1ITOA

Crystal structure analysis of bovine spleen cathepsin b-e64c complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
253
structure length
251
Chain Sequence
b'LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Structural basis for development of cathepsin B-specific noncovalent-type inhibitor: crystal structure of cathepsin B-E64c complex
pubmed doi rcsb
molecule tags Hydrolase
total genus 76
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2002-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1itoA00
4I05A 2ACTA 1AU0A 3RVWA 4I07A 2AU1A 2YJ9A 1QDQA 2B1NA 1ICFA 1AU2A 4QBBA 3MHSA 3K9MA 1M6DA 9PAPA 3E1ZB 1DEUA 2XU1A 3LXSA 1CB5A 1QXPA 3IEJA 4P6EA 1EWPA 1CV8A 8PCHA 3CH2X 3KSEA 2ATOA 4YYUA 1PIPA 2NQGA 2YJBA 4WA6A 3IMAA 3PNRA 4CDFB 2C0YA 5F02A 3H7DA 2AUZA 3OVXA 1VJVA 4BS6A 1CQDA 1TL9A 1CSBB 3ERVA 3MORA 1SP4B 3NHEA 3WXGA 3D6SA 2PADA 4W5CA 2XU5A 1K3BB 4YYWA 3AI8A 3P5XA 4Q8GA 1BGOA 2P86A 1Y08A 3CH3X 4X6IA 1NB3A 3BWKA 2FYEA 1MEGA 2R9OA 2R9FA 3WXEA 3N4CA 1KXRA 2P0RA 3HD3A 4W4UA 2DC6A 2F7DA 2BDLA 4X6HA 3U8EA 3H8BA 1SNKA 6PADA 4XUIA 3RVXA 3M99A 2WBFX 5J94A 3OISA 1A6RA 3KKUA 2OULA 4PP2E 4FK5A 1AYWA 1PPNA 3H89A 2G8EA 1TU6A 2OZ2A 3P5UA 4YVAA 1GCBA 5CVOB 1NL6A 3KWZA 1YALA 3C9EA 3IV2A 1YVBA 3P5VA 2P7UA 1AYVA 4MZOA 1KHQA 3IOQA 3BC3A 1QOLA 4HWYA 3S3QA 3V6CA 1F2CA 2PREA 4W5BA 4N79A 4QRGA 3TNXA 5JA7A 1ME3A 1NLJA 3WXFA 4CDCB 2O6XA 2YJ8A 2CB5A 3OF8A 3V6EA 1EF7A 4DMYA 5CHTA 2VHFA 3B79A 1AYUA 2Y5BA 3H8CA 3N3GA 1BY8A 4I04A 4QRXA 3BPMA 1QMYA 1MHWA 4BQVA 3PW3A 1JQPA 3CBJA 1POPA 2DZYA 1GMYA 3N3KA 1U5IA 2E01A 1GECE 2GFOA 4CZWA 2AYOA 3O0UA 4MSXA 2B1MA 2JQFR 2R9MA 1PBHA 3QJ3A 1CPJA 1KHPA 1X9YA 1NPZA 2XU4A 4YYVA 2E03A 2YJCA 4YYRA 1MIRA 5K16A 1MS6A 1KFUL 3HHIA 5A24A 3PBHA 3KFQA 1CVZA 3QT4A 5JH3A 1PADA 1ME4A 2AYNA 2R6NA 3BOWA 2DC9A 1AU4A 2DC8A 1PPPA 1EWMA 1KFXL 4OELA 3I3TA 4YYSA 1XKGA 1Q6KA 1PCIA 2FO5A 1ATKA 4P6GA 4BS5A 2G7YA 1AECA 2PBHA 3F5VA 4QH6A 1U9VA 4X6JA 3USVA 1DF0A 3HWNA 4MZSA 3OF9A 3DF0A 3KW9A 2AVWA 3S3RA 2G8JA 1GLOA 1MEMA 1S4VA 4N8WA 2FUDA 2GHUA 4AXMA 1NQCA 3HHAA 1FH0A 2ARYA 5CVNB 2NQIA 2HH5A 2DCDA 4XR7A 2AIMA 2PNSA 3MHHA 3QSDA 1AIMA 2HD5A 2DJFB 2VHSA 4CDDB 2FRAA 2AS8A 4YV8A 2OP3A 2XU3A 3RVVA 4PP1A 4FIPA 2NQAA 1THEA 4AXLA 4G54A 1YK8A 3BCNA 1AU3A 2AUXA 1PXVA 3GCBA 1BP4A 1F2BA 3PDFA 1STFE 1TLOA 1CS8A 2HHNA 2IBIA 2FT2A 2IPPB 2E00A 3P5WA 3CBKA 5PADA 4BSQA 4ZUXU 1PPOA 2JQGR 4YYQA 4OEMA 1MDWA 3K24A 4Q8HA 2DJGB 2G6DA 3F75A 1PPDA 1IWDA 1U9QX 1ZIVA 1YK7A 2NQDB 4RY2A 2R9NA 1HUCB 5FPWA 2DCAA 5EGWA 4N4ZA 2BDZA 3ZUAA 2H7JA 5EF4A 3LFYA 1U9XA 1BQIA 1ZCMA 7PCKA 2DZZA 3BPFA 1U9WA 3MTNA 2DCBA 1EWOA 1VSNA 3H6SA 4DMXA 3OVZA 3KX1A 1F2AA 2FRQA 4FJCA 3K8UA 3I06A 3KWBX 1YT7A 1CTEA 2CIOA 1CJLA 1F29A 2DCCA 2FQ9A 1EWLA 2DC7A 4QRVA 1Y4HA 4K7CA 2F1GA 2E02A 1NB5A 3IHPA 2YJ2A 1PE6A 2Y6EA 2FTDA 1O0EA 2HXZA 1ITOA 4BPVA 5CVMA 2R9CA 3IUTA 4PADA 5CHVA 4PI3A 3O1GA 4CDEB 4KLBA
chains in the Genus database with same CATH superfamily
4I05A 2ACTA 3B21A 1AU0A 4HXDB 3RVWA 4I07A 2AU1A 2UZJA 2YJ9A 1QDQA 2B1NA 2BU3A 1ICFA 1AU2A 4QBBA 3MHSA 4D8BA 3K9MA 1M6DA 9PAPA 3E1ZB 1DEUA 2JTCA 2XU1A 3LXSA 1CB5A 2FE8A 1QXPA 3IEJA 4P6EA 1EWPA 1CV8A 4GUAA 4PT5A 3CH2X 3KSEA 8PCHA 3E9SA 2ATOA 4YYUA 1PIPA 2NQGA 2YJBA 4WA6A 3IMAA 3PNRA 4CDFB 3RNVA 2C0YA 5F02A 3MP2A 3H7DA 2AUZA 3PT2A 3OVXA 1VJVA 4BS6A 1CQDA 1TL9A 1CSBB 3ERVA 3MORA 1SP4B 3NHEA 4A5UA 3WXGA 3D6SA 2PADA 4W5CA 2XU5A 1K3BB 1UKFA 4YYWA 3AI8A 3P5XA 4Q8GA 1BGOA 2P86A 1Y08A 3CH3X 4X6IA 1NB3A 3BWKA 2FYEA 3OQCA 1MEGA 2R9OA 2R9FA 3WXEA 3W30A 3N4CA 1KXRA 2P0RA 3HD3A 4W4UA 2DC6A 3MJ5A 2F7DA 2BDLA 5EZQA 4X6HA 3U8EA 3H8BA 1SNKA 6PADA 4XUIA 1PVJA 3RVXA 3M99A 2WBFX 5J94A 3OISA 1A6RA 3KKUA 2OULA 4PP2E 4FK5A 1AYWA 3PHUA 1PPNA 3H89A 2G8EA 4OW0A 1TU6A 2OZ2A 3P5UA 4IP3A 4YVAA 1GCBA 5E6JA 5CVOB 1NL6A 3KWZA 1YALA 3C9EA 3IV2A 4RKXA 1YVBA 3P5VA 4WURA 2P7UA 1AYVA 4MZOA 1KHQA 3IOQA 3BC3A 3PRMA 1QOLA 4HWYA 3S3QA 3V6CA 1F2CA 3ZNHA 4MM3B 2PREA 4W5BA 4N79A 4QRGA 4RF0A 3TNXA 5JA7A 1ME3A 1NLJA 3WXFA 4CDCB 2O6XA 2YJ8A 3MTVA 2CB5A 3OF8A 3BY4A 3V6EA 3PRPA 1EF7A 4DMYA 5CHTA 2VHFA 3B79A 1AYUA 4M0WA 2Y5BA 4D8IA 3H8CA 3N3GA 1BY8A 4I04A 4QRXA 3BPMA 1QMYA 4P16A 1MHWA 4BQVA 3IFUA 3O65A 3PW3A 1JQPA 3CBJA 1POPA 2DZYA 1GMYA 3N3KA 1U5IA 2E01A 4MI7A 1GECE 2HWKA 2GFOA 2JRIA 2AYOA 4CZWA 3O0UA 4MSXA 2B1MA 2JQFR 2R9MA 2Z84A 1PBHA 3QJ3A 1CPJA 1KHPA 1X9YA 1NPZA 2XU4A 4YYVA 2E03A 2YJCA 4YYRA 1MIRA 4BOUA 5K16A 1MS6A 1KFUL 3HHIA 4OVZB 4RNAA 3C0RA 5A24A 3PBHA 3KFQA 1CVZA 1DKIA 3QT4A 5JH3A 1PADA 1ME4A 2AYNA 2J7QA 2R6NA 3BOWA 2DC9A 1AU4A 2DC8A 3BBAA 1PPPA 1EWMA 1KFXL 4OELA 3I3TA 4YYSA 1XKGA 1Q6KA 1PCIA 2FO5A 1ATKA 4BOSA 4P6GA 4BS5A 2G7YA 1AECA 2PBHA 3F5VA 4QH6A 2J7QC 1U9VA 4X6JA 3USVA 1DF0A 3HWNA 4MZSA 3OF9A 3DF0A 3KW9A 2AVWA 3S3RA 2G8JA 1GLOA 1MEMA 1S4VA 4N8WA 2FUDA 2GHUA 4AXMA 1NQCA 3HHAA 2DOSA 1FH0A 2ARYA 5CVNB 2NQIA 2BTWB 2HH5A 2DCDA 4XR7A 2AIMA 2PNSA 3MHHA 5KO3A 4BOZA 3PSEA 3QSDA 5JZEA 2AGAA 4BOPA 1AIMA 2HD5A 2DJFB 2VHSA 4CDDB 2FRAA 2AS8A 4R3DA 4YV8A 2OP3A 2XU3A 4BOQA 3RVVA 4PP1A 4RF1A 4FIPA 2NQAA 1THEA 4AXLA 4G54A 1YK8A 3BCNA 1AU3A 2AUXA 1PXVA 3GCBA 1BP4A 1F2BA 3PDFA 1STFE 1TLOA 4OVZA 1CS8A 2HHNA 2IBIA 4REZA 3PHWA 2FT2A 2IPPB 2E00A 3P5WA 4ZTBA 3CBKA 5PADA 4BSQA 4ZUXU 1PPOA 2JQGR 4YYQA 4OEMA 1MDWA 3K24A 4Q8HA 2DJGB 2G6DA 3F75A 1PPDA 1IWDA 1U9QX 1ZIVA 3TRKA 1YK7A 2NQDB 4RY2A 4XZXA 2R9NA 1HUCB 5FPWA 2DCAA 5EGWA 4N4ZA 2BDZA 3ZUAA 2H7JA 5EF4A 2BTWA 4IUMA 3LFYA 1U9XA 1BQIA 1ZCMA 7PCKA 2DZZA 3BPFA 1U9WA 3MTNA 2DCBA 1EWOA 1VSNA 5EZSA 3H6SA 4DMXA 3OVZA 3KX1A 1F2AA 2FRQA 4FJCA 3K8UA 3I06A 3KWBX 1YT7A 1CTEA 3TMPA 2CIOA 1CJLA 1F29A 3PHXA 2DCCA 2FQ9A 1EWLA 2DC7A 4QRVA 1Y4HA 4K7CA 4D8EA 2F1GA 2E02A 1NB5A 3IHPA 2YJ2A 1PE6A 3BB7A 2Y6EA 2FTDA 1O0EA 2HXZA 1ITOA 4BPVA 5CVMA 2R9CA 3IUTA 1YZBA 4PADA 3W31A 5CHVA 4PI3A 3O1GA 4CDEB 4KLBA
chains in the Genus database with same CATH topology
4I05A 2ACTA 1GX3A 3D9WA 1AU0A 3RVWA 4I07A 2AU1A 2YJ9A 1QDQA 2B1NA 1ICFA 1AU2A 4QBBA 3MHSA 3K9MA 1M6DA 9PAPA 3E1ZB 1DEUA 2XU1A 3LXSA 1CB5A 1QXPA 3IEJA 4P6EA 1EWPA 1CV8A 8PCHA 3CH2X 3KSEA 2ATOA 4YYUA 1PIPA 2NQGA 2YJBA 4WA6A 3IMAA 3PNRA 4CDFB 2C0YA 5F02A 3H7DA 2AUZA 3OVXA 1VJVA 4BS6A 1CQDA 1TL9A 1CSBB 3ERVA 3MORA 1SP4B 3NHEA 3WXGA 3D6SA 2PADA 4W5CA 2XU5A 1K3BB 4YYWA 3AI8A 3P5XA 4Q8GA 1BGOA 2P86A 1Y08A 3CH3X 4X6IA 1NB3A 3BWKA 2FYEA 1MEGA 2R9OA 2R9FA 3WXEA 3N4CA 1KXRA 2P0RA 3HD3A 4W4UA 2DC6A 2F7DA 2BDLA 4X6HA 3U8EA 3H8BA 1SNKA 6PADA 4XUIA 3RVXA 3M99A 2WBFX 5J94A 3OISA 1A6RA 3KKUA 2OULA 4PP2E 4FK5A 1AYWA 1PPNA 3H89A 2G8EA 1TU6A 2OZ2A 3P5UA 4YVAA 1GCBA 5CVOB 1NL6A 3KWZA 1YALA 3C9EA 3IV2A 1YVBA 3P5VA 2P7UA 1AYVA 4MZOA 1W5RA 1KHQA 3IOQA 3BC3A 1QOLA 4HWYA 3S3QA 3V6CA 1F2CA 2PREA 4W5BA 4N79A 4QRGA 3TNXA 5JA7A 1ME3A 1NLJA 3WXFA 4CDCB 2O6XA 2YJ8A 2CB5A 3OF8A 3V6EA 1EF7A 4DMYA 5CHTA 2VHFA 3B79A 1AYUA 2Y5BA 3H8CA 3N3GA 1BY8A 4I04A 4QRXA 3BPMA 1QMYA 1MHWA 4BQVA 3PW3A 1JQPA 3CBJA 1POPA 2DZYA 1GMYA 3N3KA 1U5IA 2E01A 1GECE 2GFOA 4CZWA 2AYOA 3O0UA 4MSXA 2B1MA 2JQFR 2R9MA 1PBHA 3QJ3A 1CPJA 1KHPA 1X9YA 1NPZA 2XU4A 4YYVA 2E03A 2YJCA 4YYRA 1MIRA 5K16A 1MS6A 1KFUL 3HHIA 5A24A 1E2TA 3KFQA 3PBHA 1CVZA 4GUZA 3QT4A 5JH3A 1PADA 1ME4A 2AYNA 2R6NA 3BOWA 2DC9A 1AU4A 2DC8A 1PPPA 1EWMA 1KFXL 4OELA 3I3TA 4YYSA 2BSZA 1XKGA 1Q6KA 1PCIA 2FO5A 1ATKA 4P6GA 4BS5A 2G7YA 1AECA 2PBHA 3F5VA 4QH6A 1U9VA 4X6JA 3USVA 1DF0A 3HWNA 4MZSA 3OF9A 3DF0A 3KW9A 2AVWA 3LTWA 3S3RA 2G8JA 1GLOA 1MEMA 1S4VA 4N8WA 2FUDA 2GHUA 4AXMA 1NQCA 3HHAA 1FH0A 2ARYA 5CVNB 2NQIA 2HH5A 2DCDA 4XR7A 2AIMA 2PNSA 3MHHA 3QSDA 1AIMA 2HD5A 2DJFB 2VHSA 4CDDB 2FRAA 2AS8A 4YV8A 2OP3A 2XU3A 3RVVA 4B55A 2VFCA 4PP1A 4FIPA 2NQAA 1THEA 4AXLA 4G54A 1YK8A 3BCNA 1AU3A 2AUXA 1PXVA 3GCBA 1BP4A 1F2BA 3PDFA 1STFE 1TLOA 1CS8A 2HHNA 2IBIA 2FT2A 2IPPB 2E00A 3P5WA 3CBKA 5PADA 4BSQA 4ZUXU 1PPOA 2JQGR 4YYQA 4OEMA 1MDWA 3K24A 4Q8HA 2DJGB 2G6DA 3F75A 1PPDA 1IWDA 1W4TA 1U9QX 2VFBA 1ZIVA 1YK7A 2NQDB 4RY2A 2R9NA 1HUCB 5FPWA 2DCAA 5EGWA 4N4ZA 2BDZA 3ZUAA 2H7JA 5EF4A 3LFYA 1U9XA 1BQIA 4BGFA 1ZCMA 7PCKA 2DZZA 3BPFA 1U9WA 3MTNA 2DCBA 1EWOA 1VSNA 3H6SA 4DMXA 3OVZA 3KX1A 1F2AA 2FRQA 4FJCA 3K8UA 3I06A 3KWBX 1YT7A 4NV7A 1CTEA 2CIOA 1CJLA 4C5PA 1F29A 2DCCA 2FQ9A 1EWLA 2DC7A 4QRVA 1Y4HA 4K7CA 2F1GA 2E02A 1NB5A 3IHPA 2YJ2A 1PE6A 2Y6EA 2FTDA 1O0EA 2HXZA 1ITOA 4BPVA 5CVMA 4NV8A 2R9CA 3IUTA 4PADA 5CHVA 4PI3A 3O1GA 4CDEB 1W6FA 4KLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I05 A;  2ACT A;  1AU0 A;  3RVW A;  4I07 A;  2AU1 A;  2YJ9 A;  1QDQ A;  2B1N A;  1ICF A;  1AU2 A;  4QBB A;  3MHS A;  3K9M A;  1M6D A;  9PAP A;  3E1Z B;  1DEU A;  2XU1 A;  3LXS A;  1CB5 A;  1QXP A;  3IEJ A;  4P6E A;  1EWP A;  1CV8 A;  8PCH A;  3CH2 X;  3KSE A;  2ATO A;  4YYU A;  1PIP A;  2NQG A;  2YJB A;  4WA6 A;  3IMA A;  3PNR A;  4CDF B;  2C0Y A;  5F02 A;  3H7D A;  2AUZ A;  3OVX A;  1VJV A;  4BS6 A;  1CQD A;  1TL9 A;  1CSB B;  3ERV A;  3MOR A;  1SP4 B;  3NHE A;  3WXG A;  3D6S A;  2PAD A;  4W5C A;  2XU5 A;  1K3B B;  4YYW A;  3AI8 A;  3P5X A;  4Q8G A;  1BGO A;  2P86 A;  1Y08 A;  3CH3 X;  4X6I A;  1NB3 A;  3BWK A;  2FYE A;  1MEG A;  2R9O A;  2R9F A;  3WXE A;  3N4C A;  1KXR A;  2P0R A;  3HD3 A;  4W4U A;  2DC6 A;  2F7D A;  2BDL A;  4X6H A;  3U8E A;  3H8B A;  1SNK A;  6PAD A;  4XUI A;  3RVX A;  3M99 A;  2WBF X;  5J94 A;  3OIS A;  1A6R A;  3KKU A;  2OUL A;  4PP2 E;  4FK5 A;  1AYW A;  1PPN A;  3H89 A;  2G8E A;  1TU6 A;  2OZ2 A;  3P5U A;  4YVA A;  1GCB A;  5CVO B;  1NL6 A;  3KWZ A;  1YAL A;  3C9E A;  3IV2 A;  1YVB A;  3P5V A;  2P7U A;  1AYV A;  4MZO A;  1KHQ A;  3IOQ A;  3BC3 A;  1QOL A;  4HWY A;  3S3Q A;  3V6C A;  1F2C A;  2PRE A;  4W5B A;  4N79 A;  4QRG A;  3TNX A;  5JA7 A;  1ME3 A;  1NLJ A;  3WXF A;  4CDC B;  2O6X A;  2YJ8 A;  2CB5 A;  3OF8 A;  3V6E A;  1EF7 A;  4DMY A;  5CHT A;  2VHF A;  3B79 A;  1AYU A;  2Y5B A;  3H8C A;  3N3G A;  1BY8 A;  4I04 A;  4QRX A;  3BPM A;  1QMY A;  1MHW A;  4BQV A;  3PW3 A;  1JQP A;  3CBJ A;  1POP A;  2DZY A;  1GMY A;  3N3K A;  1U5I A;  2E01 A;  1GEC E;  2GFO A;  4CZW A;  2AYO A;  3O0U A;  4MSX A;  2B1M A;  2JQF R;  2R9M A;  1PBH A;  3QJ3 A;  1CPJ A;  1KHP A;  1X9Y A;  1NPZ A;  2XU4 A;  4YYV A;  2E03 A;  2YJC A;  4YYR A;  1MIR A;  5K16 A;  1MS6 A;  1KFU L;  3HHI A;  5A24 A;  3PBH A;  3KFQ A;  1CVZ A;  3QT4 A;  5JH3 A;  1PAD A;  1ME4 A;  2AYN A;  2R6N A;  3BOW A;  2DC9 A;  1AU4 A;  2DC8 A;  1PPP A;  1EWM A;  1KFX L;  4OEL A;  3I3T A;  4YYS A;  1XKG A;  1Q6K A;  1PCI A;  2FO5 A;  1ATK A;  4P6G A;  4BS5 A;  2G7Y A;  1AEC A;  2PBH A;  3F5V A;  4QH6 A;  1U9V A;  4X6J A;  3USV A;  1DF0 A;  3HWN A;  4MZS A;  3OF9 A;  3DF0 A;  3KW9 A;  2AVW A;  3S3R A;  2G8J A;  1GLO A;  1MEM A;  1S4V A;  4N8W A;  2FUD A;  2GHU A;  4AXM A;  1NQC A;  3HHA A;  1FH0 A;  2ARY A;  5CVN B;  2NQI A;  2HH5 A;  2DCD A;  4XR7 A;  2AIM A;  2PNS A;  3MHH A;  3QSD A;  1AIM A;  2HD5 A;  2DJF B;  2VHS A;  4CDD B;  2FRA A;  2AS8 A;  4YV8 A;  2OP3 A;  2XU3 A;  3RVV A;  4PP1 A;  4FIP A;  2NQA A;  1THE A;  4AXL A;  4G54 A;  1YK8 A;  3BCN A;  1AU3 A;  2AUX A;  1PXV A;  3GCB A;  1BP4 A;  1F2B A;  3PDF A;  1STF E;  1TLO A;  1CS8 A;  2HHN A;  2IBI A;  2FT2 A;  2IPP B;  2E00 A;  3P5W A;  3CBK A;  5PAD A;  4BSQ A;  4ZUX U;  1PPO A;  2JQG R;  4YYQ A;  4OEM A;  1MDW A;  3K24 A;  4Q8H A;  2DJG B;  2G6D A;  3F75 A;  1PPD A;  1IWD A;  1U9Q X;  1ZIV A;  1YK7 A;  2NQD B;  4RY2 A;  2R9N A;  1HUC B;  5FPW A;  2DCA A;  5EGW A;  4N4Z A;  2BDZ A;  3ZUA A;  2H7J A;  5EF4 A;  3LFY A;  1U9X A;  1BQI A;  1ZCM A;  7PCK A;  2DZZ A;  3BPF A;  1U9W A;  3MTN A;  2DCB A;  1EWO A;  1VSN A;  3H6S A;  4DMX A;  3OVZ A;  3KX1 A;  1F2A A;  2FRQ A;  4FJC A;  3K8U A;  3I06 A;  3KWB X;  1YT7 A;  1CTE A;  2CIO A;  1CJL A;  1F29 A;  2DCC A;  2FQ9 A;  1EWL A;  2DC7 A;  4QRV A;  1Y4H A;  4K7C A;  2F1G A;  2E02 A;  1NB5 A;  3IHP A;  2YJ2 A;  1PE6 A;  2Y6E A;  2FTD A;  1O0E A;  2HXZ A;  1ITO A;  4BPV A;  5CVM A;  2R9C A;  3IUT A;  4PAD A;  5CHV A;  4PI3 A;  3O1G A;  4CDE B;  4KLB A; 
#chains in the Genus database with same CATH topology
 4I05 A;  2ACT A;  3B21 A;  1AU0 A;  4HXD B;  3RVW A;  4I07 A;  2AU1 A;  2UZJ A;  2YJ9 A;  1QDQ A;  2B1N A;  2BU3 A;  1ICF A;  1AU2 A;  4QBB A;  3MHS A;  4D8B A;  3K9M A;  1M6D A;  9PAP A;  3E1Z B;  1DEU A;  2JTC A;  2XU1 A;  3LXS A;  1CB5 A;  2FE8 A;  1QXP A;  3IEJ A;  4P6E A;  1EWP A;  1CV8 A;  4GUA A;  4PT5 A;  3CH2 X;  3KSE A;  8PCH A;  3E9S A;  2ATO A;  4YYU A;  1PIP A;  2NQG A;  2YJB A;  4WA6 A;  3IMA A;  3PNR A;  4CDF B;  3RNV A;  2C0Y A;  5F02 A;  3MP2 A;  3H7D A;  2AUZ A;  3PT2 A;  3OVX A;  1VJV A;  4BS6 A;  1CQD A;  1TL9 A;  1CSB B;  3ERV A;  3MOR A;  1SP4 B;  3NHE A;  4A5U A;  3WXG A;  3D6S A;  2PAD A;  4W5C A;  2XU5 A;  1K3B B;  1UKF A;  4YYW A;  3AI8 A;  3P5X A;  4Q8G A;  1BGO A;  2P86 A;  1Y08 A;  3CH3 X;  4X6I A;  1NB3 A;  3BWK A;  2FYE A;  3OQC A;  1MEG A;  2R9O A;  2R9F A;  3WXE A;  3W30 A;  3N4C A;  1KXR A;  2P0R A;  3HD3 A;  4W4U A;  2DC6 A;  3MJ5 A;  2F7D A;  2BDL A;  5EZQ A;  4X6H A;  3U8E A;  3H8B A;  1SNK A;  6PAD A;  4XUI A;  1PVJ A;  3RVX A;  3M99 A;  2WBF X;  5J94 A;  3OIS A;  1A6R A;  3KKU A;  2OUL A;  4PP2 E;  4FK5 A;  1AYW A;  3PHU A;  1PPN A;  3H89 A;  2G8E A;  4OW0 A;  1TU6 A;  2OZ2 A;  3P5U A;  4IP3 A;  4YVA A;  1GCB A;  5E6J A;  5CVO B;  1NL6 A;  3KWZ A;  1YAL A;  3C9E A;  3IV2 A;  4RKX A;  1YVB A;  3P5V A;  4WUR A;  2P7U A;  1AYV A;  4MZO A;  1KHQ A;  3IOQ A;  3BC3 A;  3PRM A;  1QOL A;  4HWY A;  3S3Q A;  3V6C A;  1F2C A;  3ZNH A;  4MM3 B;  2PRE A;  4W5B A;  4N79 A;  4QRG A;  4RF0 A;  3TNX A;  5JA7 A;  1ME3 A;  1NLJ A;  3WXF A;  4CDC B;  2O6X A;  2YJ8 A;  3MTV A;  2CB5 A;  3OF8 A;  3BY4 A;  3V6E A;  3PRP A;  1EF7 A;  4DMY A;  5CHT A;  2VHF A;  3B79 A;  1AYU A;  4M0W A;  2Y5B A;  4D8I A;  3H8C A;  3N3G A;  1BY8 A;  4I04 A;  4QRX A;  3BPM A;  1QMY A;  4P16 A;  1MHW A;  4BQV A;  3IFU A;  3O65 A;  3PW3 A;  1JQP A;  3CBJ A;  1POP A;  2DZY A;  1GMY A;  3N3K A;  1U5I A;  2E01 A;  4MI7 A;  1GEC E;  2HWK A;  2GFO A;  2JRI A;  2AYO A;  4CZW A;  3O0U A;  4MSX A;  2B1M A;  2JQF R;  2R9M A;  2Z84 A;  1PBH A;  3QJ3 A;  1CPJ A;  1KHP A;  1X9Y A;  1NPZ A;  2XU4 A;  4YYV A;  2E03 A;  2YJC A;  4YYR A;  1MIR A;  4BOU A;  5K16 A;  1MS6 A;  1KFU L;  3HHI A;  4OVZ B;  4RNA A;  3C0R A;  5A24 A;  3PBH A;  3KFQ A;  1CVZ A;  1DKI A;  3QT4 A;  5JH3 A;  1PAD A;  1ME4 A;  2AYN A;  2J7Q A;  2R6N A;  3BOW A;  2DC9 A;  1AU4 A;  2DC8 A;  3BBA A;  1PPP A;  1EWM A;  1KFX L;  4OEL A;  3I3T A;  4YYS A;  1XKG A;  1Q6K A;  1PCI A;  2FO5 A;  1ATK A;  4BOS A;  4P6G A;  4BS5 A;  2G7Y A;  1AEC A;  2PBH A;  3F5V A;  4QH6 A;  2J7Q C;  1U9V A;  4X6J A;  3USV A;  1DF0 A;  3HWN A;  4MZS A;  3OF9 A;  3DF0 A;  3KW9 A;  2AVW A;  3S3R A;  2G8J A;  1GLO A;  1MEM A;  1S4V A;  4N8W A;  2FUD A;  2GHU A;  4AXM A;  1NQC A;  3HHA A;  2DOS A;  1FH0 A;  2ARY A;  5CVN B;  2NQI A;  2BTW B;  2HH5 A;  2DCD A;  4XR7 A;  2AIM A;  2PNS A;  3MHH A;  5KO3 A;  4BOZ A;  3PSE A;  3QSD A;  5JZE A;  2AGA A;  4BOP A;  1AIM A;  2HD5 A;  2DJF B;  2VHS A;  4CDD B;  2FRA A;  2AS8 A;  4R3D A;  4YV8 A;  2OP3 A;  2XU3 A;  4BOQ A;  3RVV A;  4PP1 A;  4RF1 A;  4FIP A;  2NQA A;  1THE A;  4AXL A;  4G54 A;  1YK8 A;  3BCN A;  1AU3 A;  2AUX A;  1PXV A;  3GCB A;  1BP4 A;  1F2B A;  3PDF A;  1STF E;  1TLO A;  4OVZ A;  1CS8 A;  2HHN A;  2IBI A;  4REZ A;  3PHW A;  2FT2 A;  2IPP B;  2E00 A;  3P5W A;  4ZTB A;  3CBK A;  5PAD A;  4BSQ A;  4ZUX U;  1PPO A;  2JQG R;  4YYQ A;  4OEM A;  1MDW A;  3K24 A;  4Q8H A;  2DJG B;  2G6D A;  3F75 A;  1PPD A;  1IWD A;  1U9Q X;  1ZIV A;  3TRK A;  1YK7 A;  2NQD B;  4RY2 A;  4XZX A;  2R9N A;  1HUC B;  5FPW A;  2DCA A;  5EGW A;  4N4Z A;  2BDZ A;  3ZUA A;  2H7J A;  5EF4 A;  2BTW A;  4IUM A;  3LFY A;  1U9X A;  1BQI A;  1ZCM A;  7PCK A;  2DZZ A;  3BPF A;  1U9W A;  3MTN A;  2DCB A;  1EWO A;  1VSN A;  5EZS A;  3H6S A;  4DMX A;  3OVZ A;  3KX1 A;  1F2A A;  2FRQ A;  4FJC A;  3K8U A;  3I06 A;  3KWB X;  1YT7 A;  1CTE A;  3TMP A;  2CIO A;  1CJL A;  1F29 A;  3PHX A;  2DCC A;  2FQ9 A;  1EWL A;  2DC7 A;  4QRV A;  1Y4H A;  4K7C A;  4D8E A;  2F1G A;  2E02 A;  1NB5 A;  3IHP A;  2YJ2 A;  1PE6 A;  3BB7 A;  2Y6E A;  2FTD A;  1O0E A;  2HXZ A;  1ITO A;  4BPV A;  5CVM A;  2R9C A;  3IUT A;  1YZB A;  4PAD A;  3W31 A;  5CHV A;  4PI3 A;  3O1G A;  4CDE B;  4KLB A; 
#chains in the Genus database with same CATH homology
 4I05 A;  2ACT A;  1GX3 A;  3D9W A;  1AU0 A;  3RVW A;  4I07 A;  2AU1 A;  2YJ9 A;  1QDQ A;  2B1N A;  1ICF A;  1AU2 A;  4QBB A;  3MHS A;  3K9M A;  1M6D A;  9PAP A;  3E1Z B;  1DEU A;  2XU1 A;  3LXS A;  1CB5 A;  1QXP A;  3IEJ A;  4P6E A;  1EWP A;  1CV8 A;  8PCH A;  3CH2 X;  3KSE A;  2ATO A;  4YYU A;  1PIP A;  2NQG A;  2YJB A;  4WA6 A;  3IMA A;  3PNR A;  4CDF B;  2C0Y A;  5F02 A;  3H7D A;  2AUZ A;  3OVX A;  1VJV A;  4BS6 A;  1CQD A;  1TL9 A;  1CSB B;  3ERV A;  3MOR A;  1SP4 B;  3NHE A;  3WXG A;  3D6S A;  2PAD A;  4W5C A;  2XU5 A;  1K3B B;  4YYW A;  3AI8 A;  3P5X A;  4Q8G A;  1BGO A;  2P86 A;  1Y08 A;  3CH3 X;  4X6I A;  1NB3 A;  3BWK A;  2FYE A;  1MEG A;  2R9O A;  2R9F A;  3WXE A;  3N4C A;  1KXR A;  2P0R A;  3HD3 A;  4W4U A;  2DC6 A;  2F7D A;  2BDL A;  4X6H A;  3U8E A;  3H8B A;  1SNK A;  6PAD A;  4XUI A;  3RVX A;  3M99 A;  2WBF X;  5J94 A;  3OIS A;  1A6R A;  3KKU A;  2OUL A;  4PP2 E;  4FK5 A;  1AYW A;  1PPN A;  3H89 A;  2G8E A;  1TU6 A;  2OZ2 A;  3P5U A;  4YVA A;  1GCB A;  5CVO B;  1NL6 A;  3KWZ A;  1YAL A;  3C9E A;  3IV2 A;  1YVB A;  3P5V A;  2P7U A;  1AYV A;  4MZO A;  1W5R A;  1KHQ A;  3IOQ A;  3BC3 A;  1QOL A;  4HWY A;  3S3Q A;  3V6C A;  1F2C A;  2PRE A;  4W5B A;  4N79 A;  4QRG A;  3TNX A;  5JA7 A;  1ME3 A;  1NLJ A;  3WXF A;  4CDC B;  2O6X A;  2YJ8 A;  2CB5 A;  3OF8 A;  3V6E A;  1EF7 A;  4DMY A;  5CHT A;  2VHF A;  3B79 A;  1AYU A;  2Y5B A;  3H8C A;  3N3G A;  1BY8 A;  4I04 A;  4QRX A;  3BPM A;  1QMY A;  1MHW A;  4BQV A;  3PW3 A;  1JQP A;  3CBJ A;  1POP A;  2DZY A;  1GMY A;  3N3K A;  1U5I A;  2E01 A;  1GEC E;  2GFO A;  4CZW A;  2AYO A;  3O0U A;  4MSX A;  2B1M A;  2JQF R;  2R9M A;  1PBH A;  3QJ3 A;  1CPJ A;  1KHP A;  1X9Y A;  1NPZ A;  2XU4 A;  4YYV A;  2E03 A;  2YJC A;  4YYR A;  1MIR A;  5K16 A;  1MS6 A;  1KFU L;  3HHI A;  5A24 A;  1E2T A;  3KFQ A;  3PBH A;  1CVZ A;  4GUZ A;  3QT4 A;  5JH3 A;  1PAD A;  1ME4 A;  2AYN A;  2R6N A;  3BOW A;  2DC9 A;  1AU4 A;  2DC8 A;  1PPP A;  1EWM A;  1KFX L;  4OEL A;  3I3T A;  4YYS A;  2BSZ A;  1XKG A;  1Q6K A;  1PCI A;  2FO5 A;  1ATK A;  4P6G A;  4BS5 A;  2G7Y A;  1AEC A;  2PBH A;  3F5V A;  4QH6 A;  1U9V A;  4X6J A;  3USV A;  1DF0 A;  3HWN A;  4MZS A;  3OF9 A;  3DF0 A;  3KW9 A;  2AVW A;  3LTW A;  3S3R A;  2G8J A;  1GLO A;  1MEM A;  1S4V A;  4N8W A;  2FUD A;  2GHU A;  4AXM A;  1NQC A;  3HHA A;  1FH0 A;  2ARY A;  5CVN B;  2NQI A;  2HH5 A;  2DCD A;  4XR7 A;  2AIM A;  2PNS A;  3MHH A;  3QSD A;  1AIM A;  2HD5 A;  2DJF B;  2VHS A;  4CDD B;  2FRA A;  2AS8 A;  4YV8 A;  2OP3 A;  2XU3 A;  3RVV A;  4B55 A;  2VFC A;  4PP1 A;  4FIP A;  2NQA A;  1THE A;  4AXL A;  4G54 A;  1YK8 A;  3BCN A;  1AU3 A;  2AUX A;  1PXV A;  3GCB A;  1BP4 A;  1F2B A;  3PDF A;  1STF E;  1TLO A;  1CS8 A;  2HHN A;  2IBI A;  2FT2 A;  2IPP B;  2E00 A;  3P5W A;  3CBK A;  5PAD A;  4BSQ A;  4ZUX U;  1PPO A;  2JQG R;  4YYQ A;  4OEM A;  1MDW A;  3K24 A;  4Q8H A;  2DJG B;  2G6D A;  3F75 A;  1PPD A;  1IWD A;  1W4T A;  1U9Q X;  2VFB A;  1ZIV A;  1YK7 A;  2NQD B;  4RY2 A;  2R9N A;  1HUC B;  5FPW A;  2DCA A;  5EGW A;  4N4Z A;  2BDZ A;  3ZUA A;  2H7J A;  5EF4 A;  3LFY A;  1U9X A;  1BQI A;  4BGF A;  1ZCM A;  7PCK A;  2DZZ A;  3BPF A;  1U9W A;  3MTN A;  2DCB A;  1EWO A;  1VSN A;  3H6S A;  4DMX A;  3OVZ A;  3KX1 A;  1F2A A;  2FRQ A;  4FJC A;  3K8U A;  3I06 A;  3KWB X;  1YT7 A;  4NV7 A;  1CTE A;  2CIO A;  1CJL A;  4C5P A;  1F29 A;  2DCC A;  2FQ9 A;  1EWL A;  2DC7 A;  4QRV A;  1Y4H A;  4K7C A;  2F1G A;  2E02 A;  1NB5 A;  3IHP A;  2YJ2 A;  1PE6 A;  2Y6E A;  2FTD A;  1O0E A;  2HXZ A;  1ITO A;  4BPV A;  5CVM A;  4NV8 A;  2R9C A;  3IUT A;  4PAD A;  5CHV A;  4PI3 A;  3O1G A;  4CDE B;  1W6F A;  4KLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...