1ITOA

Crystal structure analysis of bovine spleen cathepsin b-e64c complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Structural basis for development of cathepsin B-specific noncovalent-type inhibitor: crystal structure of cathepsin B-E64c complex
pubmed doi rcsb
molecule tags Hydrolase
total genus 76
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2002-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1itoA00
2CB5A 2FQ9A 1MEMA 2OZ2A 4BS5A 2YJCA 1YT7A 4QRGA 3RVWA 3O0UA 3H89A 2DC6A 1PADA 4FIPA 4MZSA 3IMAA 1EF7A 2F7DA 2AYNA 2WBFX 2XU4A 5F02A 3H6SA 4PP2E 1VJVA 1YALA 2XU3A 1S4VA 3GCBA 1ZIVA 2E03A 1F2CA 1M6DA 2B1MA 5J94A 2DC8A 3HD3A 2IPPB 3LFYA 1NB5A 2FTDA 3NHEA 1NQCA 2FO5A 2AU1A 2DC9A 4YVAA 2P7UA 2E00A 2G8JA 1XKGA 1AECA 2G6DA 3CH3X 4YYRA 2YJ9A 3BC3A 1KFUL 4W5CA 3KWZA 1KHPA 4X6IA 2JQGR 5CVOB 2BDZA 2DC7A 2CIOA 2FYEA 2FRAA 3PBHA 3BPFA 2VHSA 4N4ZA 3F75A 4HWYA 3V6CA 1Y4HA 1A6RA 4PP1A 1AYWA 1TL9A 2FUDA 1AYVA 4KLBA 1ME4A 1CTEA 3S3QA 1PE6A 1AU4A 4PI3A 4WA6A 1KXRA 1ME3A 2DZZA 3BCNA 1VSNA 2F1GA 2AYOA 3OF9A 4MSXA 2AIMA 2YJ2A 3HWNA 1X9YA 2YJBA 4K7CA 2DCAA 2OP3A 2IBIA 1MHWA 4ZUXU 4OEMA 3MHHA 1HUCB 5CVMA 3KX1A 1KFXL 1CQDA 4BPVA 1BY8A 1YK8A 2PREA 1PPNA 1F2BA 1YVBA 3K8UA 4XUIA 2DCCA 1DEUA 3MTNA 4PADA 1PCIA 2XU1A 1CJLA 2C0YA 1ZCMA 3RVXA 4QRXA 1O0EA 1SNKA 4BSQA 2NQDB 3OISA 3CBKA 1BP4A 4I04A 1DF0A 3CH2X 5PADA 3IEJA 1CVZA 3WXGA 4X6JA 1GECE 5K16A 4BS6A 1MDWA 1KHQA 4W4UA 3IV2A 3OVZA 1EWMA 2R9MA 1STFE 1MS6A 2P0RA 1MIRA 2R9FA 3E1ZB 2AUZA 4CDDB 3I06A 3WXEA 1CSBB 1K3BB 3H8CA 1NLJA 5CHVA 1PPDA 4N79A 2OULA 4QRVA 3N3KA 1U9XA 2XU5A 3P5UA 2ACTA 2O6XA 3DF0A 4YYSA 3OVXA 4I05A 3IHPA 4I07A 2B1NA 2AUXA 3D6SA 3P5WA 4FK5A 3H7DA 2PBHA 4MZOA 2HXZA 3KFQA 4N8WA 2Y6EA 3F5VA 4P6EA 3H8BA 5JA7A 2G8EA 1AU3A 3O1GA 4XR7A 3KWBX 3RVVA 2VHFA 3M99A 8PCHA 2JQFR 4YYVA 2G7YA 1QMYA 1MEGA 4DMXA 3S3RA 3BPMA 1AU0A 1IWDA 3P5VA 1EWOA 4QBBA 3KSEA 3B79A 1THEA 3PNRA 4W5BA 3N4CA 2BDLA 1POPA 2GHUA 1AIMA 2FT2A 2ATOA 3K9MA 3QJ3A 3USVA 5CHTA 3KKUA 1ATKA 2FRQA 1CPJA 3HHIA 2E01A 3V6EA 3AI8A 3WXFA 1EWPA 4CZWA 1U5IA 2YJ8A 1QDQA 2DJFB 4AXLA 5FPWA 4Q8HA 3QT4A 4RY2A 5EGWA 2NQAA 1QXPA 3BWKA 2NQIA 4YYQA 1NPZA 2E02A 2ARYA 3C9EA 3HHAA 1YK7A 3PW3A 5EF4A 1GMYA 4YYWA 3MHSA 1PXVA 4YV8A 5A24A 1F29A 3ERVA 2P86A 4G54A 1U9QX 4DMYA 2GFOA 4OELA 4QH6A 4CDEB 1EWLA 1TLOA 4YYUA 5JH3A 4FJCA 2R9NA 1U9WA 1Y08A 1GCBA 1NB3A 1Q6KA 3N3GA 2R9CA 2H7JA 3U8EA 2DCDA 3PDFA 5CVNB 1TU6A 2DJGB 2PNSA 3QSDA 3IUTA 1SP4B 1F2AA 2NQGA 2HH5A 2HHNA 1BQIA 2R6NA 2PADA 2HD5A 1ICFA 1CB5A 1ITOA 2AVWA 1PIPA 3BOWA 1GLOA 1AYUA 1QOLA 9PAPA 3ZUAA 1NL6A 3IOQA 3KW9A 4X6HA 4BQVA 4CDFB 4Q8GA 7PCKA 3LXSA 4CDCB 4AXMA 3OF8A 1AU2A 3K24A 2DZYA 1CS8A 1FH0A 1BGOA 1PBHA 1CV8A 2R9OA 1PPPA 6PADA 3I3TA 4P6GA 2AS8A 3MORA 3P5XA 2Y5BA 3TNXA 1U9VA 1PPOA 3CBJA 1JQPA 2DCBA
chains in the Genus database with same CATH superfamily
2CB5A 2FQ9A 1MEMA 2OZ2A 4BS5A 2YJCA 1YT7A 4QRGA 3RVWA 1PVJA 3O0UA 5JZEA 3H89A 4MM3B 2DC6A 1PADA 4D8IA 4FIPA 4MZSA 3IMAA 1EF7A 2F7DA 2AYNA 2WBFX 2XU4A 5F02A 4XZXA 3H6SA 4PP2E 1VJVA 1YALA 2XU3A 1S4VA 3GCBA 1ZIVA 2E03A 3RNVA 3MP2A 1F2CA 1M6DA 2B1MA 5J94A 2DC8A 3HD3A 2IPPB 3LFYA 3PSEA 1NB5A 2FTDA 3NHEA 1NQCA 2FO5A 2AU1A 2DC9A 2JTCA 4YVAA 2P7UA 2E00A 2G8JA 1XKGA 1AECA 2G6DA 3CH3X 4YYRA 2YJ9A 3BC3A 1KFUL 4W5CA 3KWZA 1KHPA 4X6IA 2JQGR 5CVOB 2BDZA 2DC7A 2CIOA 2FYEA 2UZJA 2FRAA 4M0WA 3PBHA 3BPFA 2VHSA 4N4ZA 4MI7A 4RNAA 3F75A 4HWYA 4P16A 3V6CA 1Y4HA 1A6RA 4PP1A 4HXDB 1AYWA 3O65A 1TL9A 2FUDA 1AYVA 4KLBA 1ME4A 1CTEA 3S3QA 1PE6A 1AU4A 4PI3A 4WA6A 1KXRA 1ME3A 2DZZA 3BCNA 1VSNA 2F1GA 2AYOA 3OF9A 4MSXA 2AIMA 2YJ2A 3BBAA 3HWNA 1X9YA 2YJBA 4K7CA 2DCAA 2OP3A 3E9SA 2IBIA 1MHWA 4ZUXU 4OEMA 3MHHA 1HUCB 5CVMA 3KX1A 1KFXL 1CQDA 4BPVA 1BY8A 2HWKA 1YK8A 2PREA 4REZA 1PPNA 3OQCA 1F2BA 1YVBA 3K8UA 4XUIA 2DCCA 4BOUA 1DEUA 3MTNA 5EZQA 2Z84A 4PADA 1PCIA 2XU1A 1CJLA 2C0YA 1ZCMA 3RVXA 4QRXA 1O0EA 1SNKA 2J7QC 4BSQA 2NQDB 3OISA 2AGAA 3CBKA 4IP3A 1BP4A 4I04A 3IFUA 1DF0A 3CH2X 5PADA 3IEJA 1CVZA 3WXGA 4X6JA 1GECE 3PRMA 5K16A 4BS6A 1MDWA 1KHQA 4W4UA 2J7QA 3IV2A 3OVZA 1EWMA 2FE8A 2R9MA 3C0RA 1STFE 1MS6A 2P0RA 1MIRA 2R9FA 3E1ZB 2AUZA 4CDDB 3I06A 3WXEA 4BOQA 1CSBB 1K3BB 3H8CA 1NLJA 5CHVA 1PPDA 4N79A 2OULA 4QRVA 3W31A 4BOSA 3N3KA 1U9XA 2XU5A 4D8EA 5KO3A 3P5UA 2ACTA 5E6JA 2O6XA 3DF0A 4YYSA 3OVXA 4I05A 3TMPA 3IHPA 4I07A 2B1NA 2BTWB 2AUXA 3D6SA 3P5WA 4FK5A 3H7DA 2DOSA 2PBHA 4OVZB 4MZOA 2HXZA 3KFQA 4N8WA 2Y6EA 4PT5A 3F5VA 4RF0A 4P6EA 3H8BA 5JA7A 2G8EA 1AU3A 3O1GA 4XR7A 3KWBX 3RVVA 3MTVA 2VHFA 4BOZA 3M99A 8PCHA 2JQFR 4YYVA 2G7YA 1QMYA 1MEGA 4DMXA 3S3RA 4RF1A 4RKXA 2JRIA 3BPMA 3MJ5A 1AU0A 1IWDA 3P5VA 1EWOA 4QBBA 3KSEA 3B79A 1THEA 3PNRA 4W5BA 3N4CA 1DKIA 2BDLA 4A5UA 1POPA 2GHUA 4D8BA 1AIMA 2FT2A 2ATOA 5EZSA 3K9MA 3QJ3A 3USVA 5CHTA 3KKUA 1ATKA 2FRQA 1CPJA 3HHIA 2E01A 3V6EA 3AI8A 3WXFA 1EWPA 4CZWA 1U5IA 4R3DA 4WURA 2YJ8A 1QDQA 2DJFB 4AXLA 5FPWA 4Q8HA 3QT4A 4RY2A 5EGWA 2NQAA 1QXPA 3BWKA 2NQIA 4YYQA 1NPZA 2E02A 2ARYA 3C9EA 3PHXA 3PT2A 3HHAA 1YK7A 3PW3A 1UKFA 3TRKA 5EF4A 1GMYA 4YYWA 3MHSA 1PXVA 4YV8A 4GUAA 5A24A 1F29A 3ERVA 2P86A 4G54A 2BTWA 1U9QX 4DMYA 2GFOA 4OELA 4QH6A 4CDEB 4OVZA 1EWLA 1YZBA 1TLOA 4BOPA 4YYUA 5JH3A 4FJCA 2R9NA 1U9WA 1Y08A 3BY4A 1GCBA 1NB3A 1Q6KA 3PHUA 3N3GA 2R9CA 2H7JA 3W30A 3U8EA 2DCDA 3PDFA 5CVNB 1TU6A 2DJGB 2PNSA 3QSDA 3IUTA 1SP4B 1F2AA 2NQGA 2HH5A 2HHNA 1BQIA 2R6NA 2PADA 3PRPA 2HD5A 1ICFA 1CB5A 1ITOA 2AVWA 1PIPA 3ZNHA 3BOWA 1GLOA 1AYUA 1QOLA 9PAPA 3ZUAA 1NL6A 3IOQA 3KW9A 4X6HA 4BQVA 4CDFB 4Q8GA 4IUMA 7PCKA 3LXSA 4CDCB 4AXMA 3OF8A 4ZTBA 2BU3A 1AU2A 3K24A 2DZYA 4OW0A 1CS8A 1FH0A 1BGOA 3BB7A 1PBHA 1CV8A 3B21A 2R9OA 1PPPA 6PADA 3I3TA 4P6GA 2AS8A 3MORA 3P5XA 2Y5BA 3TNXA 1U9VA 1PPOA 3CBJA 1JQPA 3PHWA 2DCBA
chains in the Genus database with same CATH topology
2CB5A 2FQ9A 1MEMA 2OZ2A 4BS5A 2YJCA 1YT7A 4QRGA 3RVWA 3O0UA 3H89A 2DC6A 1PADA 4FIPA 4MZSA 3IMAA 1EF7A 2F7DA 2AYNA 2WBFX 2XU4A 5F02A 3H6SA 4PP2E 1VJVA 1YALA 2XU3A 1S4VA 3GCBA 1ZIVA 2E03A 1F2CA 1M6DA 2B1MA 5J94A 2DC8A 3HD3A 2IPPB 3LFYA 1NB5A 2FTDA 3NHEA 1NQCA 3D9WA 2FO5A 2BSZA 2AU1A 2DC9A 4YVAA 2P7UA 2E00A 2G8JA 1XKGA 1AECA 2G6DA 3CH3X 4YYRA 2YJ9A 3BC3A 1KFUL 4W5CA 3KWZA 1KHPA 4X6IA 2JQGR 5CVOB 2BDZA 2DC7A 2CIOA 2FYEA 2FRAA 3PBHA 3BPFA 2VHSA 4N4ZA 3F75A 4HWYA 3V6CA 1Y4HA 1A6RA 4PP1A 4C5PA 1AYWA 1TL9A 2FUDA 1AYVA 4KLBA 1ME4A 1CTEA 3S3QA 1PE6A 1AU4A 4PI3A 4WA6A 1KXRA 1ME3A 2DZZA 2VFCA 3BCNA 1VSNA 2F1GA 2AYOA 3OF9A 4MSXA 2AIMA 2YJ2A 3HWNA 1X9YA 2YJBA 4K7CA 2DCAA 2OP3A 2IBIA 1MHWA 4ZUXU 4OEMA 3MHHA 1HUCB 5CVMA 3KX1A 1KFXL 1CQDA 4BPVA 1BY8A 1YK8A 2PREA 1PPNA 1F2BA 1YVBA 3K8UA 4XUIA 2DCCA 1DEUA 3MTNA 4PADA 1PCIA 2XU1A 1CJLA 2C0YA 1ZCMA 3RVXA 4QRXA 1O0EA 1SNKA 4BSQA 2NQDB 3OISA 3CBKA 1BP4A 4I04A 1DF0A 3CH2X 5PADA 3IEJA 1CVZA 3WXGA 4X6JA 1GECE 5K16A 4BS6A 1MDWA 1GX3A 1KHQA 4W4UA 3IV2A 3OVZA 1EWMA 2R9MA 1STFE 1MS6A 2P0RA 1MIRA 2R9FA 3E1ZB 2AUZA 4CDDB 3I06A 3WXEA 1CSBB 1K3BB 3H8CA 1NLJA 5CHVA 1PPDA 4N79A 2OULA 4QRVA 3N3KA 1U9XA 2XU5A 3P5UA 2ACTA 2O6XA 3DF0A 4YYSA 3OVXA 4I05A 3IHPA 4I07A 2B1NA 2AUXA 3D6SA 3P5WA 4FK5A 4BGFA 3H7DA 2PBHA 4MZOA 2HXZA 3KFQA 4N8WA 2Y6EA 3F5VA 4P6EA 3H8BA 5JA7A 2G8EA 1AU3A 3O1GA 4XR7A 3KWBX 3RVVA 2VHFA 3M99A 8PCHA 2JQFR 4YYVA 2G7YA 1QMYA 1MEGA 4DMXA 3S3RA 3BPMA 1AU0A 1IWDA 1W4TA 3P5VA 1EWOA 4QBBA 3KSEA 3B79A 1THEA 3PNRA 4W5BA 3N4CA 2BDLA 1POPA 2GHUA 1AIMA 2FT2A 2ATOA 3K9MA 3QJ3A 3USVA 5CHTA 3KKUA 1ATKA 2FRQA 1E2TA 1CPJA 3HHIA 2E01A 3V6EA 3AI8A 4NV8A 3WXFA 1EWPA 4CZWA 1U5IA 2YJ8A 1QDQA 2DJFB 4AXLA 5FPWA 4Q8HA 3QT4A 4RY2A 5EGWA 2NQAA 1QXPA 3BWKA 2NQIA 4YYQA 1NPZA 2E02A 2ARYA 3C9EA 4NV7A 3HHAA 1YK7A 3PW3A 5EF4A 1GMYA 4YYWA 3MHSA 1PXVA 4YV8A 5A24A 1F29A 3ERVA 2P86A 4G54A 1U9QX 4DMYA 2GFOA 4OELA 4QH6A 4CDEB 1EWLA 1TLOA 4YYUA 5JH3A 4FJCA 2R9NA 1U9WA 1Y08A 1GCBA 1NB3A 1Q6KA 3N3GA 2R9CA 2H7JA 3U8EA 2DCDA 3PDFA 5CVNB 1TU6A 2DJGB 2PNSA 3QSDA 3IUTA 1SP4B 1F2AA 2NQGA 2HH5A 2HHNA 1BQIA 2R6NA 2PADA 2HD5A 1ICFA 1CB5A 1ITOA 3LTWA 2AVWA 1PIPA 3BOWA 1GLOA 1AYUA 1QOLA 9PAPA 3ZUAA 4GUZA 1NL6A 3IOQA 3KW9A 4X6HA 4BQVA 4CDFB 2VFBA 4Q8GA 7PCKA 3LXSA 4CDCB 4AXMA 3OF8A 1AU2A 3K24A 2DZYA 4B55A 1CS8A 1FH0A 1BGOA 1PBHA 1CV8A 2R9OA 1PPPA 1W6FA 6PADA 3I3TA 4P6GA 2AS8A 3MORA 3P5XA 2Y5BA 3TNXA 1U9VA 1W5RA 1PPOA 3CBJA 1JQPA 2DCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CB5 A;  2FQ9 A;  1MEM A;  2OZ2 A;  4BS5 A;  2YJC A;  1YT7 A;  4QRG A;  3RVW A;  3O0U A;  3H89 A;  2DC6 A;  1PAD A;  4FIP A;  4MZS A;  3IMA A;  1EF7 A;  2F7D A;  2AYN A;  2WBF X;  2XU4 A;  5F02 A;  3H6S A;  4PP2 E;  1VJV A;  1YAL A;  2XU3 A;  1S4V A;  3GCB A;  1ZIV A;  2E03 A;  1F2C A;  1M6D A;  2B1M A;  5J94 A;  2DC8 A;  3HD3 A;  2IPP B;  3LFY A;  1NB5 A;  2FTD A;  3NHE A;  1NQC A;  2FO5 A;  2AU1 A;  2DC9 A;  4YVA A;  2P7U A;  2E00 A;  2G8J A;  1XKG A;  1AEC A;  2G6D A;  3CH3 X;  4YYR A;  2YJ9 A;  3BC3 A;  1KFU L;  4W5C A;  3KWZ A;  1KHP A;  4X6I A;  2JQG R;  5CVO B;  2BDZ A;  2DC7 A;  2CIO A;  2FYE A;  2FRA A;  3PBH A;  3BPF A;  2VHS A;  4N4Z A;  3F75 A;  4HWY A;  3V6C A;  1Y4H A;  1A6R A;  4PP1 A;  1AYW A;  1TL9 A;  2FUD A;  1AYV A;  4KLB A;  1ME4 A;  1CTE A;  3S3Q A;  1PE6 A;  1AU4 A;  4PI3 A;  4WA6 A;  1KXR A;  1ME3 A;  2DZZ A;  3BCN A;  1VSN A;  2F1G A;  2AYO A;  3OF9 A;  4MSX A;  2AIM A;  2YJ2 A;  3HWN A;  1X9Y A;  2YJB A;  4K7C A;  2DCA A;  2OP3 A;  2IBI A;  1MHW A;  4ZUX U;  4OEM A;  3MHH A;  1HUC B;  5CVM A;  3KX1 A;  1KFX L;  1CQD A;  4BPV A;  1BY8 A;  1YK8 A;  2PRE A;  1PPN A;  1F2B A;  1YVB A;  3K8U A;  4XUI A;  2DCC A;  1DEU A;  3MTN A;  4PAD A;  1PCI A;  2XU1 A;  1CJL A;  2C0Y A;  1ZCM A;  3RVX A;  4QRX A;  1O0E A;  1SNK A;  4BSQ A;  2NQD B;  3OIS A;  3CBK A;  1BP4 A;  4I04 A;  1DF0 A;  3CH2 X;  5PAD A;  3IEJ A;  1CVZ A;  3WXG A;  4X6J A;  1GEC E;  5K16 A;  4BS6 A;  1MDW A;  1KHQ A;  4W4U A;  3IV2 A;  3OVZ A;  1EWM A;  2R9M A;  1STF E;  1MS6 A;  2P0R A;  1MIR A;  2R9F A;  3E1Z B;  2AUZ A;  4CDD B;  3I06 A;  3WXE A;  1CSB B;  1K3B B;  3H8C A;  1NLJ A;  5CHV A;  1PPD A;  4N79 A;  2OUL A;  4QRV A;  3N3K A;  1U9X A;  2XU5 A;  3P5U A;  2ACT A;  2O6X A;  3DF0 A;  4YYS A;  3OVX A;  4I05 A;  3IHP A;  4I07 A;  2B1N A;  2AUX A;  3D6S A;  3P5W A;  4FK5 A;  3H7D A;  2PBH A;  4MZO A;  2HXZ A;  3KFQ A;  4N8W A;  2Y6E A;  3F5V A;  4P6E A;  3H8B A;  5JA7 A;  2G8E A;  1AU3 A;  3O1G A;  4XR7 A;  3KWB X;  3RVV A;  2VHF A;  3M99 A;  8PCH A;  2JQF R;  4YYV A;  2G7Y A;  1QMY A;  1MEG A;  4DMX A;  3S3R A;  3BPM A;  1AU0 A;  1IWD A;  3P5V A;  1EWO A;  4QBB A;  3KSE A;  3B79 A;  1THE A;  3PNR A;  4W5B A;  3N4C A;  2BDL A;  1POP A;  2GHU A;  1AIM A;  2FT2 A;  2ATO A;  3K9M A;  3QJ3 A;  3USV A;  5CHT A;  3KKU A;  1ATK A;  2FRQ A;  1CPJ A;  3HHI A;  2E01 A;  3V6E A;  3AI8 A;  3WXF A;  1EWP A;  4CZW A;  1U5I A;  2YJ8 A;  1QDQ A;  2DJF B;  4AXL A;  5FPW A;  4Q8H A;  3QT4 A;  4RY2 A;  5EGW A;  2NQA A;  1QXP A;  3BWK A;  2NQI A;  4YYQ A;  1NPZ A;  2E02 A;  2ARY A;  3C9E A;  3HHA A;  1YK7 A;  3PW3 A;  5EF4 A;  1GMY A;  4YYW A;  3MHS A;  1PXV A;  4YV8 A;  5A24 A;  1F29 A;  3ERV A;  2P86 A;  4G54 A;  1U9Q X;  4DMY A;  2GFO A;  4OEL A;  4QH6 A;  4CDE B;  1EWL A;  1TLO A;  4YYU A;  5JH3 A;  4FJC A;  2R9N A;  1U9W A;  1Y08 A;  1GCB A;  1NB3 A;  1Q6K A;  3N3G A;  2R9C A;  2H7J A;  3U8E A;  2DCD A;  3PDF A;  5CVN B;  1TU6 A;  2DJG B;  2PNS A;  3QSD A;  3IUT A;  1SP4 B;  1F2A A;  2NQG A;  2HH5 A;  2HHN A;  1BQI A;  2R6N A;  2PAD A;  2HD5 A;  1ICF A;  1CB5 A;  1ITO A;  2AVW A;  1PIP A;  3BOW A;  1GLO A;  1AYU A;  1QOL A;  9PAP A;  3ZUA A;  1NL6 A;  3IOQ A;  3KW9 A;  4X6H A;  4BQV A;  4CDF B;  4Q8G A;  7PCK A;  3LXS A;  4CDC B;  4AXM A;  3OF8 A;  1AU2 A;  3K24 A;  2DZY A;  1CS8 A;  1FH0 A;  1BGO A;  1PBH A;  1CV8 A;  2R9O A;  1PPP A;  6PAD A;  3I3T A;  4P6G A;  2AS8 A;  3MOR A;  3P5X A;  2Y5B A;  3TNX A;  1U9V A;  1PPO A;  3CBJ A;  1JQP A;  2DCB A; 
#chains in the Genus database with same CATH topology
 2CB5 A;  2FQ9 A;  1MEM A;  2OZ2 A;  4BS5 A;  2YJC A;  1YT7 A;  4QRG A;  3RVW A;  1PVJ A;  3O0U A;  5JZE A;  3H89 A;  4MM3 B;  2DC6 A;  1PAD A;  4D8I A;  4FIP A;  4MZS A;  3IMA A;  1EF7 A;  2F7D A;  2AYN A;  2WBF X;  2XU4 A;  5F02 A;  4XZX A;  3H6S A;  4PP2 E;  1VJV A;  1YAL A;  2XU3 A;  1S4V A;  3GCB A;  1ZIV A;  2E03 A;  3RNV A;  3MP2 A;  1F2C A;  1M6D A;  2B1M A;  5J94 A;  2DC8 A;  3HD3 A;  2IPP B;  3LFY A;  3PSE A;  1NB5 A;  2FTD A;  3NHE A;  1NQC A;  2FO5 A;  2AU1 A;  2DC9 A;  2JTC A;  4YVA A;  2P7U A;  2E00 A;  2G8J A;  1XKG A;  1AEC A;  2G6D A;  3CH3 X;  4YYR A;  2YJ9 A;  3BC3 A;  1KFU L;  4W5C A;  3KWZ A;  1KHP A;  4X6I A;  2JQG R;  5CVO B;  2BDZ A;  2DC7 A;  2CIO A;  2FYE A;  2UZJ A;  2FRA A;  4M0W A;  3PBH A;  3BPF A;  2VHS A;  4N4Z A;  4MI7 A;  4RNA A;  3F75 A;  4HWY A;  4P16 A;  3V6C A;  1Y4H A;  1A6R A;  4PP1 A;  4HXD B;  1AYW A;  3O65 A;  1TL9 A;  2FUD A;  1AYV A;  4KLB A;  1ME4 A;  1CTE A;  3S3Q A;  1PE6 A;  1AU4 A;  4PI3 A;  4WA6 A;  1KXR A;  1ME3 A;  2DZZ A;  3BCN A;  1VSN A;  2F1G A;  2AYO A;  3OF9 A;  4MSX A;  2AIM A;  2YJ2 A;  3BBA A;  3HWN A;  1X9Y A;  2YJB A;  4K7C A;  2DCA A;  2OP3 A;  3E9S A;  2IBI A;  1MHW A;  4ZUX U;  4OEM A;  3MHH A;  1HUC B;  5CVM A;  3KX1 A;  1KFX L;  1CQD A;  4BPV A;  1BY8 A;  2HWK A;  1YK8 A;  2PRE A;  4REZ A;  1PPN A;  3OQC A;  1F2B A;  1YVB A;  3K8U A;  4XUI A;  2DCC A;  4BOU A;  1DEU A;  3MTN A;  5EZQ A;  2Z84 A;  4PAD A;  1PCI A;  2XU1 A;  1CJL A;  2C0Y A;  1ZCM A;  3RVX A;  4QRX A;  1O0E A;  1SNK A;  2J7Q C;  4BSQ A;  2NQD B;  3OIS A;  2AGA A;  3CBK A;  4IP3 A;  1BP4 A;  4I04 A;  3IFU A;  1DF0 A;  3CH2 X;  5PAD A;  3IEJ A;  1CVZ A;  3WXG A;  4X6J A;  1GEC E;  3PRM A;  5K16 A;  4BS6 A;  1MDW A;  1KHQ A;  4W4U A;  2J7Q A;  3IV2 A;  3OVZ A;  1EWM A;  2FE8 A;  2R9M A;  3C0R A;  1STF E;  1MS6 A;  2P0R A;  1MIR A;  2R9F A;  3E1Z B;  2AUZ A;  4CDD B;  3I06 A;  3WXE A;  4BOQ A;  1CSB B;  1K3B B;  3H8C A;  1NLJ A;  5CHV A;  1PPD A;  4N79 A;  2OUL A;  4QRV A;  3W31 A;  4BOS A;  3N3K A;  1U9X A;  2XU5 A;  4D8E A;  5KO3 A;  3P5U A;  2ACT A;  5E6J A;  2O6X A;  3DF0 A;  4YYS A;  3OVX A;  4I05 A;  3TMP A;  3IHP A;  4I07 A;  2B1N A;  2BTW B;  2AUX A;  3D6S A;  3P5W A;  4FK5 A;  3H7D A;  2DOS A;  2PBH A;  4OVZ B;  4MZO A;  2HXZ A;  3KFQ A;  4N8W A;  2Y6E A;  4PT5 A;  3F5V A;  4RF0 A;  4P6E A;  3H8B A;  5JA7 A;  2G8E A;  1AU3 A;  3O1G A;  4XR7 A;  3KWB X;  3RVV A;  3MTV A;  2VHF A;  4BOZ A;  3M99 A;  8PCH A;  2JQF R;  4YYV A;  2G7Y A;  1QMY A;  1MEG A;  4DMX A;  3S3R A;  4RF1 A;  4RKX A;  2JRI A;  3BPM A;  3MJ5 A;  1AU0 A;  1IWD A;  3P5V A;  1EWO A;  4QBB A;  3KSE A;  3B79 A;  1THE A;  3PNR A;  4W5B A;  3N4C A;  1DKI A;  2BDL A;  4A5U A;  1POP A;  2GHU A;  4D8B A;  1AIM A;  2FT2 A;  2ATO A;  5EZS A;  3K9M A;  3QJ3 A;  3USV A;  5CHT A;  3KKU A;  1ATK A;  2FRQ A;  1CPJ A;  3HHI A;  2E01 A;  3V6E A;  3AI8 A;  3WXF A;  1EWP A;  4CZW A;  1U5I A;  4R3D A;  4WUR A;  2YJ8 A;  1QDQ A;  2DJF B;  4AXL A;  5FPW A;  4Q8H A;  3QT4 A;  4RY2 A;  5EGW A;  2NQA A;  1QXP A;  3BWK A;  2NQI A;  4YYQ A;  1NPZ A;  2E02 A;  2ARY A;  3C9E A;  3PHX A;  3PT2 A;  3HHA A;  1YK7 A;  3PW3 A;  1UKF A;  3TRK A;  5EF4 A;  1GMY A;  4YYW A;  3MHS A;  1PXV A;  4YV8 A;  4GUA A;  5A24 A;  1F29 A;  3ERV A;  2P86 A;  4G54 A;  2BTW A;  1U9Q X;  4DMY A;  2GFO A;  4OEL A;  4QH6 A;  4CDE B;  4OVZ A;  1EWL A;  1YZB A;  1TLO A;  4BOP A;  4YYU A;  5JH3 A;  4FJC A;  2R9N A;  1U9W A;  1Y08 A;  3BY4 A;  1GCB A;  1NB3 A;  1Q6K A;  3PHU A;  3N3G A;  2R9C A;  2H7J A;  3W30 A;  3U8E A;  2DCD A;  3PDF A;  5CVN B;  1TU6 A;  2DJG B;  2PNS A;  3QSD A;  3IUT A;  1SP4 B;  1F2A A;  2NQG A;  2HH5 A;  2HHN A;  1BQI A;  2R6N A;  2PAD A;  3PRP A;  2HD5 A;  1ICF A;  1CB5 A;  1ITO A;  2AVW A;  1PIP A;  3ZNH A;  3BOW A;  1GLO A;  1AYU A;  1QOL A;  9PAP A;  3ZUA A;  1NL6 A;  3IOQ A;  3KW9 A;  4X6H A;  4BQV A;  4CDF B;  4Q8G A;  4IUM A;  7PCK A;  3LXS A;  4CDC B;  4AXM A;  3OF8 A;  4ZTB A;  2BU3 A;  1AU2 A;  3K24 A;  2DZY A;  4OW0 A;  1CS8 A;  1FH0 A;  1BGO A;  3BB7 A;  1PBH A;  1CV8 A;  3B21 A;  2R9O A;  1PPP A;  6PAD A;  3I3T A;  4P6G A;  2AS8 A;  3MOR A;  3P5X A;  2Y5B A;  3TNX A;  1U9V A;  1PPO A;  3CBJ A;  1JQP A;  3PHW A;  2DCB A; 
#chains in the Genus database with same CATH homology
 2CB5 A;  2FQ9 A;  1MEM A;  2OZ2 A;  4BS5 A;  2YJC A;  1YT7 A;  4QRG A;  3RVW A;  3O0U A;  3H89 A;  2DC6 A;  1PAD A;  4FIP A;  4MZS A;  3IMA A;  1EF7 A;  2F7D A;  2AYN A;  2WBF X;  2XU4 A;  5F02 A;  3H6S A;  4PP2 E;  1VJV A;  1YAL A;  2XU3 A;  1S4V A;  3GCB A;  1ZIV A;  2E03 A;  1F2C A;  1M6D A;  2B1M A;  5J94 A;  2DC8 A;  3HD3 A;  2IPP B;  3LFY A;  1NB5 A;  2FTD A;  3NHE A;  1NQC A;  3D9W A;  2FO5 A;  2BSZ A;  2AU1 A;  2DC9 A;  4YVA A;  2P7U A;  2E00 A;  2G8J A;  1XKG A;  1AEC A;  2G6D A;  3CH3 X;  4YYR A;  2YJ9 A;  3BC3 A;  1KFU L;  4W5C A;  3KWZ A;  1KHP A;  4X6I A;  2JQG R;  5CVO B;  2BDZ A;  2DC7 A;  2CIO A;  2FYE A;  2FRA A;  3PBH A;  3BPF A;  2VHS A;  4N4Z A;  3F75 A;  4HWY A;  3V6C A;  1Y4H A;  1A6R A;  4PP1 A;  4C5P A;  1AYW A;  1TL9 A;  2FUD A;  1AYV A;  4KLB A;  1ME4 A;  1CTE A;  3S3Q A;  1PE6 A;  1AU4 A;  4PI3 A;  4WA6 A;  1KXR A;  1ME3 A;  2DZZ A;  2VFC A;  3BCN A;  1VSN A;  2F1G A;  2AYO A;  3OF9 A;  4MSX A;  2AIM A;  2YJ2 A;  3HWN A;  1X9Y A;  2YJB A;  4K7C A;  2DCA A;  2OP3 A;  2IBI A;  1MHW A;  4ZUX U;  4OEM A;  3MHH A;  1HUC B;  5CVM A;  3KX1 A;  1KFX L;  1CQD A;  4BPV A;  1BY8 A;  1YK8 A;  2PRE A;  1PPN A;  1F2B A;  1YVB A;  3K8U A;  4XUI A;  2DCC A;  1DEU A;  3MTN A;  4PAD A;  1PCI A;  2XU1 A;  1CJL A;  2C0Y A;  1ZCM A;  3RVX A;  4QRX A;  1O0E A;  1SNK A;  4BSQ A;  2NQD B;  3OIS A;  3CBK A;  1BP4 A;  4I04 A;  1DF0 A;  3CH2 X;  5PAD A;  3IEJ A;  1CVZ A;  3WXG A;  4X6J A;  1GEC E;  5K16 A;  4BS6 A;  1MDW A;  1GX3 A;  1KHQ A;  4W4U A;  3IV2 A;  3OVZ A;  1EWM A;  2R9M A;  1STF E;  1MS6 A;  2P0R A;  1MIR A;  2R9F A;  3E1Z B;  2AUZ A;  4CDD B;  3I06 A;  3WXE A;  1CSB B;  1K3B B;  3H8C A;  1NLJ A;  5CHV A;  1PPD A;  4N79 A;  2OUL A;  4QRV A;  3N3K A;  1U9X A;  2XU5 A;  3P5U A;  2ACT A;  2O6X A;  3DF0 A;  4YYS A;  3OVX A;  4I05 A;  3IHP A;  4I07 A;  2B1N A;  2AUX A;  3D6S A;  3P5W A;  4FK5 A;  4BGF A;  3H7D A;  2PBH A;  4MZO A;  2HXZ A;  3KFQ A;  4N8W A;  2Y6E A;  3F5V A;  4P6E A;  3H8B A;  5JA7 A;  2G8E A;  1AU3 A;  3O1G A;  4XR7 A;  3KWB X;  3RVV A;  2VHF A;  3M99 A;  8PCH A;  2JQF R;  4YYV A;  2G7Y A;  1QMY A;  1MEG A;  4DMX A;  3S3R A;  3BPM A;  1AU0 A;  1IWD A;  1W4T A;  3P5V A;  1EWO A;  4QBB A;  3KSE A;  3B79 A;  1THE A;  3PNR A;  4W5B A;  3N4C A;  2BDL A;  1POP A;  2GHU A;  1AIM A;  2FT2 A;  2ATO A;  3K9M A;  3QJ3 A;  3USV A;  5CHT A;  3KKU A;  1ATK A;  2FRQ A;  1E2T A;  1CPJ A;  3HHI A;  2E01 A;  3V6E A;  3AI8 A;  4NV8 A;  3WXF A;  1EWP A;  4CZW A;  1U5I A;  2YJ8 A;  1QDQ A;  2DJF B;  4AXL A;  5FPW A;  4Q8H A;  3QT4 A;  4RY2 A;  5EGW A;  2NQA A;  1QXP A;  3BWK A;  2NQI A;  4YYQ A;  1NPZ A;  2E02 A;  2ARY A;  3C9E A;  4NV7 A;  3HHA A;  1YK7 A;  3PW3 A;  5EF4 A;  1GMY A;  4YYW A;  3MHS A;  1PXV A;  4YV8 A;  5A24 A;  1F29 A;  3ERV A;  2P86 A;  4G54 A;  1U9Q X;  4DMY A;  2GFO A;  4OEL A;  4QH6 A;  4CDE B;  1EWL A;  1TLO A;  4YYU A;  5JH3 A;  4FJC A;  2R9N A;  1U9W A;  1Y08 A;  1GCB A;  1NB3 A;  1Q6K A;  3N3G A;  2R9C A;  2H7J A;  3U8E A;  2DCD A;  3PDF A;  5CVN B;  1TU6 A;  2DJG B;  2PNS A;  3QSD A;  3IUT A;  1SP4 B;  1F2A A;  2NQG A;  2HH5 A;  2HHN A;  1BQI A;  2R6N A;  2PAD A;  2HD5 A;  1ICF A;  1CB5 A;  1ITO A;  3LTW A;  2AVW A;  1PIP A;  3BOW A;  1GLO A;  1AYU A;  1QOL A;  9PAP A;  3ZUA A;  4GUZ A;  1NL6 A;  3IOQ A;  3KW9 A;  4X6H A;  4BQV A;  4CDF B;  2VFB A;  4Q8G A;  7PCK A;  3LXS A;  4CDC B;  4AXM A;  3OF8 A;  1AU2 A;  3K24 A;  2DZY A;  4B55 A;  1CS8 A;  1FH0 A;  1BGO A;  1PBH A;  1CV8 A;  2R9O A;  1PPP A;  1W6F A;  6PAD A;  3I3T A;  4P6G A;  2AS8 A;  3MOR A;  3P5X A;  2Y5B A;  3TNX A;  1U9V A;  1W5R A;  1PPO A;  3CBJ A;  1JQP A;  2DCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...