XU5A 2R6NA 5EGWA 3OF9A 2F7DA 2R9NA 2YJ8A 3I06A 4QBBA 2G7YA 2PNSA 4DMXA 3RVWA 3K8UA 3KWBX 4FJCA 2GHUA 1Q6KA 1QXPA 1TLOA 1TL9A 2ACTA 1QOLA 2DCCA 5FPWA 4C5PA 4YV8A 4MSXA 4DMYA 4BS5A 2FRQA 1PE6A 3H89A 1F2BA 3USVA 4X6JA 3BWKA 4B55A 1SP4B 3DF0A 4MZSA 1PXVA 2B1NA 4X6HA 4FIPA 1GLOA 3B79A 5PADA 3PNRA 3P5XA 3GCBA 4NV7A 3LXSA 2YJCA 1PPPA 3H7DA 1THEA 2AS8A 2Y6EA 3P5UA 2O6XA 3CBJA 1PIPA 3OF8A 2VHFA 3D6SA 2F1GA 1JQPA 4YYQA 1SNKA 1K3BB 2NQIA 2R9CA 1CQDA 3H6SA 3WXEA 3MHSA 2NQAA 2BDZA 3IHPA 1EWLA 2AUZA 1PPOA 3MHHA 2BDLA 4PP2E 2C0YA 3BCNA 9PAPA 2BSZA 2ARYA 1PPDA 4N4ZA 1KHPA 4BQVA 1AYVA 1ME4A 1CS8A 4Q8GA 1XKGA 2DC8A 4HWYA 3O1GA 3N4CA 1S4VA 4QRXA 3HHIA 3U8EA 1STFE 1AYUA 4I05A 4K7CA 3ZUAA 3V6CA 2AUXA 3CH2X 5CHVA 3WXFA 1PADA 1NLJA 1AU0A 1O0EA 4RY2A 1YK8A 2XU1A 1W6FA 1ME3A 2DC7A 3N3KA 3PDFA 2FUDA 4FK5A 5J94A 1AECA 4YYSA 1AIMA 1BQIA 3OISA 3RVXA 4MZOA 2DZYA 1YALA 1EWMA 3KWZA 1M6DA 3IV2A 4KLBA 4CDFB 1F2CA 1KXRA 1VJVA 4W5BA 1DEUA 1W4TA 3ERVA 4PADA 2FYEA 1MEGA 3E1ZB 2XU3A 3QSDA 2E02A 4AXMA 2HD5A 1F29A 2XU4A 2FQ9A 1U9QX 4GUZA 1AU3A 3S3RA 4QRVA 4BS6A 3H8BA 1NB3A 3MORA 3N3GA 1Y4HA 1MEMA 3IUTA 1ICFA 4CDEB 3PW3A 4PP1A 1HUCB 1AU4A 1U9WA 3HD3A 4ZUXU 3BOWA 1A6RA 3PBHA 3TNXA 4QRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJF B;  2OP3 A;  1CSB B;  5A24 A;  2YJ2 A;  5F02 A;  1QDQ A;  1NPZ A;  6PAD A;  2DZZ A;  2G8E A;  1VSN A;  1AYW A;  2HH5 A;  1U9V A;  1ZCM A;  3KKU A;  1NL6 A;  4P6G A;  2FO5 A;  4AXL A;  3S3Q A;  2DCA A;  1CPJ A;  1DF0 A;  1KFU L;  2Y5B A;  3HWN A;  4YVA A;  1POP A;  1PCI A;  1CV8 A;  4W4U A;  3CBK A;  3BPM A;  3F5V A;  2R9O A;  3P5W A;  4X6I A;  3QT4 A;  2PRE A;  2E00 A;  2E01 A;  4YYV A;  2B1M A;  2JQG R;  2DC6 A;  3HHA A;  2OZ2 A;  2DJG B;  1YVB A;  1U5I A;  1CVZ A;  2YJB A;  3V6E A;  5CVM A;  2G8J A;  3KW9 A;  3NHE A;  2HXZ A;  2NQD B;  3LFY A;  2IBI A;  4N8W A;  5CVO B;  2WBF X;  2HHN A;  7PCK A;  4BPV A;  2PBH A;  2AYO A;  4WA6 A;  1PBH A;  4I04 A;  2AYN A;  1AU2 A;  1X9Y A;  1BP4 A;  3IOQ A;  1IWD A;  4CDC B;  2VHS A;  1MIR A;  3RVV A;  1YK7 A;  3KFQ A;  3QJ3 A;  3C9E A;  2FTD A;  1U9X A;  2P86 A;  2R9F A;  1GCB A;  1CTE A;  2ATO A;  3WXG A;  4QH6 A;  4YYR A;  4OEL A;  3KX1 A;  1Y08 A;  5JH3 A;  1TU6 A;  2R9M A;  1MS6 A;  4N79 A;  4CDD B;  8PCH A;  3I3T A;  3MTN A;  2DCB A;  1BY8 A;  3M99 A;  2YJ9 A;  1GMY A;  2DC9 A;  4W5C A;  4I07 A;  2FT2 A;  1FH0 A;  2FRA A;  5K16 A;  2IPP B;  3F75 A;  5EF4 A;  1GEC E;  2CB5 A;  2DCD A;  3IEJ A;  5CHT A;  4YYU A;  3OVZ A;  3KSE A;  3K9M A;  1KFX L;  2AVW A;  4CZW A;  3K24 A;  1EWO A;  4Q8H A;  2H7J A;  4PI3 A;  4XR7 A;  2JQF R;  1MDW A;  4YYW A;  1F2A A;  1ATK A;  2AU1 A;  1YT7 A;  4XUI A;  1ZIV A;  2NQG A;  5CVN B;  2PAD A;  1MHW A;  1CJL A;  4P6E A;  1KHQ A;  1NB5 A;  3CH3 X;  3O0U A;  1NQC A;  1BGO A;  1CB5 A;  3BPF A;  2AIM A;  1EF7 A;  2CIO A;  1ITO A;  2P7U A;  2P0R A;  1QMY A;  3AI8 A;  3P5V A;  4OEM A;  1EWP A;  1PPN A;  5JA7 A;  4G54 A;  3IMA A;  3OVX A;  4BSQ A;  3H8C A;  2E03 A;  2GFO A;  2OUL A;  2G6D A;  3BC3 A;  2XU5 A;  2R6N A;  5EGW A;  3OF9 A;  2F7D A;  2R9N A;  2YJ8 A;  3I06 A;  4QBB A;  2G7Y A;  2PNS A;  4DMX A;  3RVW A;  3K8U A;  3KWB X;  4FJC A;  2GHU A;  1Q6K A;  1QXP A;  1TLO A;  1TL9 A;  2ACT A;  1QOL A;  2DCC A;  5FPW A;  4YV8 A;  4MSX A;  4DMY A;  4BS5 A;  2FRQ A;  1PE6 A;  3H89 A;  1F2B A;  3USV A;  4X6J A;  3BWK A;  1SP4 B;  3DF0 A;  4MZS A;  1PXV A;  2B1N A;  4X6H A;  4FIP A;  1GLO A;  3B79 A;  5PAD A;  3PNR A;  3P5X A;  3GCB A;  3LXS A;  2YJC A;  1PPP A;  3H7D A;  1THE A;  2AS8 A;  2Y6E A;  3P5U A;  2O6X A;  3CBJ A;  1PIP A;  3OF8 A;  2VHF A;  3D6S A;  2F1G A;  1JQP A;  4YYQ A;  1SNK A;  1K3B B;  2NQI A;  2R9C A;  1CQD A;  3H6S A;  3WXE A;  3MHS A;  2NQA A;  2BDZ A;  3IHP A;  1EWL A;  2AUZ A;  1PPO A;  3MHH A;  2BDL A;  4PP2 E;  2C0Y A;  3BCN A;  9PAP A;  2ARY A;  1PPD A;  4N4Z A;  1KHP A;  4BQV A;  1AYV A;  1ME4 A;  1CS8 A;  4Q8G A;  1XKG A;  2DC8 A;  4HWY A;  3O1G A;  3N4C A;  1S4V A;  4QRX A;  3HHI A;  3U8E A;  1STF E;  1AYU A;  4I05 A;  4K7C A;  3ZUA A;  3V6C A;  2AUX A;  3CH2 X;  5CHV A;  3WXF A;  1PAD A;  1NLJ A;  1AU0 A;  1O0E A;  4RY2 A;  1YK8 A;  2XU1 A;  1ME3 A;  2DC7 A;  3N3K A;  3PDF A;  2FUD A;  4FK5 A;  5J94 A;  1AEC A;  4YYS A;  1AIM A;  1BQI A;  3OIS A;  3RVX A;  4MZO A;  2DZY A;  1YAL A;  1EWM A;  3KWZ A;  1M6D A;  3IV2 A;  4KLB A;  4CDF B;  1F2C A;  1KXR A;  1VJV A;  4W5B A;  1DEU A;  3ERV A;  4PAD A;  2FYE A;  1MEG A;  3E1Z B;  2XU3 A;  3QSD A;  2E02 A;  4AXM A;  2HD5 A;  1F29 A;  2XU4 A;  2FQ9 A;  1U9Q X;  1AU3 A;  3S3R A;  4QRV A;  4BS6 A;  3H8B A;  1NB3 A;  3MOR A;  3N3G A;  1Y4H A;  1MEM A;  3IUT A;  1ICF A;  4CDE B;  3PW3 A;  4PP1 A;  1HUC B;  1AU4 A;  1U9W A;  3HD3 A;  4ZUX U;  3BOW A;  1A6R A;  3PBH A;  3TNX A;  4QRG A; 
#chains in the Genus database with same CATH topology
 2DJF B;  2OP3 A;  1CSB B;  5A24 A;  2YJ2 A;  3C0R A;  5F02 A;  1QDQ A;  1NPZ A;  6PAD A;  2DZZ A;  3B21 A;  2G8E A;  1VSN A;  1AYW A;  2HH5 A;  1U9V A;  3O65 A;  5JZE A;  1ZCM A;  3KKU A;  3PHU A;  1NL6 A;  2UZJ A;  4P6G A;  2FO5 A;  4P16 A;  4AXL A;  3S3Q A;  2DCA A;  1CPJ A;  1DF0 A;  1KFU L;  2Y5B A;  3HWN A;  4YVA A;  1POP A;  1PCI A;  1CV8 A;  4W4U A;  3CBK A;  3BPM A;  3OQC A;  3F5V A;  2R9O A;  3P5W A;  4X6I A;  3QT4 A;  2PRE A;  2E00 A;  2E01 A;  4YYV A;  2B1M A;  2JQG R;  4RKX A;  2DC6 A;  4BOU A;  3HHA A;  1PVJ A;  2OZ2 A;  4IP3 A;  2DJG B;  1YVB A;  1U5I A;  1CVZ A;  2YJB A;  3V6E A;  5CVM A;  2G8J A;  3KW9 A;  3NHE A;  2HXZ A;  2NQD B;  4BOS A;  3LFY A;  2IBI A;  4N8W A;  5CVO B;  3RNV A;  3PHW A;  2WBF X;  2HHN A;  7PCK A;  4BPV A;  2PBH A;  2AYO A;  4WA6 A;  1PBH A;  4I04 A;  4A5U A;  2AYN A;  2Z84 A;  1AU2 A;  1X9Y A;  1BP4 A;  3IOQ A;  1IWD A;  4CDC B;  2VHS A;  1MIR A;  3RVV A;  1YK7 A;  3KFQ A;  3QJ3 A;  3C9E A;  4GUA A;  3BBA A;  2FTD A;  1U9X A;  2P86 A;  2R9F A;  1GCB A;  1CTE A;  2ATO A;  3WXG A;  4QH6 A;  4YYR A;  4OEL A;  3W31 A;  3KX1 A;  1Y08 A;  5JH3 A;  1TU6 A;  2R9M A;  4BOZ A;  4OW0 A;  1MS6 A;  4N79 A;  2JRI A;  4CDD B;  8PCH A;  3I3T A;  3MTN A;  2DCB A;  4WUR A;  1BY8 A;  3M99 A;  2YJ9 A;  1GMY A;  2DC9 A;  4W5C A;  4I07 A;  2FT2 A;  4RNA A;  1FH0 A;  2FRA A;  5K16 A;  2IPP B;  3F75 A;  5EF4 A;  1GEC E;  2CB5 A;  2DCD A;  3IEJ A;  5CHT A;  4YYU A;  4OVZ B;  3OVZ A;  3KSE A;  4BOQ A;  3K9M A;  1KFX L;  2AVW A;  4CZW A;  3K24 A;  1EWO A;  4PT5 A;  4Q8H A;  2H7J A;  4PI3 A;  4XR7 A;  2JQF R;  1MDW A;  4YYW A;  1F2A A;  1ATK A;  3MP2 A;  2AU1 A;  1UKF A;  1YT7 A;  4XUI A;  1ZIV A;  4IUM A;  2NQG A;  5CVN B;  3E9S A;  2PAD A;  1MHW A;  1CJL A;  4P6E A;  1KHQ A;  1NB5 A;  3CH3 X;  3O0U A;  1NQC A;  1BGO A;  1CB5 A;  3BPF A;  2AIM A;  1EF7 A;  2CIO A;  1ITO A;  2P7U A;  2P0R A;  1QMY A;  3AI8 A;  3P5V A;  3PSE A;  4OEM A;  1EWP A;  1PPN A;  5JA7 A;  4G54 A;  3IMA A;  4OVZ A;  3OVX A;  4BSQ A;  3H8C A;  2E03 A;  2GFO A;  2OUL A;  2G6D A;  3BC3 A;  2XU5 A;  2R6N A;  5EGW A;  4RF0 A;  3OF9 A;  2F7D A;  2R9N A;  2YJ8 A;  3I06 A;  4QBB A;  2G7Y A;  2PNS A;  4DMX A;  3RVW A;  3K8U A;  3KWB X;  4MI7 A;  3PT2 A;  4FJC A;  2DOS A;  2GHU A;  1Q6K A;  1QXP A;  1TLO A;  2J7Q A;  1TL9 A;  2ACT A;  1QOL A;  2DCC A;  5FPW A;  4YV8 A;  4MSX A;  4DMY A;  4R3D A;  4BS5 A;  2FRQ A;  4HXD B;  2BTW B;  5EZS A;  1PE6 A;  3H89 A;  1F2B A;  3USV A;  4X6J A;  3BWK A;  1SP4 B;  5E6J A;  3DF0 A;  4MZS A;  1PXV A;  2B1N A;  4X6H A;  4D8B A;  4FIP A;  1GLO A;  3B79 A;  5PAD A;  3PNR A;  2AGA A;  3P5X A;  3GCB A;  3LXS A;  2YJC A;  1PPP A;  3H7D A;  1THE A;  2AS8 A;  2Y6E A;  3P5U A;  2O6X A;  3CBJ A;  3ZNH A;  1PIP A;  3OF8 A;  3TMP A;  2VHF A;  3D6S A;  2F1G A;  3PRM A;  1JQP A;  4ZTB A;  3TRK A;  4YYQ A;  1SNK A;  1K3B B;  2NQI A;  2R9C A;  4RF1 A;  1CQD A;  3H6S A;  3WXE A;  3MHS A;  2NQA A;  2BDZ A;  3IHP A;  1DKI A;  1EWL A;  3MJ5 A;  2AUZ A;  1PPO A;  3MHH A;  2BDL A;  4PP2 E;  3W30 A;  2C0Y A;  3BCN A;  9PAP A;  2ARY A;  1PPD A;  4XZX A;  4N4Z A;  1KHP A;  4BQV A;  1AYV A;  1ME4 A;  1CS8 A;  4Q8G A;  1XKG A;  2DC8 A;  4HWY A;  3MTV A;  3O1G A;  3N4C A;  1S4V A;  4QRX A;  3HHI A;  3U8E A;  1STF E;  5EZQ A;  1AYU A;  4I05 A;  4K7C A;  3ZUA A;  3V6C A;  2AUX A;  3BY4 A;  3CH2 X;  5CHV A;  3WXF A;  2JTC A;  1PAD A;  1NLJ A;  1AU0 A;  2BTW A;  4BOP A;  1O0E A;  5KO3 A;  4RY2 A;  1YK8 A;  2FE8 A;  2XU1 A;  1ME3 A;  2DC7 A;  3N3K A;  3PDF A;  2FUD A;  4FK5 A;  5J94 A;  1AEC A;  4YYS A;  1AIM A;  4MM3 B;  1BQI A;  1YZB A;  3OIS A;  3RVX A;  4MZO A;  3PRP A;  2DZY A;  1YAL A;  1EWM A;  3KWZ A;  1M6D A;  3IV2 A;  4KLB A;  4CDF B;  1F2C A;  3PHX A;  1KXR A;  4REZ A;  2BU3 A;  2HWK A;  1VJV A;  4D8I A;  4W5B A;  1DEU A;  3ERV A;  4PAD A;  2FYE A;  1MEG A;  3E1Z B;  2XU3 A;  3QSD A;  2E02 A;  4AXM A;  3IFU A;  2HD5 A;  1F29 A;  2XU4 A;  2FQ9 A;  1U9Q X;  1AU3 A;  3S3R A;  2J7Q C;  4QRV A;  4BS6 A;  3H8B A;  1NB3 A;  3MOR A;  3N3G A;  1Y4H A;  1MEM A;  3IUT A;  3BB7 A;  1ICF A;  4CDE B;  4M0W A;  3PW3 A;  4D8E A;  4PP1 A;  1HUC B;  1AU4 A;  1U9W A;  3HD3 A;  4ZUX U;  3BOW A;  1A6R A;  3PBH A;  3TNX A;  4QRG A; 
#chains in the Genus database with same CATH homology
 2DJF B;  2OP3 A;  1CSB B;  5A24 A;  2YJ2 A;  5F02 A;  1QDQ A;  1W5R A;  1NPZ A;  6PAD A;  2DZZ A;  2G8E A;  1VSN A;  1AYW A;  2HH5 A;  1U9V A;  1ZCM A;  3KKU A;  1NL6 A;  4P6G A;  2FO5 A;  4AXL A;  3S3Q A;  2DCA A;  1CPJ A;  1DF0 A;  1KFU L;  2Y5B A;  3HWN A;  4YVA A;  1POP A;  1PCI A;  1CV8 A;  4W4U A;  3CBK A;  3BPM A;  3F5V A;  2R9O A;  3P5W A;  4BGF A;  4X6I A;  3QT4 A;  2PRE A;  2E00 A;  2E01 A;  4YYV A;  2B1M A;  2JQG R;  2DC6 A;  3HHA A;  2OZ2 A;  2DJG B;  4NV8 A;  1YVB A;  1U5I A;  1CVZ A;  2YJB A;  3V6E A;  5CVM A;  2G8J A;  3KW9 A;  3NHE A;  2HXZ A;  2NQD B;  3LFY A;  2IBI A;  4N8W A;  5CVO B;  2WBF X;  2HHN A;  7PCK A;  4BPV A;  2PBH A;  2AYO A;  4WA6 A;  1PBH A;  4I04 A;  2AYN A;  1AU2 A;  1X9Y A;  1BP4 A;  3LTW A;  3IOQ A;  1IWD A;  4CDC B;  2VHS A;  1E2T A;  1MIR A;  3RVV A;  1YK7 A;  3KFQ A;  3QJ3 A;  3C9E A;  2FTD A;  1U9X A;  2P86 A;  2R9F A;  1GCB A;  1CTE A;  2ATO A;  3WXG A;  4QH6 A;  4YYR A;  4OEL A;  2VFC A;  3KX1 A;  1Y08 A;  5JH3 A;  1TU6 A;  2R9M A;  1MS6 A;  4N79 A;  4CDD B;  8PCH A;  3I3T A;  3MTN A;  2DCB A;  1BY8 A;  3M99 A;  2YJ9 A;  1GMY A;  2DC9 A;  4W5C A;  4I07 A;  2FT2 A;  1FH0 A;  2FRA A;  3D9W A;  5K16 A;  2IPP B;  3F75 A;  5EF4 A;  1GEC E;  2CB5 A;  2DCD A;  3IEJ A;  5CHT A;  4YYU A;  3OVZ A;  3KSE A;  3K9M A;  1KFX L;  2AVW A;  4CZW A;  3K24 A;  1EWO A;  4Q8H A;  2H7J A;  4PI3 A;  4XR7 A;  2JQF R;  1MDW A;  4YYW A;  1F2A A;  1ATK A;  2AU1 A;  1YT7 A;  4XUI A;  1ZIV A;  2NQG A;  5CVN B;  2PAD A;  1MHW A;  1CJL A;  4P6E A;  1KHQ A;  1NB5 A;  3CH3 X;  3O0U A;  1GX3 A;  1NQC A;  1BGO A;  1CB5 A;  3BPF A;  2AIM A;  1EF7 A;  2CIO A;  1ITO A;  2P7U A;  2P0R A;  1QMY A;  3AI8 A;  3P5V A;  4OEM A;  1EWP A;  1PPN A;  5JA7 A;  4G54 A;  3IMA A;  3OVX A;  4BSQ A;  3H8C A;  2VFB A;  2E03 A;  2GFO A;  2OUL A;  2G6D A;  3BC3 A;  2XU5 A;  2R6N A;  5EGW A;  3OF9 A;  2F7D A;  2R9N A;  2YJ8 A;  3I06 A;  4QBB A;  2G7Y A;  2PNS A;  4DMX A;  3RVW A;  3K8U A;  3KWB X;  4FJC A;  2GHU A;  1Q6K A;  1QXP A;  1TLO A;  1TL9 A;  2ACT A;  1QOL A;  2DCC A;  5FPW A;  4C5P A;  4YV8 A;  4MSX A;  4DMY A;  4BS5 A;  2FRQ A;  1PE6 A;  3H89 A;  1F2B A;  3USV A;  4X6J A;  3BWK A;  4B55 A;  1SP4 B;  3DF0 A;  4MZS A;  1PXV A;  2B1N A;  4X6H A;  4FIP A;  1GLO A;  3B79 A;  5PAD A;  3PNR A;  3P5X A;  3GCB A;  4NV7 A;  3LXS A;  2YJC A;  1PPP A;  3H7D A;  1THE A;  2AS8 A;  2Y6E A;  3P5U A;  2O6X A;  3CBJ A;  1PIP A;  3OF8 A;  2VHF A;  3D6S A;  2F1G A;  1JQP A;  4YYQ A;  1SNK A;  1K3B B;  2NQI A;  2R9C A;  1CQD A;  3H6S A;  3WXE A;  3MHS A;  2NQA A;  2BDZ A;  3IHP A;  1EWL A;  2AUZ A;  1PPO A;  3MHH A;  2BDL A;  4PP2 E;  2C0Y A;  3BCN A;  9PAP A;  2BSZ A;  2ARY A;  1PPD A;  4N4Z A;  1KHP A;  4BQV A;  1AYV A;  1ME4 A;  1CS8 A;  4Q8G A;  1XKG A;  2DC8 A;  4HWY A;  3O1G A;  3N4C A;  1S4V A;  4QRX A;  3HHI A;  3U8E A;  1STF E;  1AYU A;  4I05 A;  4K7C A;  3ZUA A;  3V6C A;  2AUX A;  3CH2 X;  5CHV A;  3WXF A;  1PAD A;  1NLJ A;  1AU0 A;  1O0E A;  4RY2 A;  1YK8 A;  2XU1 A;  1W6F A;  1ME3 A;  2DC7 A;  3N3K A;  3PDF A;  2FUD A;  4FK5 A;  5J94 A;  1AEC A;  4YYS A;  1AIM A;  1BQI A;  3OIS A;  3RVX A;  4MZO A;  2DZY A;  1YAL A;  1EWM A;  3KWZ A;  1M6D A;  3IV2 A;  4KLB A;  4CDF B;  1F2C A;  1KXR A;  1VJV A;  4W5B A;  1DEU A;  1W4T A;  3ERV A;  4PAD A;  2FYE A;  1MEG A;  3E1Z B;  2XU3 A;  3QSD A;  2E02 A;  4AXM A;  2HD5 A;  1F29 A;  2XU4 A;  2FQ9 A;  1U9Q X;  4GUZ A;  1AU3 A;  3S3R A;  4QRV A;  4BS6 A;  3H8B A;  1NB3 A;  3MOR A;  3N3G A;  1Y4H A;  1MEM A;  3IUT A;  1ICF A;  4CDE B;  3PW3 A;  4PP1 A;  1HUC B;  1AU4 A;  1U9W A;  3HD3 A;  4ZUX U;  3BOW A;  1A6R A;  3PBH A;  3TNX A;  4QRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...