4QH6A

Crystal structure of cruzain with nitrile inhibitor n-(2-aminoethyl)-nalpha-benzoyl-l-phenylalaninamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cruzipain
publication title Molecular Design, Synthesis and Trypanocidal Activity of Dipeptidyl Nitriles as Cruzain Inhibitors.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 67
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4qh6A00
2DC7A 3PNRA 2IBIA 2R9OA 4AXLA 5PADA 2JQGR 2FRAA 3V6CA 3LXSA 2PADA 1SP4B 2HD5A 3H6SA 5K16A 2P0RA 2DC9A 3IUTA 4N8WA 2VHSA 1QDQA 2AYNA 2YJ9A 5F02A 3HWNA 1Y4HA 1GECE 4CDCB 2XU5A 4CZWA 2F1GA 3P5VA 1O0EA 3U8EA 1AYVA 3MHHA 2P86A 3OVXA 5CVNB 4RY2A 1SNKA 3ZUAA 5CHVA 4DMXA 1NQCA 3AI8A 3I3TA 2OZ2A 1CS8A 3BOWA 4KLBA 2WBFX 4QH6A 2DJFB 1A6RA 2R9FA 3KWZA 2ATOA 4I07A 4XUIA 3RVWA 2B1NA 2PREA 1PADA 2DCAA 4YYRA 3K9MA 1Q6KA 1AYUA 3KSEA 4X6HA 2DC8A 3DF0A 1X9YA 4BS6A 4Q8GA 2FTDA 1DF0A 2FYEA 3K24A 3I06A 1NB5A 3OVZA 1GCBA 1KFUL 1NL6A 4AXMA 1AYWA 1KHQA 1AIMA 1U9WA 3QT4A 3KKUA 4MZOA 2HXZA 1M6DA 1ZCMA 2B1MA 1ITOA 2C0YA 3HHIA 1U9QX 2DCBA 4N79A 4I05A 3KFQA 2Y6EA 3CBJA 2AYOA 1GMYA 2YJBA 1AU0A 2R9CA 3S3RA 2CIOA 1PXVA 4W5CA 4HWYA 2OP3A 5J94A 2NQAA 2XU1A 3OISA 2FUDA 3MHSA 5EGWA 2IPPB 4PADA 1EWOA 4G54A 8PCHA 4CDEB 4Q8HA 1MEMA 2E02A 3OF9A 3MTNA 3F5VA 7PCKA 3GCBA 5CVOB 1MIRA 3USVA 1QXPA 2FO5A 3RVVA 1NPZA 2E03A 1ICFA 1TL9A 1GLOA 2DZYA 5JA7A 2NQIA 1AU3A 4FIPA 3QSDA 3S3QA 2XU3A 6PADA 3BWKA 5CVMA 1XKGA 1F29A 3HD3A 2G8JA 1QMYA 3P5WA 2XU4A 4W5BA 5A24A 1U5IA 5EF4A 1CQDA 4DMYA 4X6IA 4CDFB 9PAPA 1KXRA 4K7CA 3IV2A 3BPMA 2DJGB 1AU2A 3N3KA 1F2BA 1ME4A 1MS6A 3P5XA 1EF7A 1K3BB 2AUXA 3H8BA 3BPFA 1NLJA 4XR7A 4X6JA 1STFE 2G6DA 4BSQA 1U9VA 2AVWA 1S4VA 1KFXL 1POPA 3CBKA 1TU6A 2G7YA 3TNXA 3N4CA 3KX1A 3H89A 4YYUA 1AECA 3V6EA 1EWPA 1DEUA 3C9EA 4BPVA 3WXGA 4PI3A 1ME3A 1YT7A 4CDDB 1TLOA 2Y5BA 4YYQA 4QRGA 1PCIA 1PPPA 1THEA 1EWMA 1BY8A 2GFOA 3O0UA 1PPNA 2FRQA 2PNSA 3K8UA 2NQDB 2DCDA 2CB5A 4I04A 5CHTA 1F2AA 3MORA 1ZIVA 3RVXA 1BGOA 1JQPA 3B79A 1CVZA 2OULA 4QRXA 2YJ2A 4W4UA 2GHUA 3KW9A 3QJ3A 4P6EA 1U9XA 3WXFA 2AU1A 1YK7A 3M99A 4ZUXU 1CJLA 2R9MA 4BS5A 1F2CA 2G8EA 3IOQA 4FJCA 4OELA 2YJ8A 4MSXA 4P6GA 1ATKA 1YK8A 2F7DA 3BC3A 3IMAA 5FPWA 1MDWA 4WA6A 3E1ZB 3OF8A 1AU4A 4QBBA 2R9NA 2DC6A 1PE6A 1CPJA 2AS8A 5JH3A 2PBHA 2VHFA 2HH5A 1YVBA 2R6NA 1BP4A 2HHNA 1CTEA 2O6XA 3IHPA 4PP2E 1KHPA 2BDZA 2FT2A 1MEGA 2AIMA 2H7JA 1Y08A 1PBHA 2E00A 1EWLA 2FQ9A 1PPDA 3P5UA 3IEJA 1CB5A 3WXEA 3D6SA 1PIPA 4YV8A 1FH0A 3H7DA 2P7UA 3H8CA 3CH2X 2E01A 4YYWA 3PW3A 1CSBB 3PBHA 1IWDA 4OEMA 4PP1A 1BQIA 3HHAA 1NB3A 1MHWA 1VSNA 4N4ZA 4BQVA 3ERVA 1PPOA 1YALA 3O1GA 1VJVA 4FK5A 2YJCA 2JQFR 2DCCA 3LFYA 2ACTA 2AUZA 3CH3X 1HUCB 3F75A 1CV8A 3PDFA 4YVAA 4YYSA 4QRVA 1QOLA 3KWBX 3N3GA 2ARYA 3NHEA 2BDLA 3BCNA 4YYVA 2NQGA 2DZZA 4MZSA
chains in the Genus database with same CATH superfamily
4BOSA 2DC7A 3PNRA 2IBIA 2R9OA 4AXLA 5PADA 2JQGR 3E9SA 2FRAA 3V6CA 3LXSA 2PADA 1SP4B 2HD5A 3H6SA 5K16A 2J7QA 2P0RA 4MM3B 2DC9A 3IUTA 4N8WA 3PT2A 2VHSA 1QDQA 2AYNA 2YJ9A 5F02A 3HWNA 1Y4HA 4D8EA 1GECE 4OW0A 3O65A 4D8BA 4CDCB 2XU5A 4A5UA 3BBAA 2F1GA 3P5VA 4CZWA 4M0WA 1O0EA 3U8EA 1AYVA 4BOUA 3MHHA 2P86A 3OVXA 5CVNB 4RY2A 1SNKA 3ZUAA 5CHVA 4DMXA 1NQCA 3AI8A 3I3TA 2OZ2A 1CS8A 3BOWA 3PRPA 3W30A 4KLBA 2WBFX 4OVZA 4QH6A 2DJFB 1PVJA 1A6RA 2R9FA 4MI7A 3KWZA 4WURA 2ATOA 4I07A 4XUIA 4OVZB 3RVWA 2B1NA 2PREA 1PADA 2DCAA 4YYRA 3K9MA 1Q6KA 1AYUA 3KSEA 3PRMA 3PSEA 4X6HA 2DC8A 3DF0A 4GUAA 1X9YA 4BS6A 1UKFA 4Q8GA 2FTDA 1DF0A 2FYEA 3K24A 3I06A 1NB5A 3TRKA 3OVZA 1GCBA 1KFUL 1NL6A 4AXMA 1AYWA 3MP2A 1KHQA 4BOPA 1AIMA 5JZEA 3BY4A 1U9WA 3QT4A 3KKUA 2JTCA 4HXDB 4MZOA 2HXZA 1M6DA 1ZCMA 2B1MA 1ITOA 2C0YA 3HHIA 1U9QX 2DCBA 4I05A 4N79A 3KFQA 2Y6EA 3CBJA 2AYOA 1GMYA 2YJBA 1AU0A 2R9CA 3S3RA 2CIOA 1PXVA 4W5CA 3W31A 4HWYA 2OP3A 5J94A 2NQAA 2XU1A 3OISA 2FUDA 3MHSA 5EGWA 2IPPB 4PADA 1EWOA 2BTWB 4G54A 8PCHA 4CDEB 4Q8HA 1MEMA 2E02A 3OF9A 2JRIA 3MTNA 3F5VA 7PCKA 3GCBA 5CVOB 1MIRA 3USVA 1QXPA 2FO5A 3RVVA 1NPZA 4RKXA 2E03A 1ICFA 1TL9A 2Z84A 1GLOA 2DZYA 5JA7A 2NQIA 3BB7A 1AU3A 4FIPA 3QSDA 3S3QA 2XU3A 6PADA 3BWKA 5CVMA 1XKGA 5E6JA 1F29A 3HD3A 4REZA 2G8JA 1QMYA 3P5WA 2XU4A 4W5BA 3PHUA 2UZJA 5A24A 1U5IA 5EF4A 1CQDA 4DMYA 4X6IA 3PHXA 4CDFB 9PAPA 1KXRA 4K7CA 3IFUA 3IV2A 3BPMA 2FE8A 2DJGB 4BOZA 1AU2A 3N3KA 1F2BA 1ME4A 1MS6A 3P5XA 1EF7A 1K3BB 2AUXA 3H8BA 3BPFA 1NLJA 4XR7A 4X6JA 1STFE 2G6DA 4BSQA 3OQCA 1U9VA 2AVWA 1S4VA 1KFXL 1POPA 2DOSA 4RF0A 3CBKA 4R3DA 1DKIA 1TU6A 2G7YA 3TNXA 3N4CA 3KX1A 3H89A 4IUMA 4YYUA 1AECA 3V6EA 1EWPA 1DEUA 3C9EA 2HWKA 4BPVA 3WXGA 4PI3A 1ME3A 1YT7A 4CDDB 1TLOA 2Y5BA 3TMPA 4YYQA 4QRGA 4ZTBA 1PCIA 3RNVA 1PPPA 1THEA 1EWMA 1BY8A 2GFOA 3O0UA 1PPNA 4BOQA 2FRQA 2PNSA 3K8UA 2NQDB 2DCDA 2CB5A 4I04A 5CHTA 2BTWA 1F2AA 3MORA 1ZIVA 3RVXA 1BGOA 1JQPA 3B79A 4XZXA 1CVZA 2OULA 4QRXA 2YJ2A 4W4UA 2GHUA 3KW9A 3QJ3A 4P6EA 1U9XA 3WXFA 2AU1A 1YK7A 3M99A 4ZUXU 1CJLA 2R9MA 4BS5A 1F2CA 2G8EA 3IOQA 4FJCA 4OELA 2YJ8A 4MSXA 4P6GA 3PHWA 1ATKA 1YK8A 2F7DA 3BC3A 3IMAA 5FPWA 1MDWA 5KO3A 4WA6A 3E1ZB 3OF8A 1AU4A 4QBBA 2R9NA 2DC6A 1PE6A 4D8IA 1CPJA 2AS8A 5JH3A 2PBHA 2VHFA 2HH5A 1YVBA 2R6NA 1BP4A 2HHNA 2J7QC 3MJ5A 1CTEA 2O6XA 3IHPA 3MTVA 4PP2E 1KHPA 2BDZA 2FT2A 1MEGA 2AIMA 2H7JA 5EZSA 1Y08A 1PBHA 2E00A 3ZNHA 1EWLA 2FQ9A 1PPDA 3P5UA 3IEJA 1CB5A 3WXEA 3D6SA 1PIPA 4YV8A 1FH0A 3H7DA 2P7UA 3H8CA 3CH2X 2E01A 4YYWA 3PW3A 1CSBB 3PBHA 1IWDA 4OEMA 4PT5A 4PP1A 1BQIA 3HHAA 1NB3A 1MHWA 1VSNA 4N4ZA 4BQVA 4RF1A 3ERVA 1PPOA 3C0RA 4RNAA 1YALA 3O1GA 1VJVA 4FK5A 1YZBA 2YJCA 5EZQA 2JQFR 2DCCA 3LFYA 2ACTA 2AUZA 3CH3X 1HUCB 3B21A 3F75A 1CV8A 3PDFA 4IP3A 4YVAA 4QRVA 1QOLA 2AGAA 2BU3A 4YYSA 3KWBX 3N3GA 2ARYA 4P16A 3NHEA 2BDLA 3BCNA 4YYVA 2NQGA 2DZZA 4MZSA
chains in the Genus database with same CATH topology
2DC7A 3PNRA 2IBIA 2R9OA 4AXLA 5PADA 2JQGR 2FRAA 3V6CA 3LXSA 2PADA 1SP4B 2HD5A 3H6SA 5K16A 2P0RA 2DC9A 3IUTA 4N8WA 2VHSA 1QDQA 2AYNA 2YJ9A 5F02A 2VFCA 3HWNA 1Y4HA 1GECE 4CDCB 2XU5A 4CZWA 2F1GA 3P5VA 1O0EA 3U8EA 4B55A 1AYVA 3MHHA 2P86A 3OVXA 5CVNB 4RY2A 4BGFA 1SNKA 3ZUAA 5CHVA 1W6FA 4DMXA 1NQCA 3AI8A 3I3TA 2OZ2A 1CS8A 3BOWA 4KLBA 2WBFX 4QH6A 2DJFB 3LTWA 1A6RA 2R9FA 3KWZA 2ATOA 4I07A 4XUIA 3RVWA 2B1NA 2PREA 1PADA 2DCAA 4YYRA 3K9MA 1Q6KA 1AYUA 3KSEA 4X6HA 2DC8A 3DF0A 1X9YA 4BS6A 4Q8GA 2FTDA 1DF0A 2FYEA 3K24A 3I06A 1NB5A 3OVZA 1GCBA 1KFUL 1NL6A 4C5PA 4AXMA 1AYWA 1KHQA 1AIMA 1U9WA 3QT4A 3KKUA 4MZOA 2HXZA 1M6DA 1ZCMA 2B1MA 1ITOA 2C0YA 3HHIA 1U9QX 2DCBA 4N79A 4I05A 3KFQA 2Y6EA 3CBJA 2AYOA 1GMYA 2YJBA 2VFBA 1AU0A 2R9CA 3S3RA 2CIOA 1PXVA 4W5CA 4HWYA 2OP3A 5J94A 2NQAA 2XU1A 3OISA 2FUDA 3MHSA 5EGWA 2IPPB 4PADA 1EWOA 4G54A 8PCHA 4CDEB 4Q8HA 1MEMA 2E02A 3OF9A 3MTNA 3F5VA 7PCKA 3GCBA 5CVOB 1MIRA 3USVA 1QXPA 2FO5A 3RVVA 1NPZA 2E03A 1ICFA 1TL9A 4NV7A 1GLOA 2DZYA 5JA7A 2NQIA 1AU3A 4FIPA 3QSDA 3S3QA 3D9WA 2XU3A 6PADA 3BWKA 5CVMA 1XKGA 1F29A 3HD3A 2G8JA 1QMYA 3P5WA 2XU4A 4W5BA 5A24A 1U5IA 5EF4A 1CQDA 1E2TA 4DMYA 4X6IA 4CDFB 9PAPA 1KXRA 4K7CA 3IV2A 3BPMA 2DJGB 1AU2A 3N3KA 1F2BA 1ME4A 1MS6A 3P5XA 1EF7A 1K3BB 2AUXA 3H8BA 3BPFA 1NLJA 4XR7A 4X6JA 1STFE 2G6DA 4BSQA 1U9VA 2AVWA 1S4VA 1KFXL 1POPA 3CBKA 1TU6A 2G7YA 3TNXA 3N4CA 3KX1A 3H89A 4YYUA 1AECA 3V6EA 1EWPA 1DEUA 3C9EA 4BPVA 3WXGA 4PI3A 1ME3A 1YT7A 4CDDB 1TLOA 2Y5BA 4YYQA 4QRGA 1PCIA 1PPPA 1THEA 1EWMA 1BY8A 2GFOA 3O0UA 1PPNA 4NV8A 2FRQA 2PNSA 3K8UA 2NQDB 2DCDA 2CB5A 4I04A 5CHTA 1F2AA 3MORA 1ZIVA 3RVXA 1BGOA 1JQPA 3B79A 1CVZA 2OULA 4QRXA 2YJ2A 4W4UA 2GHUA 3KW9A 3QJ3A 4P6EA 1U9XA 3WXFA 2AU1A 1YK7A 3M99A 4ZUXU 1CJLA 2R9MA 4BS5A 1F2CA 2G8EA 3IOQA 4FJCA 4OELA 2YJ8A 4MSXA 4P6GA 1ATKA 1YK8A 2F7DA 3BC3A 3IMAA 5FPWA 1MDWA 4WA6A 3E1ZB 3OF8A 1AU4A 4QBBA 2R9NA 2DC6A 1PE6A 1CPJA 2AS8A 5JH3A 2PBHA 2VHFA 2HH5A 1YVBA 2R6NA 1BP4A 2HHNA 1CTEA 2O6XA 3IHPA 4PP2E 1KHPA 2BDZA 2FT2A 1MEGA 2AIMA 2H7JA 4GUZA 1Y08A 1PBHA 2E00A 1EWLA 2FQ9A 1PPDA 3P5UA 1W4TA 3IEJA 1CB5A 3WXEA 3D6SA 1PIPA 4YV8A 1FH0A 3H7DA 2P7UA 3H8CA 3CH2X 2E01A 4YYWA 3PW3A 1CSBB 3PBHA 1IWDA 4OEMA 2BSZA 4PP1A 1BQIA 3HHAA 1NB3A 1MHWA 1VSNA 4N4ZA 4BQVA 3ERVA 1PPOA 1W5RA 1YALA 3O1GA 1VJVA 4FK5A 2YJCA 1GX3A 2JQFR 2DCCA 3LFYA 2ACTA 2AUZA 3CH3X 1HUCB 3F75A 1CV8A 3PDFA 4YVAA 4YYSA 4QRVA 1QOLA 3KWBX 3N3GA 2ARYA 3NHEA 2BDLA 3BCNA 4YYVA 2NQGA 2DZZA 4MZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC7 A;  3PNR A;  2IBI A;  2R9O A;  4AXL A;  5PAD A;  2JQG R;  2FRA A;  3V6C A;  3LXS A;  2PAD A;  1SP4 B;  2HD5 A;  3H6S A;  5K16 A;  2P0R A;  2DC9 A;  3IUT A;  4N8W A;  2VHS A;  1QDQ A;  2AYN A;  2YJ9 A;  5F02 A;  3HWN A;  1Y4H A;  1GEC E;  4CDC B;  2XU5 A;  4CZW A;  2F1G A;  3P5V A;  1O0E A;  3U8E A;  1AYV A;  3MHH A;  2P86 A;  3OVX A;  5CVN B;  4RY2 A;  1SNK A;  3ZUA A;  5CHV A;  4DMX A;  1NQC A;  3AI8 A;  3I3T A;  2OZ2 A;  1CS8 A;  3BOW A;  4KLB A;  2WBF X;  4QH6 A;  2DJF B;  1A6R A;  2R9F A;  3KWZ A;  2ATO A;  4I07 A;  4XUI A;  3RVW A;  2B1N A;  2PRE A;  1PAD A;  2DCA A;  4YYR A;  3K9M A;  1Q6K A;  1AYU A;  3KSE A;  4X6H A;  2DC8 A;  3DF0 A;  1X9Y A;  4BS6 A;  4Q8G A;  2FTD A;  1DF0 A;  2FYE A;  3K24 A;  3I06 A;  1NB5 A;  3OVZ A;  1GCB A;  1KFU L;  1NL6 A;  4AXM A;  1AYW A;  1KHQ A;  1AIM A;  1U9W A;  3QT4 A;  3KKU A;  4MZO A;  2HXZ A;  1M6D A;  1ZCM A;  2B1M A;  1ITO A;  2C0Y A;  3HHI A;  1U9Q X;  2DCB A;  4N79 A;  4I05 A;  3KFQ A;  2Y6E A;  3CBJ A;  2AYO A;  1GMY A;  2YJB A;  1AU0 A;  2R9C A;  3S3R A;  2CIO A;  1PXV A;  4W5C A;  4HWY A;  2OP3 A;  5J94 A;  2NQA A;  2XU1 A;  3OIS A;  2FUD A;  3MHS A;  5EGW A;  2IPP B;  4PAD A;  1EWO A;  4G54 A;  8PCH A;  4CDE B;  4Q8H A;  1MEM A;  2E02 A;  3OF9 A;  3MTN A;  3F5V A;  7PCK A;  3GCB A;  5CVO B;  1MIR A;  3USV A;  1QXP A;  2FO5 A;  3RVV A;  1NPZ A;  2E03 A;  1ICF A;  1TL9 A;  1GLO A;  2DZY A;  5JA7 A;  2NQI A;  1AU3 A;  4FIP A;  3QSD A;  3S3Q A;  2XU3 A;  6PAD A;  3BWK A;  5CVM A;  1XKG A;  1F29 A;  3HD3 A;  2G8J A;  1QMY A;  3P5W A;  2XU4 A;  4W5B A;  5A24 A;  1U5I A;  5EF4 A;  1CQD A;  4DMY A;  4X6I A;  4CDF B;  9PAP A;  1KXR A;  4K7C A;  3IV2 A;  3BPM A;  2DJG B;  1AU2 A;  3N3K A;  1F2B A;  1ME4 A;  1MS6 A;  3P5X A;  1EF7 A;  1K3B B;  2AUX A;  3H8B A;  3BPF A;  1NLJ A;  4XR7 A;  4X6J A;  1STF E;  2G6D A;  4BSQ A;  1U9V A;  2AVW A;  1S4V A;  1KFX L;  1POP A;  3CBK A;  1TU6 A;  2G7Y A;  3TNX A;  3N4C A;  3KX1 A;  3H89 A;  4YYU A;  1AEC A;  3V6E A;  1EWP A;  1DEU A;  3C9E A;  4BPV A;  3WXG A;  4PI3 A;  1ME3 A;  1YT7 A;  4CDD B;  1TLO A;  2Y5B A;  4YYQ A;  4QRG A;  1PCI A;  1PPP A;  1THE A;  1EWM A;  1BY8 A;  2GFO A;  3O0U A;  1PPN A;  2FRQ A;  2PNS A;  3K8U A;  2NQD B;  2DCD A;  2CB5 A;  4I04 A;  5CHT A;  1F2A A;  3MOR A;  1ZIV A;  3RVX A;  1BGO A;  1JQP A;  3B79 A;  1CVZ A;  2OUL A;  4QRX A;  2YJ2 A;  4W4U A;  2GHU A;  3KW9 A;  3QJ3 A;  4P6E A;  1U9X A;  3WXF A;  2AU1 A;  1YK7 A;  3M99 A;  4ZUX U;  1CJL A;  2R9M A;  4BS5 A;  1F2C A;  2G8E A;  3IOQ A;  4FJC A;  4OEL A;  2YJ8 A;  4MSX A;  4P6G A;  1ATK A;  1YK8 A;  2F7D A;  3BC3 A;  3IMA A;  5FPW A;  1MDW A;  4WA6 A;  3E1Z B;  3OF8 A;  1AU4 A;  4QBB A;  2R9N A;  2DC6 A;  1PE6 A;  1CPJ A;  2AS8 A;  5JH3 A;  2PBH A;  2VHF A;  2HH5 A;  1YVB A;  2R6N A;  1BP4 A;  2HHN A;  1CTE A;  2O6X A;  3IHP A;  4PP2 E;  1KHP A;  2BDZ A;  2FT2 A;  1MEG A;  2AIM A;  2H7J A;  1Y08 A;  1PBH A;  2E00 A;  1EWL A;  2FQ9 A;  1PPD A;  3P5U A;  3IEJ A;  1CB5 A;  3WXE A;  3D6S A;  1PIP A;  4YV8 A;  1FH0 A;  3H7D A;  2P7U A;  3H8C A;  3CH2 X;  2E01 A;  4YYW A;  3PW3 A;  1CSB B;  3PBH A;  1IWD A;  4OEM A;  4PP1 A;  1BQI A;  3HHA A;  1NB3 A;  1MHW A;  1VSN A;  4N4Z A;  4BQV A;  3ERV A;  1PPO A;  1YAL A;  3O1G A;  1VJV A;  4FK5 A;  2YJC A;  2JQF R;  2DCC A;  3LFY A;  2ACT A;  2AUZ A;  3CH3 X;  1HUC B;  3F75 A;  1CV8 A;  3PDF A;  4YVA A;  4YYS A;  4QRV A;  1QOL A;  3KWB X;  3N3G A;  2ARY A;  3NHE A;  2BDL A;  3BCN A;  4YYV A;  2NQG A;  2DZZ A;  4MZS A; 
#chains in the Genus database with same CATH topology
 4BOS A;  2DC7 A;  3PNR A;  2IBI A;  2R9O A;  4AXL A;  5PAD A;  2JQG R;  3E9S A;  2FRA A;  3V6C A;  3LXS A;  2PAD A;  1SP4 B;  2HD5 A;  3H6S A;  5K16 A;  2J7Q A;  2P0R A;  4MM3 B;  2DC9 A;  3IUT A;  4N8W A;  3PT2 A;  2VHS A;  1QDQ A;  2AYN A;  2YJ9 A;  5F02 A;  3HWN A;  1Y4H A;  4D8E A;  1GEC E;  4OW0 A;  3O65 A;  4D8B A;  4CDC B;  2XU5 A;  4A5U A;  3BBA A;  2F1G A;  3P5V A;  4CZW A;  4M0W A;  1O0E A;  3U8E A;  1AYV A;  4BOU A;  3MHH A;  2P86 A;  3OVX A;  5CVN B;  4RY2 A;  1SNK A;  3ZUA A;  5CHV A;  4DMX A;  1NQC A;  3AI8 A;  3I3T A;  2OZ2 A;  1CS8 A;  3BOW A;  3PRP A;  3W30 A;  4KLB A;  2WBF X;  4OVZ A;  4QH6 A;  2DJF B;  1PVJ A;  1A6R A;  2R9F A;  4MI7 A;  3KWZ A;  4WUR A;  2ATO A;  4I07 A;  4XUI A;  4OVZ B;  3RVW A;  2B1N A;  2PRE A;  1PAD A;  2DCA A;  4YYR A;  3K9M A;  1Q6K A;  1AYU A;  3KSE A;  3PRM A;  3PSE A;  4X6H A;  2DC8 A;  3DF0 A;  4GUA A;  1X9Y A;  4BS6 A;  1UKF A;  4Q8G A;  2FTD A;  1DF0 A;  2FYE A;  3K24 A;  3I06 A;  1NB5 A;  3TRK A;  3OVZ A;  1GCB A;  1KFU L;  1NL6 A;  4AXM A;  1AYW A;  3MP2 A;  1KHQ A;  4BOP A;  1AIM A;  5JZE A;  3BY4 A;  1U9W A;  3QT4 A;  3KKU A;  2JTC A;  4HXD B;  4MZO A;  2HXZ A;  1M6D A;  1ZCM A;  2B1M A;  1ITO A;  2C0Y A;  3HHI A;  1U9Q X;  2DCB A;  4I05 A;  4N79 A;  3KFQ A;  2Y6E A;  3CBJ A;  2AYO A;  1GMY A;  2YJB A;  1AU0 A;  2R9C A;  3S3R A;  2CIO A;  1PXV A;  4W5C A;  3W31 A;  4HWY A;  2OP3 A;  5J94 A;  2NQA A;  2XU1 A;  3OIS A;  2FUD A;  3MHS A;  5EGW A;  2IPP B;  4PAD A;  1EWO A;  2BTW B;  4G54 A;  8PCH A;  4CDE B;  4Q8H A;  1MEM A;  2E02 A;  3OF9 A;  2JRI A;  3MTN A;  3F5V A;  7PCK A;  3GCB A;  5CVO B;  1MIR A;  3USV A;  1QXP A;  2FO5 A;  3RVV A;  1NPZ A;  4RKX A;  2E03 A;  1ICF A;  1TL9 A;  2Z84 A;  1GLO A;  2DZY A;  5JA7 A;  2NQI A;  3BB7 A;  1AU3 A;  4FIP A;  3QSD A;  3S3Q A;  2XU3 A;  6PAD A;  3BWK A;  5CVM A;  1XKG A;  5E6J A;  1F29 A;  3HD3 A;  4REZ A;  2G8J A;  1QMY A;  3P5W A;  2XU4 A;  4W5B A;  3PHU A;  2UZJ A;  5A24 A;  1U5I A;  5EF4 A;  1CQD A;  4DMY A;  4X6I A;  3PHX A;  4CDF B;  9PAP A;  1KXR A;  4K7C A;  3IFU A;  3IV2 A;  3BPM A;  2FE8 A;  2DJG B;  4BOZ A;  1AU2 A;  3N3K A;  1F2B A;  1ME4 A;  1MS6 A;  3P5X A;  1EF7 A;  1K3B B;  2AUX A;  3H8B A;  3BPF A;  1NLJ A;  4XR7 A;  4X6J A;  1STF E;  2G6D A;  4BSQ A;  3OQC A;  1U9V A;  2AVW A;  1S4V A;  1KFX L;  1POP A;  2DOS A;  4RF0 A;  3CBK A;  4R3D A;  1DKI A;  1TU6 A;  2G7Y A;  3TNX A;  3N4C A;  3KX1 A;  3H89 A;  4IUM A;  4YYU A;  1AEC A;  3V6E A;  1EWP A;  1DEU A;  3C9E A;  2HWK A;  4BPV A;  3WXG A;  4PI3 A;  1ME3 A;  1YT7 A;  4CDD B;  1TLO A;  2Y5B A;  3TMP A;  4YYQ A;  4QRG A;  4ZTB A;  1PCI A;  3RNV A;  1PPP A;  1THE A;  1EWM A;  1BY8 A;  2GFO A;  3O0U A;  1PPN A;  4BOQ A;  2FRQ A;  2PNS A;  3K8U A;  2NQD B;  2DCD A;  2CB5 A;  4I04 A;  5CHT A;  2BTW A;  1F2A A;  3MOR A;  1ZIV A;  3RVX A;  1BGO A;  1JQP A;  3B79 A;  4XZX A;  1CVZ A;  2OUL A;  4QRX A;  2YJ2 A;  4W4U A;  2GHU A;  3KW9 A;  3QJ3 A;  4P6E A;  1U9X A;  3WXF A;  2AU1 A;  1YK7 A;  3M99 A;  4ZUX U;  1CJL A;  2R9M A;  4BS5 A;  1F2C A;  2G8E A;  3IOQ A;  4FJC A;  4OEL A;  2YJ8 A;  4MSX A;  4P6G A;  3PHW A;  1ATK A;  1YK8 A;  2F7D A;  3BC3 A;  3IMA A;  5FPW A;  1MDW A;  5KO3 A;  4WA6 A;  3E1Z B;  3OF8 A;  1AU4 A;  4QBB A;  2R9N A;  2DC6 A;  1PE6 A;  4D8I A;  1CPJ A;  2AS8 A;  5JH3 A;  2PBH A;  2VHF A;  2HH5 A;  1YVB A;  2R6N A;  1BP4 A;  2HHN A;  2J7Q C;  3MJ5 A;  1CTE A;  2O6X A;  3IHP A;  3MTV A;  4PP2 E;  1KHP A;  2BDZ A;  2FT2 A;  1MEG A;  2AIM A;  2H7J A;  5EZS A;  1Y08 A;  1PBH A;  2E00 A;  3ZNH A;  1EWL A;  2FQ9 A;  1PPD A;  3P5U A;  3IEJ A;  1CB5 A;  3WXE A;  3D6S A;  1PIP A;  4YV8 A;  1FH0 A;  3H7D A;  2P7U A;  3H8C A;  3CH2 X;  2E01 A;  4YYW A;  3PW3 A;  1CSB B;  3PBH A;  1IWD A;  4OEM A;  4PT5 A;  4PP1 A;  1BQI A;  3HHA A;  1NB3 A;  1MHW A;  1VSN A;  4N4Z A;  4BQV A;  4RF1 A;  3ERV A;  1PPO A;  3C0R A;  4RNA A;  1YAL A;  3O1G A;  1VJV A;  4FK5 A;  1YZB A;  2YJC A;  5EZQ A;  2JQF R;  2DCC A;  3LFY A;  2ACT A;  2AUZ A;  3CH3 X;  1HUC B;  3B21 A;  3F75 A;  1CV8 A;  3PDF A;  4IP3 A;  4YVA A;  4QRV A;  1QOL A;  2AGA A;  2BU3 A;  4YYS A;  3KWB X;  3N3G A;  2ARY A;  4P16 A;  3NHE A;  2BDL A;  3BCN A;  4YYV A;  2NQG A;  2DZZ A;  4MZS A; 
#chains in the Genus database with same CATH homology
 2DC7 A;  3PNR A;  2IBI A;  2R9O A;  4AXL A;  5PAD A;  2JQG R;  2FRA A;  3V6C A;  3LXS A;  2PAD A;  1SP4 B;  2HD5 A;  3H6S A;  5K16 A;  2P0R A;  2DC9 A;  3IUT A;  4N8W A;  2VHS A;  1QDQ A;  2AYN A;  2YJ9 A;  5F02 A;  2VFC A;  3HWN A;  1Y4H A;  1GEC E;  4CDC B;  2XU5 A;  4CZW A;  2F1G A;  3P5V A;  1O0E A;  3U8E A;  4B55 A;  1AYV A;  3MHH A;  2P86 A;  3OVX A;  5CVN B;  4RY2 A;  4BGF A;  1SNK A;  3ZUA A;  5CHV A;  1W6F A;  4DMX A;  1NQC A;  3AI8 A;  3I3T A;  2OZ2 A;  1CS8 A;  3BOW A;  4KLB A;  2WBF X;  4QH6 A;  2DJF B;  3LTW A;  1A6R A;  2R9F A;  3KWZ A;  2ATO A;  4I07 A;  4XUI A;  3RVW A;  2B1N A;  2PRE A;  1PAD A;  2DCA A;  4YYR A;  3K9M A;  1Q6K A;  1AYU A;  3KSE A;  4X6H A;  2DC8 A;  3DF0 A;  1X9Y A;  4BS6 A;  4Q8G A;  2FTD A;  1DF0 A;  2FYE A;  3K24 A;  3I06 A;  1NB5 A;  3OVZ A;  1GCB A;  1KFU L;  1NL6 A;  4C5P A;  4AXM A;  1AYW A;  1KHQ A;  1AIM A;  1U9W A;  3QT4 A;  3KKU A;  4MZO A;  2HXZ A;  1M6D A;  1ZCM A;  2B1M A;  1ITO A;  2C0Y A;  3HHI A;  1U9Q X;  2DCB A;  4N79 A;  4I05 A;  3KFQ A;  2Y6E A;  3CBJ A;  2AYO A;  1GMY A;  2YJB A;  2VFB A;  1AU0 A;  2R9C A;  3S3R A;  2CIO A;  1PXV A;  4W5C A;  4HWY A;  2OP3 A;  5J94 A;  2NQA A;  2XU1 A;  3OIS A;  2FUD A;  3MHS A;  5EGW A;  2IPP B;  4PAD A;  1EWO A;  4G54 A;  8PCH A;  4CDE B;  4Q8H A;  1MEM A;  2E02 A;  3OF9 A;  3MTN A;  3F5V A;  7PCK A;  3GCB A;  5CVO B;  1MIR A;  3USV A;  1QXP A;  2FO5 A;  3RVV A;  1NPZ A;  2E03 A;  1ICF A;  1TL9 A;  4NV7 A;  1GLO A;  2DZY A;  5JA7 A;  2NQI A;  1AU3 A;  4FIP A;  3QSD A;  3S3Q A;  3D9W A;  2XU3 A;  6PAD A;  3BWK A;  5CVM A;  1XKG A;  1F29 A;  3HD3 A;  2G8J A;  1QMY A;  3P5W A;  2XU4 A;  4W5B A;  5A24 A;  1U5I A;  5EF4 A;  1CQD A;  1E2T A;  4DMY A;  4X6I A;  4CDF B;  9PAP A;  1KXR A;  4K7C A;  3IV2 A;  3BPM A;  2DJG B;  1AU2 A;  3N3K A;  1F2B A;  1ME4 A;  1MS6 A;  3P5X A;  1EF7 A;  1K3B B;  2AUX A;  3H8B A;  3BPF A;  1NLJ A;  4XR7 A;  4X6J A;  1STF E;  2G6D A;  4BSQ A;  1U9V A;  2AVW A;  1S4V A;  1KFX L;  1POP A;  3CBK A;  1TU6 A;  2G7Y A;  3TNX A;  3N4C A;  3KX1 A;  3H89 A;  4YYU A;  1AEC A;  3V6E A;  1EWP A;  1DEU A;  3C9E A;  4BPV A;  3WXG A;  4PI3 A;  1ME3 A;  1YT7 A;  4CDD B;  1TLO A;  2Y5B A;  4YYQ A;  4QRG A;  1PCI A;  1PPP A;  1THE A;  1EWM A;  1BY8 A;  2GFO A;  3O0U A;  1PPN A;  4NV8 A;  2FRQ A;  2PNS A;  3K8U A;  2NQD B;  2DCD A;  2CB5 A;  4I04 A;  5CHT A;  1F2A A;  3MOR A;  1ZIV A;  3RVX A;  1BGO A;  1JQP A;  3B79 A;  1CVZ A;  2OUL A;  4QRX A;  2YJ2 A;  4W4U A;  2GHU A;  3KW9 A;  3QJ3 A;  4P6E A;  1U9X A;  3WXF A;  2AU1 A;  1YK7 A;  3M99 A;  4ZUX U;  1CJL A;  2R9M A;  4BS5 A;  1F2C A;  2G8E A;  3IOQ A;  4FJC A;  4OEL A;  2YJ8 A;  4MSX A;  4P6G A;  1ATK A;  1YK8 A;  2F7D A;  3BC3 A;  3IMA A;  5FPW A;  1MDW A;  4WA6 A;  3E1Z B;  3OF8 A;  1AU4 A;  4QBB A;  2R9N A;  2DC6 A;  1PE6 A;  1CPJ A;  2AS8 A;  5JH3 A;  2PBH A;  2VHF A;  2HH5 A;  1YVB A;  2R6N A;  1BP4 A;  2HHN A;  1CTE A;  2O6X A;  3IHP A;  4PP2 E;  1KHP A;  2BDZ A;  2FT2 A;  1MEG A;  2AIM A;  2H7J A;  4GUZ A;  1Y08 A;  1PBH A;  2E00 A;  1EWL A;  2FQ9 A;  1PPD A;  3P5U A;  1W4T A;  3IEJ A;  1CB5 A;  3WXE A;  3D6S A;  1PIP A;  4YV8 A;  1FH0 A;  3H7D A;  2P7U A;  3H8C A;  3CH2 X;  2E01 A;  4YYW A;  3PW3 A;  1CSB B;  3PBH A;  1IWD A;  4OEM A;  2BSZ A;  4PP1 A;  1BQI A;  3HHA A;  1NB3 A;  1MHW A;  1VSN A;  4N4Z A;  4BQV A;  3ERV A;  1PPO A;  1W5R A;  1YAL A;  3O1G A;  1VJV A;  4FK5 A;  2YJC A;  1GX3 A;  2JQF R;  2DCC A;  3LFY A;  2ACT A;  2AUZ A;  3CH3 X;  1HUC B;  3F75 A;  1CV8 A;  3PDF A;  4YVA A;  4YYS A;  4QRV A;  1QOL A;  3KWB X;  3N3G A;  2ARY A;  3NHE A;  2BDL A;  3BCN A;  4YYV A;  2NQG A;  2DZZ A;  4MZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...