1ITOA

Crystal structure analysis of bovine spleen cathepsin b-e64c complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin B
publication title Structural basis for development of cathepsin B-specific noncovalent-type inhibitor: crystal structure of cathepsin B-E64c complex
pubmed doi rcsb
total genus 76
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2002-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1itoA00
2BDLA 3QT4A 2YJCA 1PIPA 1VJVA 1PPPA 4CDFB 3M99A 1KHQA 4N4ZA 4BS6A 2AYNA 1NPZA 1PADA 3BPFA 2CIOA 4CDCB 3MTNA 1U9XA 3O1GA 5A24A 1VSNA 5CHTA 1F2CA 2DCDA 1KFXL 1PPNA 1AIMA 1DF0A 1U5IA 6PADA 2R9CA 1MDWA 5JH3A 1KHPA 1AYWA 1ZCMA 2DCCA 3P5WA 2FT2A 1ITOA 1Q6KA 1GLOA 3CH3X 1XKGA 2FTDA 2GFOA 2XU1A 4K7CA 3KFQA 2WBFX 4W4UA 3MHHA 3C9EA 1AU0A 2F7DA 4W5CA 3CBKA 2DCBA 2G7YA 1YK8A 2OULA 2VHFA 2R6NA 1MEMA 3H89A 1DEUA 3QSDA 4KLBA 1CVZA 2DC7A 1U9WA 1IWDA 2NQDB 2AS8A 1YT7A 2Y5BA 3AI8A 4YYUA 1EWOA 3P5UA 3HHIA 4PP2E 1U9QX 1ICFA 1ME3A 3D6SA 1QOLA 3CH2X 3LXSA 1S4VA 5JA7A 4G54A 2IPPB 1PCIA 4YVAA 2DC8A 4YV8A 3IEJA 4AXLA 1Y08A 1AYVA 2FRAA 3MHSA 2P0RA 1FH0A 4X6IA 2BDZA 4I04A 3KWZA 2GHUA 1TL9A 1PPOA 2FYEA 2P86A 2C0YA 3KX1A 1EF7A 1YK7A 3I06A 3KKUA 1QXPA 2O6XA 5CVOB 4I05A 5CHVA 1CS8A 3K9MA 1NL6A 2R9OA 2PBHA 1NB3A 1YALA 3LFYA 3HHAA 2E00A 2XU5A 3IV2A 3N3GA 5CVMA 2E02A 2G8EA 2DJFB 4OELA 2E01A 3IHPA 4BS5A 3IOQA 1CPJA 1TU6A 1U9VA 1CJLA 3WXFA 3I3TA 5EGWA 5J94A 2P7UA 1STFE 3O0UA 2NQAA 4CZWA 4YYQA 2XU3A 4PP1A 1BGOA 3V6EA 3IMAA 4QH6A 4P6EA 3QJ3A 1ZIVA 2F1GA 4HWYA 1AU2A 3HWNA 5K16A 4YYWA 3N3KA 3F5VA 5CVNB 4YYSA 4QRVA 2PNSA 3N4CA 1O0EA 3WXEA 1EWMA 4QBBA 3K24A 3F75A 2G6DA 2H7JA 2VHSA 4BSQA 3KW9A 4DMYA 2ACTA 1AYUA 1ATKA 2FQ9A 2DCAA 2AUZA 4P6GA 1BY8A 1MEGA 3CBJA 3OVZA 4CDDB 1K3BB 2CB5A 2B1MA 1CQDA 2NQGA 2YJBA 1MHWA 3BCNA 1F2BA 1ME4A 1CV8A 2AIMA 8PCHA 3IUTA 4QRGA 3RVXA 1SNKA 3BOWA 1Y4HA 1PPDA 3RVWA 5FPWA 5PADA 4XR7A 2DJGB 4PI3A 3TNXA 2DZYA 4MZOA 3V6CA 2B1NA 1JQPA 1AECA 1BP4A 4BQVA 1KFUL 1A6RA 1YVBA 3H6SA 4MZSA 2HXZA 3BC3A 4DMXA 2YJ2A 3H8BA 3OF8A 2ARYA 2PADA 1CB5A 3S3QA 1GCBA 3H7DA 4X6JA 4MSXA 2DC6A 3HD3A 4ZUXU 2HHNA 4WA6A 1NQCA 2Y6EA 4AXMA 2JQFR 2HD5A 2R9NA 2HH5A 3KSEA 4YYRA 1CSBB 2FO5A 3OF9A 1NLJA 2DC9A 2R9FA 1MIRA 4I07A 3BPMA 2AYOA 2IBIA 2NQIA 3H8CA 3OVXA 3OISA 2PREA 2YJ8A 1POPA 3NHEA 4PADA 4RY2A 4X6HA 2AU1A 4FIPA 1HUCB 1PBHA 3E1ZB 3PBHA 1QMYA 1QDQA 3B79A 3BWKA 9PAPA 3ZUAA 4N8WA 3GCBA 1BQIA 1THEA 3ERVA 4QRXA 1GECE 5F02A 4CDEB 1KXRA 1GMYA 2FRQA 2XU4A 1F29A 4Q8GA 4XUIA 1AU4A 1EWPA 3WXGA 4Q8HA 2DZZA 4FK5A 2FUDA 3RVVA 2YJ9A 1NB5A 1PXVA 3P5VA 1EWLA 3P5XA 4FJCA 2OP3A 3S3RA 3PNRA 3PW3A 4BPVA 1AU3A 3PDFA 1CTEA 2JQGR 2AUXA 3U8EA 3K8UA 2G8JA 3MORA 1PE6A 3KWBX 1MS6A 4W5BA 7PCKA 4YYVA 1SP4B 1TLOA 1X9YA 1F2AA 2R9MA 4N79A 1M6DA 5EF4A 3DF0A 2E03A 3USVA 2AVWA 2ATOA 2OZ2A 4OEMA
chains in the Genus database with same CATH superfamily
2BDLA 3QT4A 2YJCA 1PIPA 1VJVA 1PPPA 4CDFB 2J7QC 4D8IA 3M99A 1KHQA 2BTWA 4N4ZA 4BS6A 2AYNA 1NPZA 1PADA 3BPFA 2CIOA 4CDCB 3MTNA 1U9XA 3O1GA 5A24A 1VSNA 2JRIA 5CHTA 1F2CA 2DCDA 1KFXL 4ZTBA 1PPNA 4P16A 1AIMA 1DF0A 1U5IA 4BOPA 6PADA 3BBAA 2R9CA 1MDWA 5JH3A 1KHPA 1AYWA 1ZCMA 2DCCA 3P5WA 2FT2A 1ITOA 1Q6KA 1GLOA 3CH3X 1XKGA 2FTDA 2GFOA 2XU1A 3RNVA 3BY4A 4K7CA 1DKIA 3KFQA 2WBFX 4RF1A 3MTVA 4REZA 4W4UA 5EZSA 3MHHA 3C9EA 2Z84A 1AU0A 2F7DA 4W5CA 3CBKA 2DCBA 2G7YA 1YK8A 3W30A 2OULA 2VHFA 2R6NA 1MEMA 3H89A 1DEUA 3QSDA 4KLBA 4R3DA 1CVZA 2DC7A 1U9WA 1IWDA 2AGAA 2NQDB 4XZXA 2AS8A 1YT7A 2Y5BA 3AI8A 4YYUA 1EWOA 3P5UA 3HHIA 4PP2E 1U9QX 1ICFA 1ME3A 2UZJA 2DOSA 3D6SA 3B21A 1QOLA 3CH2X 3LXSA 1S4VA 5JA7A 4G54A 2IPPB 1PCIA 4YVAA 2DC8A 4GUAA 4YV8A 3IEJA 4AXLA 1Y08A 3OQCA 1AYVA 2FRAA 3MHSA 2P0RA 1FH0A 4HXDB 4X6IA 2BDZA 4I04A 3KWZA 2JTCA 2GHUA 2FE8A 4RKXA 1TL9A 1PPOA 2FYEA 2P86A 2C0YA 3KX1A 1EF7A 1YK7A 3I06A 3PHXA 3KKUA 1QXPA 2O6XA 4PT5A 5CVOB 4I05A 1UKFA 5CHVA 3PT2A 1CS8A 3K9MA 1NL6A 2R9OA 2PBHA 1NB3A 1YALA 3LFYA 3HHAA 2E00A 2XU5A 3IV2A 3N3GA 5CVMA 2E02A 2G8EA 2DJFB 4OELA 2E01A 3IHPA 4BS5A 3PRPA 3IOQA 1CPJA 1TU6A 1PVJA 1U9VA 1CJLA 3WXFA 3I3TA 5EGWA 5J94A 2P7UA 1STFE 3O0UA 5EZQA 2NQAA 4CZWA 4YYQA 2XU3A 4PP1A 1BGOA 2J7QA 5JZEA 3V6EA 3IMAA 4QH6A 4P6EA 3QJ3A 1ZIVA 2F1GA 4HWYA 1AU2A 3HWNA 5K16A 4YYWA 3N3KA 3F5VA 2BTWB 4RF0A 5CVNB 4YYSA 4QRVA 2PNSA 3N4CA 1O0EA 3WXEA 1EWMA 4QBBA 3K24A 3F75A 2G6DA 2H7JA 2VHSA 4BSQA 3KW9A 4DMYA 2ACTA 5KO3A 1AYUA 1ATKA 2FQ9A 2DCAA 5E6JA 2AUZA 4P6GA 4D8EA 4D8BA 1BY8A 1MEGA 3CBJA 3OVZA 4CDDB 4RNAA 3MJ5A 1YZBA 1K3BB 2CB5A 4OW0A 2B1MA 1CQDA 2NQGA 2YJBA 3MP2A 1MHWA 4OVZA 3BCNA 3PRMA 4WURA 1F2BA 1ME4A 1CV8A 2AIMA 8PCHA 3IUTA 4QRGA 3RVXA 1SNKA 3BOWA 3W31A 1Y4HA 1PPDA 3RVWA 5FPWA 5PADA 4XR7A 2DJGB 4PI3A 4BOQA 3TNXA 2DZYA 4MZOA 3V6CA 2B1NA 1JQPA 3BB7A 1AECA 1BP4A 4BQVA 1KFUL 1A6RA 1YVBA 3H6SA 4MZSA 2HXZA 3BC3A 4DMXA 2YJ2A 3H8BA 3OF8A 2ARYA 2PADA 1CB5A 3S3QA 1GCBA 3H7DA 4X6JA 4MSXA 2DC6A 3HD3A 4ZUXU 2HHNA 4WA6A 1NQCA 2Y6EA 4AXMA 2JQFR 2HD5A 2R9NA 2HH5A 3KSEA 4YYRA 1CSBB 2FO5A 3OF9A 1NLJA 2DC9A 2BU3A 2R9FA 1MIRA 4I07A 3BPMA 2AYOA 2IBIA 2NQIA 3H8CA 3OVXA 3OISA 2PREA 2YJ8A 1POPA 3IFUA 3NHEA 4IP3A 4BOZA 4PADA 4RY2A 4X6HA 4A5UA 2AU1A 4FIPA 1HUCB 1PBHA 3E1ZB 4OVZB 3PBHA 4MI7A 1QMYA 1QDQA 3B79A 3BWKA 9PAPA 4IUMA 3ZUAA 4N8WA 4BOUA 3PHUA 3GCBA 1BQIA 1THEA 3ERVA 4QRXA 1GECE 3PHWA 5F02A 4CDEB 1KXRA 1GMYA 2FRQA 3E9SA 2XU4A 3TMPA 1F29A 4Q8GA 4XUIA 1AU4A 1EWPA 3WXGA 4Q8HA 2DZZA 4FK5A 2FUDA 3RVVA 2YJ9A 1NB5A 1PXVA 3P5VA 2HWKA 1EWLA 3P5XA 4FJCA 2OP3A 3S3RA 3PNRA 3PW3A 4BPVA 1AU3A 3PDFA 3O65A 1CTEA 2JQGR 2AUXA 3U8EA 3K8UA 3PSEA 4M0WA 2G8JA 3MORA 1PE6A 3KWBX 1MS6A 4W5BA 7PCKA 4YYVA 1SP4B 1TLOA 3C0RA 1X9YA 3ZNHA 1F2AA 2R9MA 4MM3B 4N79A 1M6DA 5EF4A 3TRKA 4BOSA 3DF0A 2E03A 3USVA 2AVWA 2ATOA 2OZ2A 4OEMA
chains in the Genus database with same CATH topology
2BDLA 3QT4A 2YJCA 1PIPA 1VJVA 1PPPA 4CDFB 3M99A 1KHQA 4N4ZA 4BS6A 2AYNA 1NPZA 1PADA 3BPFA 2CIOA 4CDCB 3MTNA 1U9XA 3O1GA 5A24A 1VSNA 5CHTA 1F2CA 2VFBA 2DCDA 1KFXL 1PPNA 1AIMA 3LTWA 1DF0A 1U5IA 2VFCA 6PADA 2R9CA 1MDWA 5JH3A 1KHPA 1AYWA 1ZCMA 2DCCA 3P5WA 2FT2A 1ITOA 1Q6KA 1GLOA 3CH3X 4C5PA 1XKGA 2FTDA 2GFOA 2XU1A 4K7CA 3KFQA 2WBFX 4W4UA 3MHHA 3C9EA 1AU0A 2F7DA 4W5CA 3CBKA 2DCBA 2G7YA 1YK8A 2OULA 2VHFA 2R6NA 3H89A 1MEMA 1DEUA 3QSDA 4KLBA 1CVZA 2DC7A 1U9WA 1IWDA 2NQDB 3D9WA 2AS8A 1YT7A 2Y5BA 3AI8A 4YYUA 1EWOA 3P5UA 3HHIA 4PP2E 1U9QX 1ICFA 1ME3A 3D6SA 1QOLA 3CH2X 3LXSA 1S4VA 5JA7A 4G54A 2IPPB 1PCIA 4YVAA 2DC8A 4YV8A 3IEJA 4AXLA 1Y08A 1AYVA 2FRAA 3MHSA 2P0RA 1FH0A 4X6IA 2BDZA 4I04A 3KWZA 2GHUA 1TL9A 1PPOA 2FYEA 2P86A 2C0YA 3KX1A 1EF7A 1YK7A 2BSZA 3I06A 3KKUA 1QXPA 2O6XA 5CVOB 4I05A 5CHVA 1CS8A 3K9MA 1NL6A 2R9OA 2PBHA 1NB3A 1YALA 3LFYA 3HHAA 2E00A 2XU5A 4B55A 3IV2A 3N3GA 5CVMA 2E02A 2G8EA 2DJFB 4OELA 2E01A 3IHPA 4BS5A 3IOQA 1CPJA 1TU6A 1U9VA 1W6FA 1CJLA 3WXFA 3I3TA 5EGWA 5J94A 2P7UA 1STFE 3O0UA 2NQAA 4CZWA 4YYQA 2XU3A 4PP1A 1BGOA 3V6EA 3IMAA 4QH6A 4NV7A 4P6EA 3QJ3A 1ZIVA 2F1GA 4HWYA 1AU2A 3HWNA 5K16A 4YYWA 3N3KA 3F5VA 5CVNB 4YYSA 4QRVA 2PNSA 3N4CA 1O0EA 3WXEA 1EWMA 4QBBA 3K24A 3F75A 2G6DA 2H7JA 2VHSA 4BSQA 3KW9A 4DMYA 2ACTA 1AYUA 1ATKA 1E2TA 4NV8A 2FQ9A 2DCAA 2AUZA 4P6GA 1BY8A 1MEGA 3CBJA 3OVZA 4CDDB 1K3BB 2CB5A 2B1MA 1CQDA 2NQGA 2YJBA 1MHWA 3BCNA 1F2BA 1ME4A 1CV8A 2AIMA 8PCHA 3IUTA 4QRGA 3RVXA 1SNKA 3BOWA 1Y4HA 1PPDA 3RVWA 5FPWA 5PADA 4XR7A 2DJGB 4PI3A 3TNXA 2DZYA 4MZOA 3V6CA 2B1NA 1JQPA 1AECA 1BP4A 4BQVA 1KFUL 1A6RA 1YVBA 3H6SA 4MZSA 2HXZA 3BC3A 4DMXA 2YJ2A 3H8BA 3OF8A 2ARYA 2PADA 1CB5A 1W5RA 3S3QA 1GCBA 3H7DA 4X6JA 4MSXA 2DC6A 3HD3A 4ZUXU 2HHNA 4WA6A 1NQCA 2Y6EA 4AXMA 2JQFR 2HD5A 2R9NA 2HH5A 3KSEA 4YYRA 1CSBB 2FO5A 3OF9A 1NLJA 2DC9A 2R9FA 1MIRA 4I07A 3BPMA 2AYOA 2IBIA 2NQIA 3H8CA 3OVXA 3OISA 4BGFA 2PREA 2YJ8A 1POPA 3NHEA 4PADA 4RY2A 4X6HA 2AU1A 4FIPA 1HUCB 1PBHA 3E1ZB 3PBHA 1QMYA 1QDQA 3B79A 3BWKA 9PAPA 3ZUAA 4N8WA 3GCBA 1BQIA 1THEA 3ERVA 4QRXA 1GECE 5F02A 4CDEB 1KXRA 1GMYA 2FRQA 2XU4A 1F29A 4Q8GA 4XUIA 1AU4A 1EWPA 3WXGA 4Q8HA 2DZZA 4FK5A 1GX3A 2FUDA 3RVVA 2YJ9A 1NB5A 1PXVA 3P5VA 1EWLA 3P5XA 1W4TA 4FJCA 2OP3A 3S3RA 3PNRA 3PW3A 4BPVA 1AU3A 3PDFA 1CTEA 2JQGR 2AUXA 3U8EA 3K8UA 2G8JA 3MORA 1PE6A 3KWBX 1MS6A 4W5BA 7PCKA 4YYVA 1SP4B 1TLOA 1X9YA 1F2AA 2R9MA 4N79A 1M6DA 5EF4A 3DF0A 2E03A 4GUZA 3USVA 2AVWA 2ATOA 2OZ2A 4OEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDL A;  3QT4 A;  2YJC A;  1PIP A;  1VJV A;  1PPP A;  4CDF B;  3M99 A;  1KHQ A;  4N4Z A;  4BS6 A;  2AYN A;  1NPZ A;  1PAD A;  3BPF A;  2CIO A;  4CDC B;  3MTN A;  1U9X A;  3O1G A;  5A24 A;  1VSN A;  5CHT A;  1F2C A;  2DCD A;  1KFX L;  1PPN A;  1AIM A;  1DF0 A;  1U5I A;  6PAD A;  2R9C A;  1MDW A;  5JH3 A;  1KHP A;  1AYW A;  1ZCM A;  2DCC A;  3P5W A;  2FT2 A;  1ITO A;  1Q6K A;  1GLO A;  3CH3 X;  1XKG A;  2FTD A;  2GFO A;  2XU1 A;  4K7C A;  3KFQ A;  2WBF X;  4W4U A;  3MHH A;  3C9E A;  1AU0 A;  2F7D A;  4W5C A;  3CBK A;  2DCB A;  2G7Y A;  1YK8 A;  2OUL A;  2VHF A;  2R6N A;  1MEM A;  3H89 A;  1DEU A;  3QSD A;  4KLB A;  1CVZ A;  2DC7 A;  1U9W A;  1IWD A;  2NQD B;  2AS8 A;  1YT7 A;  2Y5B A;  3AI8 A;  4YYU A;  1EWO A;  3P5U A;  3HHI A;  4PP2 E;  1U9Q X;  1ICF A;  1ME3 A;  3D6S A;  1QOL A;  3CH2 X;  3LXS A;  1S4V A;  5JA7 A;  4G54 A;  2IPP B;  1PCI A;  4YVA A;  2DC8 A;  4YV8 A;  3IEJ A;  4AXL A;  1Y08 A;  1AYV A;  2FRA A;  3MHS A;  2P0R A;  1FH0 A;  4X6I A;  2BDZ A;  4I04 A;  3KWZ A;  2GHU A;  1TL9 A;  1PPO A;  2FYE A;  2P86 A;  2C0Y A;  3KX1 A;  1EF7 A;  1YK7 A;  3I06 A;  3KKU A;  1QXP A;  2O6X A;  5CVO B;  4I05 A;  5CHV A;  1CS8 A;  3K9M A;  1NL6 A;  2R9O A;  2PBH A;  1NB3 A;  1YAL A;  3LFY A;  3HHA A;  2E00 A;  2XU5 A;  3IV2 A;  3N3G A;  5CVM A;  2E02 A;  2G8E A;  2DJF B;  4OEL A;  2E01 A;  3IHP A;  4BS5 A;  3IOQ A;  1CPJ A;  1TU6 A;  1U9V A;  1CJL A;  3WXF A;  3I3T A;  5EGW A;  5J94 A;  2P7U A;  1STF E;  3O0U A;  2NQA A;  4CZW A;  4YYQ A;  2XU3 A;  4PP1 A;  1BGO A;  3V6E A;  3IMA A;  4QH6 A;  4P6E A;  3QJ3 A;  1ZIV A;  2F1G A;  4HWY A;  1AU2 A;  3HWN A;  5K16 A;  4YYW A;  3N3K A;  3F5V A;  5CVN B;  4YYS A;  4QRV A;  2PNS A;  3N4C A;  1O0E A;  3WXE A;  1EWM A;  4QBB A;  3K24 A;  3F75 A;  2G6D A;  2H7J A;  2VHS A;  4BSQ A;  3KW9 A;  4DMY A;  2ACT A;  1AYU A;  1ATK A;  2FQ9 A;  2DCA A;  2AUZ A;  4P6G A;  1BY8 A;  1MEG A;  3CBJ A;  3OVZ A;  4CDD B;  1K3B B;  2CB5 A;  2B1M A;  1CQD A;  2NQG A;  2YJB A;  1MHW A;  3BCN A;  1F2B A;  1ME4 A;  1CV8 A;  2AIM A;  8PCH A;  3IUT A;  4QRG A;  3RVX A;  1SNK A;  3BOW A;  1Y4H A;  1PPD A;  3RVW A;  5FPW A;  5PAD A;  4XR7 A;  2DJG B;  4PI3 A;  3TNX A;  2DZY A;  4MZO A;  3V6C A;  2B1N A;  1JQP A;  1AEC A;  1BP4 A;  4BQV A;  1KFU L;  1A6R A;  1YVB A;  3H6S A;  4MZS A;  2HXZ A;  3BC3 A;  4DMX A;  2YJ2 A;  3H8B A;  3OF8 A;  2ARY A;  2PAD A;  1CB5 A;  3S3Q A;  1GCB A;  3H7D A;  4X6J A;  4MSX A;  2DC6 A;  3HD3 A;  4ZUX U;  2HHN A;  4WA6 A;  1NQC A;  2Y6E A;  4AXM A;  2JQF R;  2HD5 A;  2R9N A;  2HH5 A;  3KSE A;  4YYR A;  1CSB B;  2FO5 A;  3OF9 A;  1NLJ A;  2DC9 A;  2R9F A;  1MIR A;  4I07 A;  3BPM A;  2AYO A;  2IBI A;  2NQI A;  3H8C A;  3OVX A;  3OIS A;  2PRE A;  2YJ8 A;  1POP A;  3NHE A;  4PAD A;  4RY2 A;  4X6H A;  2AU1 A;  4FIP A;  1HUC B;  1PBH A;  3E1Z B;  3PBH A;  1QMY A;  1QDQ A;  3B79 A;  3BWK A;  9PAP A;  3ZUA A;  4N8W A;  3GCB A;  1BQI A;  1THE A;  3ERV A;  4QRX A;  1GEC E;  5F02 A;  4CDE B;  1KXR A;  1GMY A;  2FRQ A;  2XU4 A;  1F29 A;  4Q8G A;  4XUI A;  1AU4 A;  1EWP A;  3WXG A;  4Q8H A;  2DZZ A;  4FK5 A;  2FUD A;  3RVV A;  2YJ9 A;  1NB5 A;  1PXV A;  3P5V A;  1EWL A;  3P5X A;  4FJC A;  2OP3 A;  3S3R A;  3PNR A;  3PW3 A;  4BPV A;  1AU3 A;  3PDF A;  1CTE A;  2JQG R;  2AUX A;  3U8E A;  3K8U A;  2G8J A;  3MOR A;  1PE6 A;  3KWB X;  1MS6 A;  4W5B A;  7PCK A;  4YYV A;  1SP4 B;  1TLO A;  1X9Y A;  1F2A A;  2R9M A;  4N79 A;  1M6D A;  5EF4 A;  3DF0 A;  2E03 A;  3USV A;  2AVW A;  2ATO A;  2OZ2 A;  4OEM A; 
#chains in the Genus database with same CATH topology
 2BDL A;  3QT4 A;  2YJC A;  1PIP A;  1VJV A;  1PPP A;  4CDF B;  2J7Q C;  4D8I A;  3M99 A;  1KHQ A;  2BTW A;  4N4Z A;  4BS6 A;  2AYN A;  1NPZ A;  1PAD A;  3BPF A;  2CIO A;  4CDC B;  3MTN A;  1U9X A;  3O1G A;  5A24 A;  1VSN A;  2JRI A;  5CHT A;  1F2C A;  2DCD A;  1KFX L;  4ZTB A;  1PPN A;  4P16 A;  1AIM A;  1DF0 A;  1U5I A;  4BOP A;  6PAD A;  3BBA A;  2R9C A;  1MDW A;  5JH3 A;  1KHP A;  1AYW A;  1ZCM A;  2DCC A;  3P5W A;  2FT2 A;  1ITO A;  1Q6K A;  1GLO A;  3CH3 X;  1XKG A;  2FTD A;  2GFO A;  2XU1 A;  3RNV A;  3BY4 A;  4K7C A;  1DKI A;  3KFQ A;  2WBF X;  4RF1 A;  3MTV A;  4REZ A;  4W4U A;  5EZS A;  3MHH A;  3C9E A;  2Z84 A;  1AU0 A;  2F7D A;  4W5C A;  3CBK A;  2DCB A;  2G7Y A;  1YK8 A;  3W30 A;  2OUL A;  2VHF A;  2R6N A;  1MEM A;  3H89 A;  1DEU A;  3QSD A;  4KLB A;  4R3D A;  1CVZ A;  2DC7 A;  1U9W A;  1IWD A;  2AGA A;  2NQD B;  4XZX A;  2AS8 A;  1YT7 A;  2Y5B A;  3AI8 A;  4YYU A;  1EWO A;  3P5U A;  3HHI A;  4PP2 E;  1U9Q X;  1ICF A;  1ME3 A;  2UZJ A;  2DOS A;  3D6S A;  3B21 A;  1QOL A;  3CH2 X;  3LXS A;  1S4V A;  5JA7 A;  4G54 A;  2IPP B;  1PCI A;  4YVA A;  2DC8 A;  4GUA A;  4YV8 A;  3IEJ A;  4AXL A;  1Y08 A;  3OQC A;  1AYV A;  2FRA A;  3MHS A;  2P0R A;  1FH0 A;  4HXD B;  4X6I A;  2BDZ A;  4I04 A;  3KWZ A;  2JTC A;  2GHU A;  2FE8 A;  4RKX A;  1TL9 A;  1PPO A;  2FYE A;  2P86 A;  2C0Y A;  3KX1 A;  1EF7 A;  1YK7 A;  3I06 A;  3PHX A;  3KKU A;  1QXP A;  2O6X A;  4PT5 A;  5CVO B;  4I05 A;  1UKF A;  5CHV A;  3PT2 A;  1CS8 A;  3K9M A;  1NL6 A;  2R9O A;  2PBH A;  1NB3 A;  1YAL A;  3LFY A;  3HHA A;  2E00 A;  2XU5 A;  3IV2 A;  3N3G A;  5CVM A;  2E02 A;  2G8E A;  2DJF B;  4OEL A;  2E01 A;  3IHP A;  4BS5 A;  3PRP A;  3IOQ A;  1CPJ A;  1TU6 A;  1PVJ A;  1U9V A;  1CJL A;  3WXF A;  3I3T A;  5EGW A;  5J94 A;  2P7U A;  1STF E;  3O0U A;  5EZQ A;  2NQA A;  4CZW A;  4YYQ A;  2XU3 A;  4PP1 A;  1BGO A;  2J7Q A;  5JZE A;  3V6E A;  3IMA A;  4QH6 A;  4P6E A;  3QJ3 A;  1ZIV A;  2F1G A;  4HWY A;  1AU2 A;  3HWN A;  5K16 A;  4YYW A;  3N3K A;  3F5V A;  2BTW B;  4RF0 A;  5CVN B;  4YYS A;  4QRV A;  2PNS A;  3N4C A;  1O0E A;  3WXE A;  1EWM A;  4QBB A;  3K24 A;  3F75 A;  2G6D A;  2H7J A;  2VHS A;  4BSQ A;  3KW9 A;  4DMY A;  2ACT A;  5KO3 A;  1AYU A;  1ATK A;  2FQ9 A;  2DCA A;  5E6J A;  2AUZ A;  4P6G A;  4D8E A;  4D8B A;  1BY8 A;  1MEG A;  3CBJ A;  3OVZ A;  4CDD B;  4RNA A;  3MJ5 A;  1YZB A;  1K3B B;  2CB5 A;  4OW0 A;  2B1M A;  1CQD A;  2NQG A;  2YJB A;  3MP2 A;  1MHW A;  4OVZ A;  3BCN A;  3PRM A;  4WUR A;  1F2B A;  1ME4 A;  1CV8 A;  2AIM A;  8PCH A;  3IUT A;  4QRG A;  3RVX A;  1SNK A;  3BOW A;  3W31 A;  1Y4H A;  1PPD A;  3RVW A;  5FPW A;  5PAD A;  4XR7 A;  2DJG B;  4PI3 A;  4BOQ A;  3TNX A;  2DZY A;  4MZO A;  3V6C A;  2B1N A;  1JQP A;  3BB7 A;  1AEC A;  1BP4 A;  4BQV A;  1KFU L;  1A6R A;  1YVB A;  3H6S A;  4MZS A;  2HXZ A;  3BC3 A;  4DMX A;  2YJ2 A;  3H8B A;  3OF8 A;  2ARY A;  2PAD A;  1CB5 A;  3S3Q A;  1GCB A;  3H7D A;  4X6J A;  4MSX A;  2DC6 A;  3HD3 A;  4ZUX U;  2HHN A;  4WA6 A;  1NQC A;  2Y6E A;  4AXM A;  2JQF R;  2HD5 A;  2R9N A;  2HH5 A;  3KSE A;  4YYR A;  1CSB B;  2FO5 A;  3OF9 A;  1NLJ A;  2DC9 A;  2BU3 A;  2R9F A;  1MIR A;  4I07 A;  3BPM A;  2AYO A;  2IBI A;  2NQI A;  3H8C A;  3OVX A;  3OIS A;  2PRE A;  2YJ8 A;  1POP A;  3IFU A;  3NHE A;  4IP3 A;  4BOZ A;  4PAD A;  4RY2 A;  4X6H A;  4A5U A;  2AU1 A;  4FIP A;  1HUC B;  1PBH A;  3E1Z B;  4OVZ B;  3PBH A;  4MI7 A;  1QMY A;  1QDQ A;  3B79 A;  3BWK A;  9PAP A;  4IUM A;  3ZUA A;  4N8W A;  4BOU A;  3PHU A;  3GCB A;  1BQI A;  1THE A;  3ERV A;  4QRX A;  1GEC E;  3PHW A;  5F02 A;  4CDE B;  1KXR A;  1GMY A;  2FRQ A;  3E9S A;  2XU4 A;  3TMP A;  1F29 A;  4Q8G A;  4XUI A;  1AU4 A;  1EWP A;  3WXG A;  4Q8H A;  2DZZ A;  4FK5 A;  2FUD A;  3RVV A;  2YJ9 A;  1NB5 A;  1PXV A;  3P5V A;  2HWK A;  1EWL A;  3P5X A;  4FJC A;  2OP3 A;  3S3R A;  3PNR A;  3PW3 A;  4BPV A;  1AU3 A;  3PDF A;  3O65 A;  1CTE A;  2JQG R;  2AUX A;  3U8E A;  3K8U A;  3PSE A;  4M0W A;  2G8J A;  3MOR A;  1PE6 A;  3KWB X;  1MS6 A;  4W5B A;  7PCK A;  4YYV A;  1SP4 B;  1TLO A;  3C0R A;  1X9Y A;  3ZNH A;  1F2A A;  2R9M A;  4MM3 B;  4N79 A;  1M6D A;  5EF4 A;  3TRK A;  4BOS A;  3DF0 A;  2E03 A;  3USV A;  2AVW A;  2ATO A;  2OZ2 A;  4OEM A; 
#chains in the Genus database with same CATH homology
 2BDL A;  3QT4 A;  2YJC A;  1PIP A;  1VJV A;  1PPP A;  4CDF B;  3M99 A;  1KHQ A;  4N4Z A;  4BS6 A;  2AYN A;  1NPZ A;  1PAD A;  3BPF A;  2CIO A;  4CDC B;  3MTN A;  1U9X A;  3O1G A;  5A24 A;  1VSN A;  5CHT A;  1F2C A;  2VFB A;  2DCD A;  1KFX L;  1PPN A;  1AIM A;  3LTW A;  1DF0 A;  1U5I A;  2VFC A;  6PAD A;  2R9C A;  1MDW A;  5JH3 A;  1KHP A;  1AYW A;  1ZCM A;  2DCC A;  3P5W A;  2FT2 A;  1ITO A;  1Q6K A;  1GLO A;  3CH3 X;  4C5P A;  1XKG A;  2FTD A;  2GFO A;  2XU1 A;  4K7C A;  3KFQ A;  2WBF X;  4W4U A;  3MHH A;  3C9E A;  1AU0 A;  2F7D A;  4W5C A;  3CBK A;  2DCB A;  2G7Y A;  1YK8 A;  2OUL A;  2VHF A;  2R6N A;  3H89 A;  1MEM A;  1DEU A;  3QSD A;  4KLB A;  1CVZ A;  2DC7 A;  1U9W A;  1IWD A;  2NQD B;  3D9W A;  2AS8 A;  1YT7 A;  2Y5B A;  3AI8 A;  4YYU A;  1EWO A;  3P5U A;  3HHI A;  4PP2 E;  1U9Q X;  1ICF A;  1ME3 A;  3D6S A;  1QOL A;  3CH2 X;  3LXS A;  1S4V A;  5JA7 A;  4G54 A;  2IPP B;  1PCI A;  4YVA A;  2DC8 A;  4YV8 A;  3IEJ A;  4AXL A;  1Y08 A;  1AYV A;  2FRA A;  3MHS A;  2P0R A;  1FH0 A;  4X6I A;  2BDZ A;  4I04 A;  3KWZ A;  2GHU A;  1TL9 A;  1PPO A;  2FYE A;  2P86 A;  2C0Y A;  3KX1 A;  1EF7 A;  1YK7 A;  2BSZ A;  3I06 A;  3KKU A;  1QXP A;  2O6X A;  5CVO B;  4I05 A;  5CHV A;  1CS8 A;  3K9M A;  1NL6 A;  2R9O A;  2PBH A;  1NB3 A;  1YAL A;  3LFY A;  3HHA A;  2E00 A;  2XU5 A;  4B55 A;  3IV2 A;  3N3G A;  5CVM A;  2E02 A;  2G8E A;  2DJF B;  4OEL A;  2E01 A;  3IHP A;  4BS5 A;  3IOQ A;  1CPJ A;  1TU6 A;  1U9V A;  1W6F A;  1CJL A;  3WXF A;  3I3T A;  5EGW A;  5J94 A;  2P7U A;  1STF E;  3O0U A;  2NQA A;  4CZW A;  4YYQ A;  2XU3 A;  4PP1 A;  1BGO A;  3V6E A;  3IMA A;  4QH6 A;  4NV7 A;  4P6E A;  3QJ3 A;  1ZIV A;  2F1G A;  4HWY A;  1AU2 A;  3HWN A;  5K16 A;  4YYW A;  3N3K A;  3F5V A;  5CVN B;  4YYS A;  4QRV A;  2PNS A;  3N4C A;  1O0E A;  3WXE A;  1EWM A;  4QBB A;  3K24 A;  3F75 A;  2G6D A;  2H7J A;  2VHS A;  4BSQ A;  3KW9 A;  4DMY A;  2ACT A;  1AYU A;  1ATK A;  1E2T A;  4NV8 A;  2FQ9 A;  2DCA A;  2AUZ A;  4P6G A;  1BY8 A;  1MEG A;  3CBJ A;  3OVZ A;  4CDD B;  1K3B B;  2CB5 A;  2B1M A;  1CQD A;  2NQG A;  2YJB A;  1MHW A;  3BCN A;  1F2B A;  1ME4 A;  1CV8 A;  2AIM A;  8PCH A;  3IUT A;  4QRG A;  3RVX A;  1SNK A;  3BOW A;  1Y4H A;  1PPD A;  3RVW A;  5FPW A;  5PAD A;  4XR7 A;  2DJG B;  4PI3 A;  3TNX A;  2DZY A;  4MZO A;  3V6C A;  2B1N A;  1JQP A;  1AEC A;  1BP4 A;  4BQV A;  1KFU L;  1A6R A;  1YVB A;  3H6S A;  4MZS A;  2HXZ A;  3BC3 A;  4DMX A;  2YJ2 A;  3H8B A;  3OF8 A;  2ARY A;  2PAD A;  1CB5 A;  1W5R A;  3S3Q A;  1GCB A;  3H7D A;  4X6J A;  4MSX A;  2DC6 A;  3HD3 A;  4ZUX U;  2HHN A;  4WA6 A;  1NQC A;  2Y6E A;  4AXM A;  2JQF R;  2HD5 A;  2R9N A;  2HH5 A;  3KSE A;  4YYR A;  1CSB B;  2FO5 A;  3OF9 A;  1NLJ A;  2DC9 A;  2R9F A;  1MIR A;  4I07 A;  3BPM A;  2AYO A;  2IBI A;  2NQI A;  3H8C A;  3OVX A;  3OIS A;  4BGF A;  2PRE A;  2YJ8 A;  1POP A;  3NHE A;  4PAD A;  4RY2 A;  4X6H A;  2AU1 A;  4FIP A;  1HUC B;  1PBH A;  3E1Z B;  3PBH A;  1QMY A;  1QDQ A;  3B79 A;  3BWK A;  9PAP A;  3ZUA A;  4N8W A;  3GCB A;  1BQI A;  1THE A;  3ERV A;  4QRX A;  1GEC E;  5F02 A;  4CDE B;  1KXR A;  1GMY A;  2FRQ A;  2XU4 A;  1F29 A;  4Q8G A;  4XUI A;  1AU4 A;  1EWP A;  3WXG A;  4Q8H A;  2DZZ A;  4FK5 A;  1GX3 A;  2FUD A;  3RVV A;  2YJ9 A;  1NB5 A;  1PXV A;  3P5V A;  1EWL A;  3P5X A;  1W4T A;  4FJC A;  2OP3 A;  3S3R A;  3PNR A;  3PW3 A;  4BPV A;  1AU3 A;  3PDF A;  1CTE A;  2JQG R;  2AUX A;  3U8E A;  3K8U A;  2G8J A;  3MOR A;  1PE6 A;  3KWB X;  1MS6 A;  4W5B A;  7PCK A;  4YYV A;  1SP4 B;  1TLO A;  1X9Y A;  1F2A A;  2R9M A;  4N79 A;  1M6D A;  5EF4 A;  3DF0 A;  2E03 A;  4GUZ A;  3USV A;  2AVW A;  2ATO A;  2OZ2 A;  4OEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...