2BDLA

Cathepsin k complexed with a pyrrolidine ketoamide-based inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel, potent P2-P3 pyrrolidine derivatives of ketoamide-based cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2bdlA00
4QRVA 2XU3A 1CV8A 2DCCA 2JQGR 1AECA 5F02A 1DF0A 3CBKA 1F2BA 3BC3A 1ZIVA 3PNRA 2G6DA 3E1ZB 1CPJA 2AUZA 2DCBA 2FUDA 4X6JA 3ZUAA 1K3BB 3BCNA 3HD3A 2AYOA 1YALA 2PADA 2G8EA 3K24A 1QMYA 3QSDA 1XKGA 5J94A 4BSQA 4W5BA 4QH6A 5FPWA 5EGWA 3WXGA 7PCKA 2P86A 4OEMA 1MEMA 3MHHA 1THEA 1Y08A 1U5IA 2G7YA 2E02A 1M6DA 1F2CA 3PBHA 3BPFA 1CSBB 4YYWA 1NB5A 2AVWA 4AXMA 2HH5A 1NL6A 3H7DA 4KLBA 4YV8A 2AS8A 2AIMA 4N4ZA 3H6SA 4CDFB 3TNXA 1MIRA 5K16A 5CVMA 1ME3A 1U9WA 2DCAA 2VHFA 3V6CA 3CBJA 2BDLA 2DC6A 2DCDA 1YT7A 3H8CA 1BQIA 4CDEB 4YYVA 1O0EA 1CVZA 1PBHA 9PAPA 3OF9A 4X6IA 3IEJA 1MHWA 3B79A 3M99A 1IWDA 3MORA 4YYUA 6PADA 1PIPA 3CH2X 3IMAA 3N3KA 1AIMA 3P5UA 1TU6A 3I3TA 4X6HA 1EWOA 4YYRA 2HXZA 1SP4B 2AU1A 3P5XA 5CVOB 4Q8GA 1PPDA 3O1GA 4MZOA 2R6NA 4CDDB 2CIOA 3KWZA 2B1NA 2H7JA 3CH3X 1JQPA 2DZYA 1KXRA 2FRAA 2FYEA 2P0RA 5CHVA 1KFUL 4BS6A 3BOWA 2IPPB 4YYSA 1SNKA 1PCIA 4OELA 1PPNA 3NHEA 1PE6A 1KHPA 4K7CA 3IUTA 4BPVA 3RVXA 2NQIA 4PADA 1BGOA 3RVWA 2PNSA 1ZCMA 2R9CA 3MHSA 4MZSA 3IV2A 3K8UA 3S3RA 5JH3A 1GECE 1AYWA 3OF8A 2F7DA 2XU1A 3BPMA 3MTNA 4RY2A 3KFQA 1QOLA 1YVBA 3I06A 1Q6KA 4I05A 5A24A 2Y5BA 2OZ2A 2DJFB 2FQ9A 3OISA 2G8JA 2PREA 2HD5A 4YYQA 4P6EA 3N4CA 3AI8A 5CHTA 3H8BA 2DC7A 3K9MA 3OVXA 3U8EA 1PPOA 4FK5A 4WA6A 4BQVA 1DEUA 3USVA 4W4UA 3IHPA 4CDCB 2NQAA 3BWKA 2DJGB 2R9NA 1U9QX 5PADA 4FIPA 4G54A 1GMYA 1U9XA 1EWLA 1MS6A 2OULA 1QXPA 1STFE 4I04A 2O6XA 2YJCA 3HHIA 2AUXA 1YK8A 1AU4A 3KWBX 1PPPA 3P5WA 1U9VA 1AYVA 1NB3A 1TL9A 5JA7A 4ZUXU 3QJ3A 2NQGA 3O0UA 4QRGA 2NQDB 3GCBA 3KSEA 4BS5A 2C0YA 4AXLA 1MEGA 1AU2A 2CB5A 1HUCB 4HWYA 2AYNA 2GHUA 2R9FA 4MSXA 4DMYA 4YVAA 1CJLA 2IBIA 1ICFA 2OP3A 2B1MA 1S4VA 2HHNA 1KHQA 1NLJA 1ATKA 2Y6EA 1PADA 2DC9A 3KX1A 8PCHA 2YJ8A 1AYUA 1GCBA 2PBHA 2YJBA 2YJ9A 2F1GA 4CZWA 1QDQA 4FJCA 2ARYA 1MDWA 2R9MA 4DMXA 1CB5A 2GFOA 1FH0A 2WBFX 2YJ2A 1EWMA 3D6SA 1ITOA 3KW9A 3OVZA 1BP4A 1EF7A 3PDFA 4PP2E 1Y4HA 1CS8A 1KFXL 4XUIA 3RVVA 3HWNA 4QRXA 3WXEA 3V6EA 3WXFA 2XU5A 2BDZA 2ATOA 3PW3A 2R9OA 1F2AA 2P7UA 1TLOA 2FO5A 2XU4A 3DF0A 3LFYA 2FTDA 1VJVA 3IOQA 3C9EA 1VSNA 3F75A 4PP1A 1PXVA 2DC8A 3S3QA 1CQDA 2DZZA 3N3GA 1POPA 1F29A 2E00A 3ERVA 4Q8HA 1NQCA 5EF4A 2JQFR 3P5VA 4PI3A 1YK7A 1AU0A 1EWPA 3QT4A 4I07A 2VHSA 1GLOA 4XR7A 5CVNB 3KKUA 1AU3A 1X9YA 2E03A 2E01A 1A6RA 3H89A 4N79A 2FT2A 3HHAA 1NPZA 3LXSA 3F5VA 2ACTA 2FRQA 4QBBA 4P6GA 1CTEA 4N8WA 1ME4A 4W5CA 1BY8A
chains in the Genus database with same CATH superfamily
4QRVA 2XU3A 1CV8A 2DCCA 2JQGR 1AECA 5F02A 1DF0A 3CBKA 1F2BA 3BC3A 1ZIVA 3PNRA 2G6DA 4BOUA 3E1ZB 1CPJA 2AUZA 2DCBA 2FUDA 4X6JA 3ZUAA 1K3BB 3BCNA 3HD3A 2AYOA 1YALA 2PADA 2G8EA 3K24A 1QMYA 3QSDA 1XKGA 5J94A 4BSQA 4W5BA 4QH6A 5FPWA 3ZNHA 5EGWA 3WXGA 3B21A 7PCKA 2P86A 4OEMA 4RF1A 1MEMA 1YZBA 3MHHA 1THEA 1Y08A 1U5IA 2G7YA 2E02A 1M6DA 3IFUA 1F2CA 3PBHA 3BPFA 1CSBB 4YYWA 1NB5A 2AVWA 4AXMA 2HH5A 1NL6A 3H7DA 4D8IA 4KLBA 4YV8A 2AS8A 2AIMA 4N4ZA 3BY4A 3H6SA 4CDFB 3PSEA 3TNXA 1MIRA 5K16A 5CVMA 1ME3A 1U9WA 2DCAA 2VHFA 4XZXA 3V6CA 4R3DA 3CBJA 2BDLA 2DC6A 2DCDA 1YT7A 3H8CA 1BQIA 4CDEB 4YYVA 1O0EA 1CVZA 1PBHA 9PAPA 3OF9A 4X6IA 3IEJA 4BOQA 1MHWA 3B79A 3M99A 1IWDA 3MORA 4YYUA 6PADA 1PIPA 2J7QA 3CH2X 3IMAA 3N3KA 1AIMA 3P5UA 1TU6A 3O65A 3I3TA 4X6HA 1UKFA 2BU3A 1EWOA 4OVZA 4YYRA 2HXZA 1SP4B 2AU1A 3P5XA 5CVOB 4Q8GA 1PPDA 3O1GA 4MZOA 2R6NA 4CDDB 2CIOA 4D8BA 3KWZA 2B1NA 2H7JA 3CH3X 1JQPA 2DZYA 1DKIA 1KXRA 2FRAA 2FYEA 2P0RA 5CHVA 4P16A 1KFUL 4ZTBA 4BS6A 3BOWA 2IPPB 4M0WA 4YYSA 1SNKA 1PCIA 4OELA 1PPNA 3NHEA 1PE6A 4W5CA 1KHPA 4K7CA 3IUTA 4BPVA 3RVXA 2NQIA 4PADA 1BGOA 4OVZB 3RVWA 2PNSA 1ZCMA 4IP3A 2R9CA 3MHSA 4MZSA 4RF0A 3IV2A 3K8UA 3S3RA 5JH3A 1GECE 1AYWA 3OF8A 3RNVA 2F7DA 2XU1A 3BPMA 4D8EA 3MTNA 4RY2A 2J7QC 3KFQA 1QOLA 1YVBA 3I06A 1Q6KA 4I05A 5A24A 2Y5BA 2OZ2A 2DJFB 2FQ9A 3OISA 2G8JA 2PREA 2Z84A 2HD5A 4YYQA 4A5UA 4P6EA 3N4CA 3AI8A 5CHTA 4BOPA 4MI7A 1PVJA 2AGAA 3H8BA 2DC7A 4BOZA 3K9MA 3OVXA 3U8EA 1PPOA 3W30A 4FK5A 4WA6A 4GUAA 4BQVA 1DEUA 3USVA 4W4UA 3IHPA 4RNAA 4CDCB 2NQAA 3BWKA 2DJGB 2R9NA 1U9QX 5PADA 4WURA 4FIPA 3BBAA 4G54A 1GMYA 1U9XA 4PT5A 1EWLA 1MS6A 2OULA 1QXPA 1STFE 4I04A 3PT2A 2O6XA 2YJCA 2BTWA 3HHIA 2UZJA 2AUXA 4RKXA 1YK8A 4MM3B 3W31A 1AU4A 3KWBX 4REZA 1PPPA 3P5WA 1U9VA 1AYVA 1NB3A 1TL9A 5JA7A 4ZUXU 3QJ3A 2NQGA 3O0UA 4QRGA 2NQDB 3GCBA 2BTWB 3BB7A 3KSEA 4BS5A 2C0YA 4AXLA 1MEGA 1AU2A 2CB5A 4HWYA 2AYNA 2GHUA 2R9FA 4MSXA 3OQCA 4DMYA 4YVAA 1CJLA 2IBIA 1ICFA 2OP3A 2B1MA 1S4VA 3PRMA 2HHNA 1KHQA 2FE8A 1NLJA 3E9SA 1ATKA 2Y6EA 1PADA 2DC9A 3KX1A 8PCHA 2YJ8A 5E6JA 1AYUA 1GCBA 2PBHA 2YJBA 5EZSA 2YJ9A 4HXDB 2F1GA 4CZWA 1QDQA 4FJCA 3MTVA 2ARYA 1MDWA 2R9MA 4DMXA 1CB5A 2GFOA 2JRIA 1FH0A 2WBFX 2YJ2A 1EWMA 3D6SA 1ITOA 3KW9A 3OVZA 3TRKA 1BP4A 1EF7A 3PDFA 4PP2E 1Y4HA 3TMPA 1CS8A 1KFXL 4XUIA 3RVVA 3HWNA 4QRXA 3WXEA 3V6EA 3WXFA 2XU5A 2BDZA 2JTCA 2ATOA 3PW3A 2R9OA 1F2AA 2P7UA 1TLOA 2FO5A 2XU4A 3DF0A 3LFYA 2FTDA 1VJVA 3IOQA 3C9EA 3PRPA 1VSNA 3F75A 4PP1A 5JZEA 2DOSA 1PXVA 2DC8A 3S3QA 1CQDA 2DZZA 3N3GA 1POPA 3PHWA 3MP2A 1F29A 2E00A 3ERVA 4Q8HA 1NQCA 5EF4A 2JQFR 3P5VA 4PI3A 1YK7A 1AU0A 2HWKA 1EWPA 3QT4A 3PHXA 4I07A 2VHSA 1GLOA 4XR7A 5CVNB 3KKUA 5EZQA 1AU3A 1X9YA 4IUMA 2E03A 2E01A 3C0RA 1A6RA 3H89A 4N79A 2FT2A 3HHAA 1NPZA 3LXSA 3F5VA 5KO3A 4BOSA 2ACTA 2FRQA 3PHUA 4OW0A 4QBBA 4P6GA 1CTEA 4N8WA 1ME4A 1HUCB 1BY8A 3MJ5A
chains in the Genus database with same CATH topology
4QRVA 2XU3A 1CV8A 2DCCA 2JQGR 1AECA 5F02A 1DF0A 3CBKA 1F2BA 3BC3A 1ZIVA 3PNRA 2G6DA 3E1ZB 1CPJA 2AUZA 2DCBA 2VFCA 2FUDA 4X6JA 3ZUAA 1K3BB 3BCNA 3HD3A 2AYOA 1YALA 2PADA 2G8EA 3K24A 1QMYA 3QSDA 1XKGA 5J94A 4BSQA 4W5BA 4QH6A 5FPWA 5EGWA 3WXGA 7PCKA 2P86A 4OEMA 1MEMA 3MHHA 1THEA 1Y08A 1U5IA 2G7YA 2E02A 1M6DA 4GUZA 1F2CA 3PBHA 3BPFA 1CSBB 4YYWA 1NB5A 2AVWA 4AXMA 2HH5A 1NL6A 3H7DA 4KLBA 4YV8A 2AS8A 1W5RA 2AIMA 4N4ZA 3H6SA 4CDFB 3TNXA 1MIRA 5K16A 5CVMA 1ME3A 1U9WA 2DCAA 2VHFA 4BGFA 1W6FA 3V6CA 3CBJA 2BDLA 2DC6A 2DCDA 1YT7A 3H8CA 1BQIA 4CDEB 4YYVA 1O0EA 1CVZA 1PBHA 9PAPA 3OF9A 4X6IA 3IEJA 1MHWA 3B79A 3M99A 1IWDA 3MORA 4YYUA 6PADA 2BSZA 3D9WA 1PIPA 3CH2X 3IMAA 3N3KA 1AIMA 4NV8A 3P5UA 1TU6A 3I3TA 4X6HA 1EWOA 4YYRA 2HXZA 1SP4B 2AU1A 3P5XA 5CVOB 4Q8GA 1PPDA 3O1GA 4MZOA 2R6NA 4CDDB 2CIOA 3KWZA 2B1NA 2H7JA 3CH3X 1JQPA 2DZYA 4B55A 1KXRA 2FRAA 2FYEA 2P0RA 5CHVA 4C5PA 1KFUL 4BS6A 1E2TA 3BOWA 2IPPB 4YYSA 1SNKA 1PCIA 4OELA 1PPNA 3NHEA 1PE6A 1KHPA 4K7CA 3IUTA 4BPVA 3RVXA 2NQIA 4PADA 1BGOA 3RVWA 2PNSA 1ZCMA 1GX3A 2R9CA 3MHSA 4MZSA 3IV2A 3K8UA 3S3RA 5JH3A 1GECE 1AYWA 3OF8A 2F7DA 2XU1A 3BPMA 3MTNA 4RY2A 3KFQA 1QOLA 1YVBA 3I06A 1Q6KA 4I05A 5A24A 2Y5BA 2OZ2A 2DJFB 2FQ9A 3OISA 2G8JA 2PREA 2HD5A 4YYQA 4P6EA 3N4CA 1W4TA 3AI8A 5CHTA 3H8BA 2DC7A 4NV7A 3K9MA 3OVXA 3U8EA 1PPOA 4FK5A 4WA6A 4BQVA 1DEUA 3USVA 4W4UA 3IHPA 4CDCB 2NQAA 3BWKA 2DJGB 2R9NA 1U9QX 5PADA 2VFBA 4FIPA 4G54A 1GMYA 1U9XA 1EWLA 1MS6A 2OULA 1QXPA 1STFE 4I04A 2O6XA 2YJCA 3HHIA 2AUXA 1YK8A 1AU4A 3KWBX 1PPPA 3P5WA 1U9VA 1AYVA 1NB3A 1TL9A 5JA7A 4ZUXU 3QJ3A 2NQGA 3O0UA 4QRGA 2NQDB 3GCBA 3KSEA 4BS5A 2C0YA 4AXLA 1MEGA 1AU2A 2CB5A 1HUCB 4HWYA 2AYNA 2GHUA 2R9FA 4MSXA 4DMYA 4YVAA 1CJLA 2IBIA 1ICFA 2OP3A 2B1MA 1S4VA 2HHNA 1KHQA 1NLJA 3LTWA 1ATKA 2Y6EA 1PADA 2DC9A 3KX1A 8PCHA 2YJ8A 1AYUA 1GCBA 2PBHA 2YJBA 2YJ9A 2F1GA 4CZWA 1QDQA 4FJCA 2ARYA 1MDWA 2R9MA 4DMXA 1CB5A 2GFOA 1FH0A 2WBFX 2YJ2A 1EWMA 3D6SA 1ITOA 3KW9A 3OVZA 1BP4A 1EF7A 3PDFA 4PP2E 1Y4HA 1CS8A 1KFXL 4XUIA 3RVVA 3HWNA 4QRXA 3WXEA 3V6EA 3WXFA 2XU5A 2BDZA 2ATOA 3PW3A 2R9OA 1F2AA 2P7UA 1TLOA 2FO5A 2XU4A 3DF0A 3LFYA 2FTDA 1VJVA 3IOQA 3C9EA 1VSNA 3F75A 4PP1A 1PXVA 2DC8A 3S3QA 1CQDA 2DZZA 3N3GA 1POPA 1F29A 2E00A 3ERVA 4Q8HA 1NQCA 5EF4A 2JQFR 3P5VA 4PI3A 1YK7A 1AU0A 1EWPA 3QT4A 4I07A 2VHSA 1GLOA 4XR7A 5CVNB 3KKUA 1AU3A 1X9YA 2E03A 2E01A 1A6RA 3H89A 4N79A 2FT2A 3HHAA 1NPZA 3LXSA 3F5VA 2ACTA 2FRQA 4QBBA 4P6GA 1CTEA 4N8WA 1ME4A 4W5CA 1BY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRV A;  2XU3 A;  1CV8 A;  2DCC A;  2JQG R;  1AEC A;  5F02 A;  1DF0 A;  3CBK A;  1F2B A;  3BC3 A;  1ZIV A;  3PNR A;  2G6D A;  3E1Z B;  1CPJ A;  2AUZ A;  2DCB A;  2FUD A;  4X6J A;  3ZUA A;  1K3B B;  3BCN A;  3HD3 A;  2AYO A;  1YAL A;  2PAD A;  2G8E A;  3K24 A;  1QMY A;  3QSD A;  1XKG A;  5J94 A;  4BSQ A;  4W5B A;  4QH6 A;  5FPW A;  5EGW A;  3WXG A;  7PCK A;  2P86 A;  4OEM A;  1MEM A;  3MHH A;  1THE A;  1Y08 A;  1U5I A;  2G7Y A;  2E02 A;  1M6D A;  1F2C A;  3PBH A;  3BPF A;  1CSB B;  4YYW A;  1NB5 A;  2AVW A;  4AXM A;  2HH5 A;  1NL6 A;  3H7D A;  4KLB A;  4YV8 A;  2AS8 A;  2AIM A;  4N4Z A;  3H6S A;  4CDF B;  3TNX A;  1MIR A;  5K16 A;  5CVM A;  1ME3 A;  1U9W A;  2DCA A;  2VHF A;  3V6C A;  3CBJ A;  2BDL A;  2DC6 A;  2DCD A;  1YT7 A;  3H8C A;  1BQI A;  4CDE B;  4YYV A;  1O0E A;  1CVZ A;  1PBH A;  9PAP A;  3OF9 A;  4X6I A;  3IEJ A;  1MHW A;  3B79 A;  3M99 A;  1IWD A;  3MOR A;  4YYU A;  6PAD A;  1PIP A;  3CH2 X;  3IMA A;  3N3K A;  1AIM A;  3P5U A;  1TU6 A;  3I3T A;  4X6H A;  1EWO A;  4YYR A;  2HXZ A;  1SP4 B;  2AU1 A;  3P5X A;  5CVO B;  4Q8G A;  1PPD A;  3O1G A;  4MZO A;  2R6N A;  4CDD B;  2CIO A;  3KWZ A;  2B1N A;  2H7J A;  3CH3 X;  1JQP A;  2DZY A;  1KXR A;  2FRA A;  2FYE A;  2P0R A;  5CHV A;  1KFU L;  4BS6 A;  3BOW A;  2IPP B;  4YYS A;  1SNK A;  1PCI A;  4OEL A;  1PPN A;  3NHE A;  1PE6 A;  1KHP A;  4K7C A;  3IUT A;  4BPV A;  3RVX A;  2NQI A;  4PAD A;  1BGO A;  3RVW A;  2PNS A;  1ZCM A;  2R9C A;  3MHS A;  4MZS A;  3IV2 A;  3K8U A;  3S3R A;  5JH3 A;  1GEC E;  1AYW A;  3OF8 A;  2F7D A;  2XU1 A;  3BPM A;  3MTN A;  4RY2 A;  3KFQ A;  1QOL A;  1YVB A;  3I06 A;  1Q6K A;  4I05 A;  5A24 A;  2Y5B A;  2OZ2 A;  2DJF B;  2FQ9 A;  3OIS A;  2G8J A;  2PRE A;  2HD5 A;  4YYQ A;  4P6E A;  3N4C A;  3AI8 A;  5CHT A;  3H8B A;  2DC7 A;  3K9M A;  3OVX A;  3U8E A;  1PPO A;  4FK5 A;  4WA6 A;  4BQV A;  1DEU A;  3USV A;  4W4U A;  3IHP A;  4CDC B;  2NQA A;  3BWK A;  2DJG B;  2R9N A;  1U9Q X;  5PAD A;  4FIP A;  4G54 A;  1GMY A;  1U9X A;  1EWL A;  1MS6 A;  2OUL A;  1QXP A;  1STF E;  4I04 A;  2O6X A;  2YJC A;  3HHI A;  2AUX A;  1YK8 A;  1AU4 A;  3KWB X;  1PPP A;  3P5W A;  1U9V A;  1AYV A;  1NB3 A;  1TL9 A;  5JA7 A;  4ZUX U;  3QJ3 A;  2NQG A;  3O0U A;  4QRG A;  2NQD B;  3GCB A;  3KSE A;  4BS5 A;  2C0Y A;  4AXL A;  1MEG A;  1AU2 A;  2CB5 A;  1HUC B;  4HWY A;  2AYN A;  2GHU A;  2R9F A;  4MSX A;  4DMY A;  4YVA A;  1CJL A;  2IBI A;  1ICF A;  2OP3 A;  2B1M A;  1S4V A;  2HHN A;  1KHQ A;  1NLJ A;  1ATK A;  2Y6E A;  1PAD A;  2DC9 A;  3KX1 A;  8PCH A;  2YJ8 A;  1AYU A;  1GCB A;  2PBH A;  2YJB A;  2YJ9 A;  2F1G A;  4CZW A;  1QDQ A;  4FJC A;  2ARY A;  1MDW A;  2R9M A;  4DMX A;  1CB5 A;  2GFO A;  1FH0 A;  2WBF X;  2YJ2 A;  1EWM A;  3D6S A;  1ITO A;  3KW9 A;  3OVZ A;  1BP4 A;  1EF7 A;  3PDF A;  4PP2 E;  1Y4H A;  1CS8 A;  1KFX L;  4XUI A;  3RVV A;  3HWN A;  4QRX A;  3WXE A;  3V6E A;  3WXF A;  2XU5 A;  2BDZ A;  2ATO A;  3PW3 A;  2R9O A;  1F2A A;  2P7U A;  1TLO A;  2FO5 A;  2XU4 A;  3DF0 A;  3LFY A;  2FTD A;  1VJV A;  3IOQ A;  3C9E A;  1VSN A;  3F75 A;  4PP1 A;  1PXV A;  2DC8 A;  3S3Q A;  1CQD A;  2DZZ A;  3N3G A;  1POP A;  1F29 A;  2E00 A;  3ERV A;  4Q8H A;  1NQC A;  5EF4 A;  2JQF R;  3P5V A;  4PI3 A;  1YK7 A;  1AU0 A;  1EWP A;  3QT4 A;  4I07 A;  2VHS A;  1GLO A;  4XR7 A;  5CVN B;  3KKU A;  1AU3 A;  1X9Y A;  2E03 A;  2E01 A;  1A6R A;  3H89 A;  4N79 A;  2FT2 A;  3HHA A;  1NPZ A;  3LXS A;  3F5V A;  2ACT A;  2FRQ A;  4QBB A;  4P6G A;  1CTE A;  4N8W A;  1ME4 A;  4W5C A;  1BY8 A; 
#chains in the Genus database with same CATH topology
 4QRV A;  2XU3 A;  1CV8 A;  2DCC A;  2JQG R;  1AEC A;  5F02 A;  1DF0 A;  3CBK A;  1F2B A;  3BC3 A;  1ZIV A;  3PNR A;  2G6D A;  4BOU A;  3E1Z B;  1CPJ A;  2AUZ A;  2DCB A;  2FUD A;  4X6J A;  3ZUA A;  1K3B B;  3BCN A;  3HD3 A;  2AYO A;  1YAL A;  2PAD A;  2G8E A;  3K24 A;  1QMY A;  3QSD A;  1XKG A;  5J94 A;  4BSQ A;  4W5B A;  4QH6 A;  5FPW A;  3ZNH A;  5EGW A;  3WXG A;  3B21 A;  7PCK A;  2P86 A;  4OEM A;  4RF1 A;  1MEM A;  1YZB A;  3MHH A;  1THE A;  1Y08 A;  1U5I A;  2G7Y A;  2E02 A;  1M6D A;  3IFU A;  1F2C A;  3PBH A;  3BPF A;  1CSB B;  4YYW A;  1NB5 A;  2AVW A;  4AXM A;  2HH5 A;  1NL6 A;  3H7D A;  4D8I A;  4KLB A;  4YV8 A;  2AS8 A;  2AIM A;  4N4Z A;  3BY4 A;  3H6S A;  4CDF B;  3PSE A;  3TNX A;  1MIR A;  5K16 A;  5CVM A;  1ME3 A;  1U9W A;  2DCA A;  2VHF A;  4XZX A;  3V6C A;  4R3D A;  3CBJ A;  2BDL A;  2DC6 A;  2DCD A;  1YT7 A;  3H8C A;  1BQI A;  4CDE B;  4YYV A;  1O0E A;  1CVZ A;  1PBH A;  9PAP A;  3OF9 A;  4X6I A;  3IEJ A;  4BOQ A;  1MHW A;  3B79 A;  3M99 A;  1IWD A;  3MOR A;  4YYU A;  6PAD A;  1PIP A;  2J7Q A;  3CH2 X;  3IMA A;  3N3K A;  1AIM A;  3P5U A;  1TU6 A;  3O65 A;  3I3T A;  4X6H A;  1UKF A;  2BU3 A;  1EWO A;  4OVZ A;  4YYR A;  2HXZ A;  1SP4 B;  2AU1 A;  3P5X A;  5CVO B;  4Q8G A;  1PPD A;  3O1G A;  4MZO A;  2R6N A;  4CDD B;  2CIO A;  4D8B A;  3KWZ A;  2B1N A;  2H7J A;  3CH3 X;  1JQP A;  2DZY A;  1DKI A;  1KXR A;  2FRA A;  2FYE A;  2P0R A;  5CHV A;  4P16 A;  1KFU L;  4ZTB A;  4BS6 A;  3BOW A;  2IPP B;  4M0W A;  4YYS A;  1SNK A;  1PCI A;  4OEL A;  1PPN A;  3NHE A;  1PE6 A;  4W5C A;  1KHP A;  4K7C A;  3IUT A;  4BPV A;  3RVX A;  2NQI A;  4PAD A;  1BGO A;  4OVZ B;  3RVW A;  2PNS A;  1ZCM A;  4IP3 A;  2R9C A;  3MHS A;  4MZS A;  4RF0 A;  3IV2 A;  3K8U A;  3S3R A;  5JH3 A;  1GEC E;  1AYW A;  3OF8 A;  3RNV A;  2F7D A;  2XU1 A;  3BPM A;  4D8E A;  3MTN A;  4RY2 A;  2J7Q C;  3KFQ A;  1QOL A;  1YVB A;  3I06 A;  1Q6K A;  4I05 A;  5A24 A;  2Y5B A;  2OZ2 A;  2DJF B;  2FQ9 A;  3OIS A;  2G8J A;  2PRE A;  2Z84 A;  2HD5 A;  4YYQ A;  4A5U A;  4P6E A;  3N4C A;  3AI8 A;  5CHT A;  4BOP A;  4MI7 A;  1PVJ A;  2AGA A;  3H8B A;  2DC7 A;  4BOZ A;  3K9M A;  3OVX A;  3U8E A;  1PPO A;  3W30 A;  4FK5 A;  4WA6 A;  4GUA A;  4BQV A;  1DEU A;  3USV A;  4W4U A;  3IHP A;  4RNA A;  4CDC B;  2NQA A;  3BWK A;  2DJG B;  2R9N A;  1U9Q X;  5PAD A;  4WUR A;  4FIP A;  3BBA A;  4G54 A;  1GMY A;  1U9X A;  4PT5 A;  1EWL A;  1MS6 A;  2OUL A;  1QXP A;  1STF E;  4I04 A;  3PT2 A;  2O6X A;  2YJC A;  2BTW A;  3HHI A;  2UZJ A;  2AUX A;  4RKX A;  1YK8 A;  4MM3 B;  3W31 A;  1AU4 A;  3KWB X;  4REZ A;  1PPP A;  3P5W A;  1U9V A;  1AYV A;  1NB3 A;  1TL9 A;  5JA7 A;  4ZUX U;  3QJ3 A;  2NQG A;  3O0U A;  4QRG A;  2NQD B;  3GCB A;  2BTW B;  3BB7 A;  3KSE A;  4BS5 A;  2C0Y A;  4AXL A;  1MEG A;  1AU2 A;  2CB5 A;  4HWY A;  2AYN A;  2GHU A;  2R9F A;  4MSX A;  3OQC A;  4DMY A;  4YVA A;  1CJL A;  2IBI A;  1ICF A;  2OP3 A;  2B1M A;  1S4V A;  3PRM A;  2HHN A;  1KHQ A;  2FE8 A;  1NLJ A;  3E9S A;  1ATK A;  2Y6E A;  1PAD A;  2DC9 A;  3KX1 A;  8PCH A;  2YJ8 A;  5E6J A;  1AYU A;  1GCB A;  2PBH A;  2YJB A;  5EZS A;  2YJ9 A;  4HXD B;  2F1G A;  4CZW A;  1QDQ A;  4FJC A;  3MTV A;  2ARY A;  1MDW A;  2R9M A;  4DMX A;  1CB5 A;  2GFO A;  2JRI A;  1FH0 A;  2WBF X;  2YJ2 A;  1EWM A;  3D6S A;  1ITO A;  3KW9 A;  3OVZ A;  3TRK A;  1BP4 A;  1EF7 A;  3PDF A;  4PP2 E;  1Y4H A;  3TMP A;  1CS8 A;  1KFX L;  4XUI A;  3RVV A;  3HWN A;  4QRX A;  3WXE A;  3V6E A;  3WXF A;  2XU5 A;  2BDZ A;  2JTC A;  2ATO A;  3PW3 A;  2R9O A;  1F2A A;  2P7U A;  1TLO A;  2FO5 A;  2XU4 A;  3DF0 A;  3LFY A;  2FTD A;  1VJV A;  3IOQ A;  3C9E A;  3PRP A;  1VSN A;  3F75 A;  4PP1 A;  5JZE A;  2DOS A;  1PXV A;  2DC8 A;  3S3Q A;  1CQD A;  2DZZ A;  3N3G A;  1POP A;  3PHW A;  3MP2 A;  1F29 A;  2E00 A;  3ERV A;  4Q8H A;  1NQC A;  5EF4 A;  2JQF R;  3P5V A;  4PI3 A;  1YK7 A;  1AU0 A;  2HWK A;  1EWP A;  3QT4 A;  3PHX A;  4I07 A;  2VHS A;  1GLO A;  4XR7 A;  5CVN B;  3KKU A;  5EZQ A;  1AU3 A;  1X9Y A;  4IUM A;  2E03 A;  2E01 A;  3C0R A;  1A6R A;  3H89 A;  4N79 A;  2FT2 A;  3HHA A;  1NPZ A;  3LXS A;  3F5V A;  5KO3 A;  4BOS A;  2ACT A;  2FRQ A;  3PHU A;  4OW0 A;  4QBB A;  4P6G A;  1CTE A;  4N8W A;  1ME4 A;  1HUC B;  1BY8 A;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 4QRV A;  2XU3 A;  1CV8 A;  2DCC A;  2JQG R;  1AEC A;  5F02 A;  1DF0 A;  3CBK A;  1F2B A;  3BC3 A;  1ZIV A;  3PNR A;  2G6D A;  3E1Z B;  1CPJ A;  2AUZ A;  2DCB A;  2VFC A;  2FUD A;  4X6J A;  3ZUA A;  1K3B B;  3BCN A;  3HD3 A;  2AYO A;  1YAL A;  2PAD A;  2G8E A;  3K24 A;  1QMY A;  3QSD A;  1XKG A;  5J94 A;  4BSQ A;  4W5B A;  4QH6 A;  5FPW A;  5EGW A;  3WXG A;  7PCK A;  2P86 A;  4OEM A;  1MEM A;  3MHH A;  1THE A;  1Y08 A;  1U5I A;  2G7Y A;  2E02 A;  1M6D A;  4GUZ A;  1F2C A;  3PBH A;  3BPF A;  1CSB B;  4YYW A;  1NB5 A;  2AVW A;  4AXM A;  2HH5 A;  1NL6 A;  3H7D A;  4KLB A;  4YV8 A;  2AS8 A;  1W5R A;  2AIM A;  4N4Z A;  3H6S A;  4CDF B;  3TNX A;  1MIR A;  5K16 A;  5CVM A;  1ME3 A;  1U9W A;  2DCA A;  2VHF A;  4BGF A;  1W6F A;  3V6C A;  3CBJ A;  2BDL A;  2DC6 A;  2DCD A;  1YT7 A;  3H8C A;  1BQI A;  4CDE B;  4YYV A;  1O0E A;  1CVZ A;  1PBH A;  9PAP A;  3OF9 A;  4X6I A;  3IEJ A;  1MHW A;  3B79 A;  3M99 A;  1IWD A;  3MOR A;  4YYU A;  6PAD A;  2BSZ A;  3D9W A;  1PIP A;  3CH2 X;  3IMA A;  3N3K A;  1AIM A;  4NV8 A;  3P5U A;  1TU6 A;  3I3T A;  4X6H A;  1EWO A;  4YYR A;  2HXZ A;  1SP4 B;  2AU1 A;  3P5X A;  5CVO B;  4Q8G A;  1PPD A;  3O1G A;  4MZO A;  2R6N A;  4CDD B;  2CIO A;  3KWZ A;  2B1N A;  2H7J A;  3CH3 X;  1JQP A;  2DZY A;  4B55 A;  1KXR A;  2FRA A;  2FYE A;  2P0R A;  5CHV A;  4C5P A;  1KFU L;  4BS6 A;  1E2T A;  3BOW A;  2IPP B;  4YYS A;  1SNK A;  1PCI A;  4OEL A;  1PPN A;  3NHE A;  1PE6 A;  1KHP A;  4K7C A;  3IUT A;  4BPV A;  3RVX A;  2NQI A;  4PAD A;  1BGO A;  3RVW A;  2PNS A;  1ZCM A;  1GX3 A;  2R9C A;  3MHS A;  4MZS A;  3IV2 A;  3K8U A;  3S3R A;  5JH3 A;  1GEC E;  1AYW A;  3OF8 A;  2F7D A;  2XU1 A;  3BPM A;  3MTN A;  4RY2 A;  3KFQ A;  1QOL A;  1YVB A;  3I06 A;  1Q6K A;  4I05 A;  5A24 A;  2Y5B A;  2OZ2 A;  2DJF B;  2FQ9 A;  3OIS A;  2G8J A;  2PRE A;  2HD5 A;  4YYQ A;  4P6E A;  3N4C A;  1W4T A;  3AI8 A;  5CHT A;  3H8B A;  2DC7 A;  4NV7 A;  3K9M A;  3OVX A;  3U8E A;  1PPO A;  4FK5 A;  4WA6 A;  4BQV A;  1DEU A;  3USV A;  4W4U A;  3IHP A;  4CDC B;  2NQA A;  3BWK A;  2DJG B;  2R9N A;  1U9Q X;  5PAD A;  2VFB A;  4FIP A;  4G54 A;  1GMY A;  1U9X A;  1EWL A;  1MS6 A;  2OUL A;  1QXP A;  1STF E;  4I04 A;  2O6X A;  2YJC A;  3HHI A;  2AUX A;  1YK8 A;  1AU4 A;  3KWB X;  1PPP A;  3P5W A;  1U9V A;  1AYV A;  1NB3 A;  1TL9 A;  5JA7 A;  4ZUX U;  3QJ3 A;  2NQG A;  3O0U A;  4QRG A;  2NQD B;  3GCB A;  3KSE A;  4BS5 A;  2C0Y A;  4AXL A;  1MEG A;  1AU2 A;  2CB5 A;  1HUC B;  4HWY A;  2AYN A;  2GHU A;  2R9F A;  4MSX A;  4DMY A;  4YVA A;  1CJL A;  2IBI A;  1ICF A;  2OP3 A;  2B1M A;  1S4V A;  2HHN A;  1KHQ A;  1NLJ A;  3LTW A;  1ATK A;  2Y6E A;  1PAD A;  2DC9 A;  3KX1 A;  8PCH A;  2YJ8 A;  1AYU A;  1GCB A;  2PBH A;  2YJB A;  2YJ9 A;  2F1G A;  4CZW A;  1QDQ A;  4FJC A;  2ARY A;  1MDW A;  2R9M A;  4DMX A;  1CB5 A;  2GFO A;  1FH0 A;  2WBF X;  2YJ2 A;  1EWM A;  3D6S A;  1ITO A;  3KW9 A;  3OVZ A;  1BP4 A;  1EF7 A;  3PDF A;  4PP2 E;  1Y4H A;  1CS8 A;  1KFX L;  4XUI A;  3RVV A;  3HWN A;  4QRX A;  3WXE A;  3V6E A;  3WXF A;  2XU5 A;  2BDZ A;  2ATO A;  3PW3 A;  2R9O A;  1F2A A;  2P7U A;  1TLO A;  2FO5 A;  2XU4 A;  3DF0 A;  3LFY A;  2FTD A;  1VJV A;  3IOQ A;  3C9E A;  1VSN A;  3F75 A;  4PP1 A;  1PXV A;  2DC8 A;  3S3Q A;  1CQD A;  2DZZ A;  3N3G A;  1POP A;  1F29 A;  2E00 A;  3ERV A;  4Q8H A;  1NQC A;  5EF4 A;  2JQF R;  3P5V A;  4PI3 A;  1YK7 A;  1AU0 A;  1EWP A;  3QT4 A;  4I07 A;  2VHS A;  1GLO A;  4XR7 A;  5CVN B;  3KKU A;  1AU3 A;  1X9Y A;  2E03 A;  2E01 A;  1A6R A;  3H89 A;  4N79 A;  2FT2 A;  3HHA A;  1NPZ A;  3LXS A;  3F5V A;  2ACT A;  2FRQ A;  4QBB A;  4P6G A;  1CTE A;  4N8W A;  1ME4 A;  4W5C A;  1BY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...