2BDLA

Cathepsin k complexed with a pyrrolidine ketoamide-based inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Novel, potent P2-P3 pyrrolidine derivatives of ketoamide-based cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2bdlA00
1NL6A 1POPA 1NPZA 3V6CA 2FO5A 3QT4A 4WA6A 5A24A 3K8UA 2CB5A 4OELA 5J94A 2Y6EA 4BQVA 2IPPB 1YT7A 3H6SA 3WXGA 2DCBA 2DZZA 3MTNA 4OEMA 2DC9A 3N3GA 4K7CA 3D6SA 1CQDA 3KX1A 3IOQA 3S3RA 1BY8A 2NQIA 1ICFA 1X9YA 1ZIVA 3CBJA 1EWMA 3S3QA 4MZSA 1KFXL 1K3BB 2C0YA 4I07A 3OVXA 2GHUA 2IBIA 2OZ2A 1AU0A 3CBKA 3KWBX 4G54A 7PCKA 2G8JA 1PPOA 2DCAA 3BPFA 2R9CA 1KXRA 1TLOA 3KFQA 1KHPA 4Q8GA 4X6JA 1GLOA 1BP4A 3HWNA 4DMYA 4FIPA 2VHSA 2VHFA 1YK7A 1CTEA 3K24A 2AYNA 2G6DA 3IUTA 4I05A 3PDFA 1NB5A 2AVWA 5CHVA 1CPJA 1TU6A 1VJVA 2AIMA 4P6EA 4AXMA 4W5BA 1CS8A 1CVZA 4P6GA 2Y5BA 4YYQA 1AU4A 2YJ8A 3P5XA 4Q8HA 1MEGA 1F2AA 3QSDA 3KKUA 3IEJA 2E00A 5F02A 3PBHA 4QH6A 3ZUAA 1NLJA 1MEMA 2XU3A 1EWLA 2HD5A 3B79A 1SNKA 1MHWA 3O0UA 2AUZA 1U5IA 1PE6A 3MORA 4QBBA 2AU1A 1ME3A 1MIRA 4XR7A 2DCDA 1FH0A 2FQ9A 4CDCB 1BGOA 5PADA 4CDEB 2YJ2A 5CVOB 3N3KA 3H7DA 1PBHA 2DJGB 3P5VA 2G8EA 2DC8A 2WBFX 3IHPA 4QRGA 4PI3A 1GCBA 4YVAA 1ATKA 1AECA 1VSNA 3CH3X 2G7YA 1BQIA 3H89A 2FUDA 3RVXA 4FK5A 2DJFB 1YVBA 3RVVA 2OP3A 3LXSA 1Q6KA 3IV2A 1ME4A 4X6HA 4YV8A 2FRQA 1EWOA 1AU2A 3H8BA 1S4VA 1CB5A 1TL9A 1QXPA 1CV8A 2F1GA 1AU3A 2R6NA 2GFOA 2XU1A 1F29A 1PADA 3CH2X 1KHQA 4N79A 1U9WA 2ATOA 3AI8A 1YALA 2E03A 1THEA 1Y08A 4N8WA 3PW3A 4CDDB 2FTDA 5CVMA 1NB3A 3TNXA 8PCHA 1U9QX 3BCNA 4ZUXU 3WXFA 3C9EA 3BPMA 2BDZA 2NQDB 1KFUL 3KSEA 1PIPA 1O0EA 3BWKA 4XUIA 1PPNA 1Y4HA 3OISA 2PREA 3IMAA 2P7UA 1ITOA 4BPVA 1U9XA 6PADA 3O1GA 3BOWA 1U9VA 4BS6A 1AYUA 2AS8A 3BC3A 4I04A 1PPPA 2R9NA 3K9MA 4HWYA 1JQPA 4YYSA 9PAPA 3P5WA 4BSQA 2FT2A 1F2BA 1DEUA 3DF0A 1GECE 3HHIA 3H8CA 5CVNB 4AXLA 3HD3A 2PBHA 1NQCA 4FJCA 1EF7A 2R9MA 3F5VA 1F2CA 2AUXA 3PNRA 2DC6A 3N4CA 1CJLA 3MHSA 4MZOA 4BS5A 2R9OA 3LFYA 3USVA 2AYOA 2ACTA 3OF8A 2YJCA 4DMXA 1AIMA 2E01A 2HHNA 2PNSA 1IWDA 5K16A 1QDQA 5JH3A 3KW9A 1EWPA 1HUCB 2NQAA 4CZWA 1MDWA 4YYVA 4PP2E 1MS6A 2PADA 1M6DA 5JA7A 1A6RA 1AYVA 2O6XA 4X6IA 3MHHA 1YK8A 2JQGR 4QRXA 3HHAA 5EGWA 4W4UA 4N4ZA 4W5CA 2DC7A 1STFE 3WXEA 2DZYA 3QJ3A 1DF0A 3F75A 1QMYA 3U8EA 3I3TA 3E1ZB 2YJ9A 3RVWA 1CSBB 2DCCA 2P0RA 2BDLA 2E02A 4PP1A 2B1MA 4RY2A 1PPDA 2F7DA 3GCBA 2HH5A 4YYRA 1AYWA 2XU5A 3KWZA 4MSXA 3OF9A 3NHEA 2P86A 4QRVA 3OVZA 3P5UA 1XKGA 1PCIA 1GMYA 1SP4B 2R9FA 2H7JA 2XU4A 5CHTA 2OULA 2FRAA 3M99A 4KLBA 2JQFR 2ARYA 4CDFB 2YJBA 5FPWA 1QOLA 3I06A 2B1NA 1ZCMA 2NQGA 3V6EA 5EF4A 4PADA 4YYWA 1PXVA 2CIOA 3ERVA 4YYUA 2FYEA 2HXZA
chains in the Genus database with same CATH superfamily
1NL6A 1POPA 1NPZA 3V6CA 2FO5A 3QT4A 4WA6A 5A24A 3K8UA 2CB5A 4OELA 5J94A 4OW0A 2Y6EA 4BQVA 4WURA 2J7QA 2IPPB 1YT7A 3H6SA 3WXGA 2DCBA 2DZZA 3MTNA 4OVZB 4OEMA 2DC9A 3N3GA 4K7CA 3D6SA 3BB7A 3PHXA 1CQDA 3KX1A 3IOQA 3S3RA 4IP3A 1BY8A 2NQIA 1ICFA 1X9YA 1ZIVA 3CBJA 1EWMA 3S3QA 4MZSA 1KFXL 1K3BB 2C0YA 4I07A 3OVXA 2GHUA 2IBIA 2OZ2A 4PT5A 1AU0A 3CBKA 3PT2A 3KWBX 4G54A 7PCKA 5EZQA 2G8JA 1PPOA 2DCAA 3BPFA 2R9CA 1KXRA 1TLOA 3KFQA 5EZSA 1KHPA 4Q8GA 4X6JA 4ZTBA 1GLOA 1BP4A 3HWNA 4DMYA 4FIPA 2VHSA 2VHFA 1YK7A 1CTEA 3K24A 2AYNA 3IFUA 2G6DA 3IUTA 4I05A 3PDFA 1NB5A 2AVWA 5CHVA 1CPJA 1TU6A 1VJVA 2AIMA 4OVZA 4P6EA 4AXMA 4BOZA 4W5BA 1CS8A 4D8IA 1CVZA 4P6GA 2Y5BA 4YYQA 1AU4A 2YJ8A 3P5XA 4Q8HA 1MEGA 1F2AA 3QSDA 3KKUA 3IEJA 2E00A 5E6JA 5F02A 3PBHA 4QH6A 4MM3B 3ZUAA 1NLJA 1MEMA 4BOSA 2XU3A 1EWLA 2HD5A 3B79A 1SNKA 1MHWA 3RNVA 3MJ5A 3O0UA 2AUZA 1U5IA 1PE6A 3MORA 4QBBA 2AU1A 1ME3A 1MIRA 4XR7A 3PRPA 2DCDA 1FH0A 2HWKA 2FQ9A 4CDCB 1BGOA 5PADA 4BOPA 4CDEB 2YJ2A 1DKIA 3N3KA 5CVOB 3H7DA 4IUMA 3O65A 1PBHA 2DJGB 3BBAA 3P5VA 2G8EA 2DC8A 2WBFX 3IHPA 3W31A 4QRGA 2AGAA 4PI3A 3PHWA 1GCBA 4YVAA 1ATKA 1AECA 1VSNA 3CH3X 2G7YA 1BQIA 3H89A 2BU3A 2FUDA 3RVXA 2J7QC 4FK5A 4D8EA 2DJFB 1YVBA 3RVVA 2OP3A 3LXSA 1Q6KA 3IV2A 1ME4A 4X6HA 4YV8A 2FRQA 1EWOA 1AU2A 4RF0A 3H8BA 4REZA 3PHUA 3W30A 4A5UA 3ZNHA 1S4VA 1CB5A 5KO3A 1TL9A 1QXPA 1CV8A 2F1GA 3B21A 1AU3A 2R6NA 2GFOA 2XU1A 1F29A 1PADA 3CH2X 1KHQA 4N79A 1U9WA 2ATOA 3AI8A 1YALA 2E03A 2JTCA 4MI7A 4RNAA 1THEA 1Y08A 4N8WA 3TMPA 3PW3A 4CDDB 2FTDA 5CVMA 1NB3A 3TNXA 8PCHA 1U9QX 3BCNA 4ZUXU 3WXFA 3C9EA 2UZJA 3BPMA 2BDZA 2NQDB 1KFUL 4RKXA 3KSEA 1PIPA 1O0EA 2BTWA 3BWKA 4XUIA 1PPNA 1Y4HA 4HXDB 3OISA 2PREA 3IMAA 2P7UA 1ITOA 4BPVA 1U9XA 3E9SA 6PADA 3O1GA 3BOWA 1U9VA 4BS6A 1AYUA 2AS8A 3BC3A 4I04A 3OQCA 1PPPA 2R9NA 3K9MA 4HWYA 1JQPA 4YYSA 9PAPA 2JRIA 3P5WA 4BSQA 2FT2A 4D8BA 1F2BA 1DEUA 3DF0A 1GECE 3MTVA 3PSEA 3HHIA 3H8CA 5CVNB 4AXLA 3HD3A 2PBHA 1NQCA 4GUAA 4FJCA 1EF7A 3BY4A 4XZXA 2R9MA 3F5VA 1F2CA 2AUXA 3PNRA 2DC6A 3N4CA 1CJLA 3MHSA 4MZOA 4BS5A 2BTWB 2R9OA 3LFYA 3USVA 3PRMA 2AYOA 3C0RA 2ACTA 3OF8A 2YJCA 4DMXA 4RF1A 1AIMA 4R3DA 1UKFA 2E01A 2HHNA 2PNSA 1IWDA 5K16A 1QDQA 5JH3A 3KW9A 1EWPA 1HUCB 2NQAA 4CZWA 5JZEA 1MDWA 4YYVA 4PP2E 1MS6A 2PADA 1M6DA 5JA7A 1A6RA 1AYVA 2O6XA 4X6IA 3MHHA 1YK8A 2JQGR 4QRXA 3HHAA 5EGWA 4W4UA 4N4ZA 4BOQA 4W5CA 2DC7A 1STFE 3WXEA 2DZYA 4BOUA 3QJ3A 1DF0A 3F75A 1QMYA 3U8EA 3I3TA 3E1ZB 2YJ9A 3RVWA 1YZBA 1CSBB 2DCCA 2P0RA 2BDLA 2E02A 4PP1A 2B1MA 4RY2A 1PPDA 2F7DA 3GCBA 2HH5A 4YYRA 1AYWA 3MP2A 2XU5A 3KWZA 2Z84A 4MSXA 3OF9A 4P16A 2DOSA 3NHEA 4M0WA 2P86A 4QRVA 3OVZA 2FE8A 3P5UA 1XKGA 1PCIA 1GMYA 1SP4B 2R9FA 2H7JA 2XU4A 5CHTA 2OULA 2FRAA 3M99A 4KLBA 2JQFR 2ARYA 4CDFB 2YJBA 5FPWA 1QOLA 1PVJA 3I06A 2B1NA 3TRKA 1ZCMA 2NQGA 3V6EA 5EF4A 4PADA 4YYWA 1PXVA 2CIOA 3ERVA 4YYUA 2FYEA 2HXZA
chains in the Genus database with same CATH topology
1NL6A 1POPA 1NPZA 3V6CA 2VFCA 2FO5A 3QT4A 4WA6A 5A24A 3K8UA 2CB5A 4OELA 5J94A 2VFBA 4NV8A 2Y6EA 4BQVA 2IPPB 1YT7A 3H6SA 3WXGA 2DCBA 2DZZA 3MTNA 4OEMA 2DC9A 3N3GA 4K7CA 3D6SA 1CQDA 3KX1A 3IOQA 3S3RA 1BY8A 2NQIA 1ICFA 1X9YA 1ZIVA 3CBJA 1EWMA 3S3QA 4MZSA 1KFXL 1K3BB 4GUZA 2C0YA 4I07A 3OVXA 2GHUA 2IBIA 2OZ2A 1W5RA 1AU0A 3CBKA 3KWBX 4G54A 7PCKA 2G8JA 1PPOA 2DCAA 3BPFA 2R9CA 1KXRA 1TLOA 3KFQA 1KHPA 4Q8GA 4X6JA 1GLOA 1BP4A 3HWNA 4DMYA 4FIPA 2VHSA 2VHFA 1YK7A 1CTEA 3K24A 2AYNA 2G6DA 3IUTA 4I05A 3PDFA 1NB5A 2AVWA 5CHVA 2BSZA 1CPJA 1TU6A 1VJVA 2AIMA 4P6EA 4AXMA 4W5BA 1CS8A 1CVZA 4P6GA 2Y5BA 4YYQA 1AU4A 2YJ8A 3P5XA 4Q8HA 1MEGA 1F2AA 3QSDA 3KKUA 3IEJA 2E00A 5F02A 3PBHA 4QH6A 3ZUAA 1NLJA 1MEMA 2XU3A 1EWLA 2HD5A 3B79A 1SNKA 1MHWA 3O0UA 2AUZA 1U5IA 1PE6A 3MORA 4QBBA 2AU1A 1ME3A 1MIRA 4XR7A 2DCDA 1FH0A 2FQ9A 4CDCB 1BGOA 1E2TA 5PADA 4CDEB 2YJ2A 5CVOB 3N3KA 3H7DA 1PBHA 2DJGB 3P5VA 2G8EA 2DC8A 2WBFX 3IHPA 4QRGA 4PI3A 1GCBA 4YVAA 1ATKA 1AECA 1VSNA 3CH3X 2G7YA 1BQIA 3H89A 2FUDA 3RVXA 4FK5A 2DJFB 1YVBA 3RVVA 2OP3A 3LXSA 1Q6KA 4C5PA 3IV2A 1ME4A 4X6HA 4YV8A 2FRQA 1EWOA 1AU2A 3H8BA 1S4VA 1CB5A 1TL9A 1QXPA 1CV8A 2F1GA 1AU3A 2R6NA 2GFOA 2XU1A 1F29A 1PADA 3CH2X 1KHQA 4N79A 1U9WA 2ATOA 3AI8A 1YALA 2E03A 1THEA 1Y08A 1W4TA 4N8WA 3PW3A 4CDDB 2FTDA 5CVMA 1NB3A 3TNXA 3D9WA 4BGFA 8PCHA 1U9QX 3BCNA 4ZUXU 3WXFA 3C9EA 3BPMA 2BDZA 2NQDB 1KFUL 3KSEA 1PIPA 1O0EA 1GX3A 3BWKA 4XUIA 1PPNA 1Y4HA 3OISA 2PREA 3IMAA 2P7UA 1ITOA 4BPVA 1U9XA 6PADA 3O1GA 3BOWA 1U9VA 4BS6A 1AYUA 2AS8A 3BC3A 4I04A 1PPPA 2R9NA 3K9MA 4HWYA 1JQPA 4YYSA 9PAPA 3P5WA 4BSQA 2FT2A 1F2BA 1DEUA 3DF0A 1GECE 3HHIA 3H8CA 5CVNB 4AXLA 3HD3A 2PBHA 1NQCA 4FJCA 1EF7A 2R9MA 3F5VA 1F2CA 2AUXA 3PNRA 2DC6A 3N4CA 1CJLA 3MHSA 4MZOA 4BS5A 2R9OA 3LFYA 3USVA 2AYOA 2ACTA 3OF8A 2YJCA 4DMXA 1AIMA 2E01A 2HHNA 2PNSA 1IWDA 5K16A 1QDQA 5JH3A 3KW9A 1EWPA 1HUCB 2NQAA 4CZWA 1MDWA 3LTWA 4YYVA 4PP2E 1MS6A 2PADA 1M6DA 5JA7A 1A6RA 1AYVA 2O6XA 4NV7A 4X6IA 3MHHA 1YK8A 2JQGR 4QRXA 3HHAA 5EGWA 4W4UA 4N4ZA 4W5CA 2DC7A 1STFE 3WXEA 2DZYA 3QJ3A 1DF0A 3F75A 1QMYA 3U8EA 3I3TA 3E1ZB 2YJ9A 3RVWA 1CSBB 2DCCA 2P0RA 2BDLA 2E02A 4PP1A 2B1MA 4RY2A 1PPDA 2F7DA 3GCBA 2HH5A 4YYRA 1AYWA 2XU5A 3KWZA 4MSXA 3OF9A 3NHEA 2P86A 4QRVA 3OVZA 3P5UA 1XKGA 1PCIA 1GMYA 1SP4B 2R9FA 2H7JA 2XU4A 5CHTA 2OULA 4B55A 2FRAA 3M99A 4KLBA 2JQFR 2ARYA 4CDFB 2YJBA 5FPWA 1QOLA 3I06A 2B1NA 1ZCMA 2NQGA 3V6EA 5EF4A 4PADA 4YYWA 1PXVA 2CIOA 3ERVA 4YYUA 1W6FA 2FYEA 2HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NL6 A;  1POP A;  1NPZ A;  3V6C A;  2FO5 A;  3QT4 A;  4WA6 A;  5A24 A;  3K8U A;  2CB5 A;  4OEL A;  5J94 A;  2Y6E A;  4BQV A;  2IPP B;  1YT7 A;  3H6S A;  3WXG A;  2DCB A;  2DZZ A;  3MTN A;  4OEM A;  2DC9 A;  3N3G A;  4K7C A;  3D6S A;  1CQD A;  3KX1 A;  3IOQ A;  3S3R A;  1BY8 A;  2NQI A;  1ICF A;  1X9Y A;  1ZIV A;  3CBJ A;  1EWM A;  3S3Q A;  4MZS A;  1KFX L;  1K3B B;  2C0Y A;  4I07 A;  3OVX A;  2GHU A;  2IBI A;  2OZ2 A;  1AU0 A;  3CBK A;  3KWB X;  4G54 A;  7PCK A;  2G8J A;  1PPO A;  2DCA A;  3BPF A;  2R9C A;  1KXR A;  1TLO A;  3KFQ A;  1KHP A;  4Q8G A;  4X6J A;  1GLO A;  1BP4 A;  3HWN A;  4DMY A;  4FIP A;  2VHS A;  2VHF A;  1YK7 A;  1CTE A;  3K24 A;  2AYN A;  2G6D A;  3IUT A;  4I05 A;  3PDF A;  1NB5 A;  2AVW A;  5CHV A;  1CPJ A;  1TU6 A;  1VJV A;  2AIM A;  4P6E A;  4AXM A;  4W5B A;  1CS8 A;  1CVZ A;  4P6G A;  2Y5B A;  4YYQ A;  1AU4 A;  2YJ8 A;  3P5X A;  4Q8H A;  1MEG A;  1F2A A;  3QSD A;  3KKU A;  3IEJ A;  2E00 A;  5F02 A;  3PBH A;  4QH6 A;  3ZUA A;  1NLJ A;  1MEM A;  2XU3 A;  1EWL A;  2HD5 A;  3B79 A;  1SNK A;  1MHW A;  3O0U A;  2AUZ A;  1U5I A;  1PE6 A;  3MOR A;  4QBB A;  2AU1 A;  1ME3 A;  1MIR A;  4XR7 A;  2DCD A;  1FH0 A;  2FQ9 A;  4CDC B;  1BGO A;  5PAD A;  4CDE B;  2YJ2 A;  5CVO B;  3N3K A;  3H7D A;  1PBH A;  2DJG B;  3P5V A;  2G8E A;  2DC8 A;  2WBF X;  3IHP A;  4QRG A;  4PI3 A;  1GCB A;  4YVA A;  1ATK A;  1AEC A;  1VSN A;  3CH3 X;  2G7Y A;  1BQI A;  3H89 A;  2FUD A;  3RVX A;  4FK5 A;  2DJF B;  1YVB A;  3RVV A;  2OP3 A;  3LXS A;  1Q6K A;  3IV2 A;  1ME4 A;  4X6H A;  4YV8 A;  2FRQ A;  1EWO A;  1AU2 A;  3H8B A;  1S4V A;  1CB5 A;  1TL9 A;  1QXP A;  1CV8 A;  2F1G A;  1AU3 A;  2R6N A;  2GFO A;  2XU1 A;  1F29 A;  1PAD A;  3CH2 X;  1KHQ A;  4N79 A;  1U9W A;  2ATO A;  3AI8 A;  1YAL A;  2E03 A;  1THE A;  1Y08 A;  4N8W A;  3PW3 A;  4CDD B;  2FTD A;  5CVM A;  1NB3 A;  3TNX A;  8PCH A;  1U9Q X;  3BCN A;  4ZUX U;  3WXF A;  3C9E A;  3BPM A;  2BDZ A;  2NQD B;  1KFU L;  3KSE A;  1PIP A;  1O0E A;  3BWK A;  4XUI A;  1PPN A;  1Y4H A;  3OIS A;  2PRE A;  3IMA A;  2P7U A;  1ITO A;  4BPV A;  1U9X A;  6PAD A;  3O1G A;  3BOW A;  1U9V A;  4BS6 A;  1AYU A;  2AS8 A;  3BC3 A;  4I04 A;  1PPP A;  2R9N A;  3K9M A;  4HWY A;  1JQP A;  4YYS A;  9PAP A;  3P5W A;  4BSQ A;  2FT2 A;  1F2B A;  1DEU A;  3DF0 A;  1GEC E;  3HHI A;  3H8C A;  5CVN B;  4AXL A;  3HD3 A;  2PBH A;  1NQC A;  4FJC A;  1EF7 A;  2R9M A;  3F5V A;  1F2C A;  2AUX A;  3PNR A;  2DC6 A;  3N4C A;  1CJL A;  3MHS A;  4MZO A;  4BS5 A;  2R9O A;  3LFY A;  3USV A;  2AYO A;  2ACT A;  3OF8 A;  2YJC A;  4DMX A;  1AIM A;  2E01 A;  2HHN A;  2PNS A;  1IWD A;  5K16 A;  1QDQ A;  5JH3 A;  3KW9 A;  1EWP A;  1HUC B;  2NQA A;  4CZW A;  1MDW A;  4YYV A;  4PP2 E;  1MS6 A;  2PAD A;  1M6D A;  5JA7 A;  1A6R A;  1AYV A;  2O6X A;  4X6I A;  3MHH A;  1YK8 A;  2JQG R;  4QRX A;  3HHA A;  5EGW A;  4W4U A;  4N4Z A;  4W5C A;  2DC7 A;  1STF E;  3WXE A;  2DZY A;  3QJ3 A;  1DF0 A;  3F75 A;  1QMY A;  3U8E A;  3I3T A;  3E1Z B;  2YJ9 A;  3RVW A;  1CSB B;  2DCC A;  2P0R A;  2BDL A;  2E02 A;  4PP1 A;  2B1M A;  4RY2 A;  1PPD A;  2F7D A;  3GCB A;  2HH5 A;  4YYR A;  1AYW A;  2XU5 A;  3KWZ A;  4MSX A;  3OF9 A;  3NHE A;  2P86 A;  4QRV A;  3OVZ A;  3P5U A;  1XKG A;  1PCI A;  1GMY A;  1SP4 B;  2R9F A;  2H7J A;  2XU4 A;  5CHT A;  2OUL A;  2FRA A;  3M99 A;  4KLB A;  2JQF R;  2ARY A;  4CDF B;  2YJB A;  5FPW A;  1QOL A;  3I06 A;  2B1N A;  1ZCM A;  2NQG A;  3V6E A;  5EF4 A;  4PAD A;  4YYW A;  1PXV A;  2CIO A;  3ERV A;  4YYU A;  2FYE A;  2HXZ A; 
#chains in the Genus database with same CATH topology
 1NL6 A;  1POP A;  1NPZ A;  3V6C A;  2FO5 A;  3QT4 A;  4WA6 A;  5A24 A;  3K8U A;  2CB5 A;  4OEL A;  5J94 A;  4OW0 A;  2Y6E A;  4BQV A;  4WUR A;  2J7Q A;  2IPP B;  1YT7 A;  3H6S A;  3WXG A;  2DCB A;  2DZZ A;  3MTN A;  4OVZ B;  4OEM A;  2DC9 A;  3N3G A;  4K7C A;  3D6S A;  3BB7 A;  3PHX A;  1CQD A;  3KX1 A;  3IOQ A;  3S3R A;  4IP3 A;  1BY8 A;  2NQI A;  1ICF A;  1X9Y A;  1ZIV A;  3CBJ A;  1EWM A;  3S3Q A;  4MZS A;  1KFX L;  1K3B B;  2C0Y A;  4I07 A;  3OVX A;  2GHU A;  2IBI A;  2OZ2 A;  4PT5 A;  1AU0 A;  3CBK A;  3PT2 A;  3KWB X;  4G54 A;  7PCK A;  5EZQ A;  2G8J A;  1PPO A;  2DCA A;  3BPF A;  2R9C A;  1KXR A;  1TLO A;  3KFQ A;  5EZS A;  1KHP A;  4Q8G A;  4X6J A;  4ZTB A;  1GLO A;  1BP4 A;  3HWN A;  4DMY A;  4FIP A;  2VHS A;  2VHF A;  1YK7 A;  1CTE A;  3K24 A;  2AYN A;  3IFU A;  2G6D A;  3IUT A;  4I05 A;  3PDF A;  1NB5 A;  2AVW A;  5CHV A;  1CPJ A;  1TU6 A;  1VJV A;  2AIM A;  4OVZ A;  4P6E A;  4AXM A;  4BOZ A;  4W5B A;  1CS8 A;  4D8I A;  1CVZ A;  4P6G A;  2Y5B A;  4YYQ A;  1AU4 A;  2YJ8 A;  3P5X A;  4Q8H A;  1MEG A;  1F2A A;  3QSD A;  3KKU A;  3IEJ A;  2E00 A;  5E6J A;  5F02 A;  3PBH A;  4QH6 A;  4MM3 B;  3ZUA A;  1NLJ A;  1MEM A;  4BOS A;  2XU3 A;  1EWL A;  2HD5 A;  3B79 A;  1SNK A;  1MHW A;  3RNV A;  3MJ5 A;  3O0U A;  2AUZ A;  1U5I A;  1PE6 A;  3MOR A;  4QBB A;  2AU1 A;  1ME3 A;  1MIR A;  4XR7 A;  3PRP A;  2DCD A;  1FH0 A;  2HWK A;  2FQ9 A;  4CDC B;  1BGO A;  5PAD A;  4BOP A;  4CDE B;  2YJ2 A;  1DKI A;  3N3K A;  5CVO B;  3H7D A;  4IUM A;  3O65 A;  1PBH A;  2DJG B;  3BBA A;  3P5V A;  2G8E A;  2DC8 A;  2WBF X;  3IHP A;  3W31 A;  4QRG A;  2AGA A;  4PI3 A;  3PHW A;  1GCB A;  4YVA A;  1ATK A;  1AEC A;  1VSN A;  3CH3 X;  2G7Y A;  1BQI A;  3H89 A;  2BU3 A;  2FUD A;  3RVX A;  2J7Q C;  4FK5 A;  4D8E A;  2DJF B;  1YVB A;  3RVV A;  2OP3 A;  3LXS A;  1Q6K A;  3IV2 A;  1ME4 A;  4X6H A;  4YV8 A;  2FRQ A;  1EWO A;  1AU2 A;  4RF0 A;  3H8B A;  4REZ A;  3PHU A;  3W30 A;  4A5U A;  3ZNH A;  1S4V A;  1CB5 A;  5KO3 A;  1TL9 A;  1QXP A;  1CV8 A;  2F1G A;  3B21 A;  1AU3 A;  2R6N A;  2GFO A;  2XU1 A;  1F29 A;  1PAD A;  3CH2 X;  1KHQ A;  4N79 A;  1U9W A;  2ATO A;  3AI8 A;  1YAL A;  2E03 A;  2JTC A;  4MI7 A;  4RNA A;  1THE A;  1Y08 A;  4N8W A;  3TMP A;  3PW3 A;  4CDD B;  2FTD A;  5CVM A;  1NB3 A;  3TNX A;  8PCH A;  1U9Q X;  3BCN A;  4ZUX U;  3WXF A;  3C9E A;  2UZJ A;  3BPM A;  2BDZ A;  2NQD B;  1KFU L;  4RKX A;  3KSE A;  1PIP A;  1O0E A;  2BTW A;  3BWK A;  4XUI A;  1PPN A;  1Y4H A;  4HXD B;  3OIS A;  2PRE A;  3IMA A;  2P7U A;  1ITO A;  4BPV A;  1U9X A;  3E9S A;  6PAD A;  3O1G A;  3BOW A;  1U9V A;  4BS6 A;  1AYU A;  2AS8 A;  3BC3 A;  4I04 A;  3OQC A;  1PPP A;  2R9N A;  3K9M A;  4HWY A;  1JQP A;  4YYS A;  9PAP A;  2JRI A;  3P5W A;  4BSQ A;  2FT2 A;  4D8B A;  1F2B A;  1DEU A;  3DF0 A;  1GEC E;  3MTV A;  3PSE A;  3HHI A;  3H8C A;  5CVN B;  4AXL A;  3HD3 A;  2PBH A;  1NQC A;  4GUA A;  4FJC A;  1EF7 A;  3BY4 A;  4XZX A;  2R9M A;  3F5V A;  1F2C A;  2AUX A;  3PNR A;  2DC6 A;  3N4C A;  1CJL A;  3MHS A;  4MZO A;  4BS5 A;  2BTW B;  2R9O A;  3LFY A;  3USV A;  3PRM A;  2AYO A;  3C0R A;  2ACT A;  3OF8 A;  2YJC A;  4DMX A;  4RF1 A;  1AIM A;  4R3D A;  1UKF A;  2E01 A;  2HHN A;  2PNS A;  1IWD A;  5K16 A;  1QDQ A;  5JH3 A;  3KW9 A;  1EWP A;  1HUC B;  2NQA A;  4CZW A;  5JZE A;  1MDW A;  4YYV A;  4PP2 E;  1MS6 A;  2PAD A;  1M6D A;  5JA7 A;  1A6R A;  1AYV A;  2O6X A;  4X6I A;  3MHH A;  1YK8 A;  2JQG R;  4QRX A;  3HHA A;  5EGW A;  4W4U A;  4N4Z A;  4BOQ A;  4W5C A;  2DC7 A;  1STF E;  3WXE A;  2DZY A;  4BOU A;  3QJ3 A;  1DF0 A;  3F75 A;  1QMY A;  3U8E A;  3I3T A;  3E1Z B;  2YJ9 A;  3RVW A;  1YZB A;  1CSB B;  2DCC A;  2P0R A;  2BDL A;  2E02 A;  4PP1 A;  2B1M A;  4RY2 A;  1PPD A;  2F7D A;  3GCB A;  2HH5 A;  4YYR A;  1AYW A;  3MP2 A;  2XU5 A;  3KWZ A;  2Z84 A;  4MSX A;  3OF9 A;  4P16 A;  2DOS A;  3NHE A;  4M0W A;  2P86 A;  4QRV A;  3OVZ A;  2FE8 A;  3P5U A;  1XKG A;  1PCI A;  1GMY A;  1SP4 B;  2R9F A;  2H7J A;  2XU4 A;  5CHT A;  2OUL A;  2FRA A;  3M99 A;  4KLB A;  2JQF R;  2ARY A;  4CDF B;  2YJB A;  5FPW A;  1QOL A;  1PVJ A;  3I06 A;  2B1N A;  3TRK A;  1ZCM A;  2NQG A;  3V6E A;  5EF4 A;  4PAD A;  4YYW A;  1PXV A;  2CIO A;  3ERV A;  4YYU A;  2FYE A;  2HXZ A; 
#chains in the Genus database with same CATH homology
 1NL6 A;  1POP A;  1NPZ A;  3V6C A;  2VFC A;  2FO5 A;  3QT4 A;  4WA6 A;  5A24 A;  3K8U A;  2CB5 A;  4OEL A;  5J94 A;  2VFB A;  4NV8 A;  2Y6E A;  4BQV A;  2IPP B;  1YT7 A;  3H6S A;  3WXG A;  2DCB A;  2DZZ A;  3MTN A;  4OEM A;  2DC9 A;  3N3G A;  4K7C A;  3D6S A;  1CQD A;  3KX1 A;  3IOQ A;  3S3R A;  1BY8 A;  2NQI A;  1ICF A;  1X9Y A;  1ZIV A;  3CBJ A;  1EWM A;  3S3Q A;  4MZS A;  1KFX L;  1K3B B;  4GUZ A;  2C0Y A;  4I07 A;  3OVX A;  2GHU A;  2IBI A;  2OZ2 A;  1W5R A;  1AU0 A;  3CBK A;  3KWB X;  4G54 A;  7PCK A;  2G8J A;  1PPO A;  2DCA A;  3BPF A;  2R9C A;  1KXR A;  1TLO A;  3KFQ A;  1KHP A;  4Q8G A;  4X6J A;  1GLO A;  1BP4 A;  3HWN A;  4DMY A;  4FIP A;  2VHS A;  2VHF A;  1YK7 A;  1CTE A;  3K24 A;  2AYN A;  2G6D A;  3IUT A;  4I05 A;  3PDF A;  1NB5 A;  2AVW A;  5CHV A;  2BSZ A;  1CPJ A;  1TU6 A;  1VJV A;  2AIM A;  4P6E A;  4AXM A;  4W5B A;  1CS8 A;  1CVZ A;  4P6G A;  2Y5B A;  4YYQ A;  1AU4 A;  2YJ8 A;  3P5X A;  4Q8H A;  1MEG A;  1F2A A;  3QSD A;  3KKU A;  3IEJ A;  2E00 A;  5F02 A;  3PBH A;  4QH6 A;  3ZUA A;  1NLJ A;  1MEM A;  2XU3 A;  1EWL A;  2HD5 A;  3B79 A;  1SNK A;  1MHW A;  3O0U A;  2AUZ A;  1U5I A;  1PE6 A;  3MOR A;  4QBB A;  2AU1 A;  1ME3 A;  1MIR A;  4XR7 A;  2DCD A;  1FH0 A;  2FQ9 A;  4CDC B;  1BGO A;  1E2T A;  5PAD A;  4CDE B;  2YJ2 A;  5CVO B;  3N3K A;  3H7D A;  1PBH A;  2DJG B;  3P5V A;  2G8E A;  2DC8 A;  2WBF X;  3IHP A;  4QRG A;  4PI3 A;  1GCB A;  4YVA A;  1ATK A;  1AEC A;  1VSN A;  3CH3 X;  2G7Y A;  1BQI A;  3H89 A;  2FUD A;  3RVX A;  4FK5 A;  2DJF B;  1YVB A;  3RVV A;  2OP3 A;  3LXS A;  1Q6K A;  4C5P A;  3IV2 A;  1ME4 A;  4X6H A;  4YV8 A;  2FRQ A;  1EWO A;  1AU2 A;  3H8B A;  1S4V A;  1CB5 A;  1TL9 A;  1QXP A;  1CV8 A;  2F1G A;  1AU3 A;  2R6N A;  2GFO A;  2XU1 A;  1F29 A;  1PAD A;  3CH2 X;  1KHQ A;  4N79 A;  1U9W A;  2ATO A;  3AI8 A;  1YAL A;  2E03 A;  1THE A;  1Y08 A;  1W4T A;  4N8W A;  3PW3 A;  4CDD B;  2FTD A;  5CVM A;  1NB3 A;  3TNX A;  3D9W A;  4BGF A;  8PCH A;  1U9Q X;  3BCN A;  4ZUX U;  3WXF A;  3C9E A;  3BPM A;  2BDZ A;  2NQD B;  1KFU L;  3KSE A;  1PIP A;  1O0E A;  1GX3 A;  3BWK A;  4XUI A;  1PPN A;  1Y4H A;  3OIS A;  2PRE A;  3IMA A;  2P7U A;  1ITO A;  4BPV A;  1U9X A;  6PAD A;  3O1G A;  3BOW A;  1U9V A;  4BS6 A;  1AYU A;  2AS8 A;  3BC3 A;  4I04 A;  1PPP A;  2R9N A;  3K9M A;  4HWY A;  1JQP A;  4YYS A;  9PAP A;  3P5W A;  4BSQ A;  2FT2 A;  1F2B A;  1DEU A;  3DF0 A;  1GEC E;  3HHI A;  3H8C A;  5CVN B;  4AXL A;  3HD3 A;  2PBH A;  1NQC A;  4FJC A;  1EF7 A;  2R9M A;  3F5V A;  1F2C A;  2AUX A;  3PNR A;  2DC6 A;  3N4C A;  1CJL A;  3MHS A;  4MZO A;  4BS5 A;  2R9O A;  3LFY A;  3USV A;  2AYO A;  2ACT A;  3OF8 A;  2YJC A;  4DMX A;  1AIM A;  2E01 A;  2HHN A;  2PNS A;  1IWD A;  5K16 A;  1QDQ A;  5JH3 A;  3KW9 A;  1EWP A;  1HUC B;  2NQA A;  4CZW A;  1MDW A;  3LTW A;  4YYV A;  4PP2 E;  1MS6 A;  2PAD A;  1M6D A;  5JA7 A;  1A6R A;  1AYV A;  2O6X A;  4NV7 A;  4X6I A;  3MHH A;  1YK8 A;  2JQG R;  4QRX A;  3HHA A;  5EGW A;  4W4U A;  4N4Z A;  4W5C A;  2DC7 A;  1STF E;  3WXE A;  2DZY A;  3QJ3 A;  1DF0 A;  3F75 A;  1QMY A;  3U8E A;  3I3T A;  3E1Z B;  2YJ9 A;  3RVW A;  1CSB B;  2DCC A;  2P0R A;  2BDL A;  2E02 A;  4PP1 A;  2B1M A;  4RY2 A;  1PPD A;  2F7D A;  3GCB A;  2HH5 A;  4YYR A;  1AYW A;  2XU5 A;  3KWZ A;  4MSX A;  3OF9 A;  3NHE A;  2P86 A;  4QRV A;  3OVZ A;  3P5U A;  1XKG A;  1PCI A;  1GMY A;  1SP4 B;  2R9F A;  2H7J A;  2XU4 A;  5CHT A;  2OUL A;  4B55 A;  2FRA A;  3M99 A;  4KLB A;  2JQF R;  2ARY A;  4CDF B;  2YJB A;  5FPW A;  1QOL A;  3I06 A;  2B1N A;  1ZCM A;  2NQG A;  3V6E A;  5EF4 A;  4PAD A;  4YYW A;  1PXV A;  2CIO A;  3ERV A;  4YYU A;  1W6F A;  2FYE A;  2HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...