4X6HA

Development of n-(functionalized benzoyl)-homocycloleucyl-glycinonitriles as potent cathepsin k inhibitors.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of N-(Functionalized benzoyl)-homocycloleucyl-glycinonitriles as Potent Cathepsin K Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 67
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4x6hA00
4X6JA 1CPJA 1BGOA 1PPNA 1MHWA 2Y5BA 1QOLA 1KHPA 2O6XA 5CVMA 1HUCB 4WA6A 3KSEA 3BCNA 2JQGR 3V6EA 2G7YA 3F5VA 2NQDB 3H8CA 3NHEA 2XU1A 4I05A 2FTDA 3OF9A 1POPA 1F2BA 1EWPA 1AIMA 1AU0A 4FK5A 1BP4A 3PDFA 3O1GA 8PCHA 2R9NA 2DJGB 2FUDA 3BPFA 1ZIVA 3OISA 2AYNA 4N4ZA 4CZWA 3IOQA 3OVZA 4QRGA 1KHQA 1QXPA 3ERVA 1FH0A 2DC8A 1CSBB 2E03A 2B1MA 1CB5A 5JH3A 4CDFB 2YJ9A 4N8WA 1AU4A 4PI3A 4PP1A 2E01A 3MTNA 2B1NA 3HHAA 4XR7A 2G8JA 2AUXA 3K9MA 1XKGA 2AIMA 2HHNA 1A6RA 1S4VA 1F2AA 1YK8A 1MEGA 2DZZA 2E00A 1PIPA 1Q6KA 3K8UA 1EF7A 3IEJA 1ATKA 2AU1A 1NB5A 5J94A 5CHVA 3IUTA 2ATOA 1PADA 2R9CA 2XU4A 3N4CA 3I06A 2DZYA 2G6DA 3RVWA 2YJCA 3V6CA 2PBHA 2HD5A 2FO5A 6PADA 1GMYA 2PREA 4XUIA 1O0EA 1PPPA 3PNRA 2P7UA 4BSQA 1U9QX 3PW3A 1SNKA 3I3TA 3H89A 4BS5A 4YV8A 1CS8A 1U5IA 1VSNA 3P5XA 4QH6A 1AECA 2R9OA 2R9MA 4YVAA 2AVWA 3QT4A 1AYWA 1KXRA 4YYQA 4P6EA 3IMAA 1AYVA 2ARYA 1GECE 2R6NA 3AI8A 5CHTA 1ZCMA 4CDEB 2OULA 4P6GA 1K3BB 4OELA 3H6SA 1EWMA 2PADA 2P0RA 2DC6A 4OEMA 2PNSA 3MORA 3WXFA 4KLBA 4FIPA 3CBJA 4YYSA 3OVXA 3WXGA 1AU3A 1CV8A 1DEUA 2CIOA 5FPWA 3HD3A 1TL9A 1KFUL 2BDZA 1M6DA 1X9YA 1SP4B 2DJFB 5PADA 4Q8HA 1NL6A 2NQGA 3H7DA 2BDLA 2XU3A 2NQAA 3PBHA 4ZUXU 5EF4A 2IBIA 1U9XA 2YJBA 3LFYA 1PPDA 4DMYA 5F02A 3OF8A 4DMXA 3M99A 1CQDA 2FRAA 3BPMA 3S3QA 2E02A 2F7DA 1YVBA 5CVOB 4YYWA 2AS8A 4QRXA 2WBFX 3IHPA 1NB3A 3HHIA 1VJVA 5CVNB 4CDDB 3WXEA 1BY8A 2DC9A 2GFOA 1EWOA 1AYUA 2OP3A 3KFQA 2FYEA 1PE6A 1YALA 7PCKA 1ITOA 2CB5A 1F2CA 4HWYA 4BPVA 1CTEA 1THEA 2NQIA 4YYVA 1NLJA 1NPZA 1MDWA 2YJ8A 3C9EA 2IPPB 1GLOA 2C0YA 2HXZA 2Y6EA 3HWNA 3GCBA 4QBBA 4W5CA 3B79A 3O0UA 4K7CA 3S3RA 1ME3A 4G54A 2VHFA 3RVXA 1IWDA 1STFE 2DCDA 1KFXL 2H7JA 1MEMA 4AXMA 1YT7A 3KKUA 1JQPA 3LXSA 4I04A 1F29A 4QRVA 1BQIA 1DF0A 1CJLA 1QMYA 3N3KA 3BC3A 4MSXA 3CH2X 1PXVA 3MHHA 2ACTA 2F1GA 3F75A 2FT2A 2AYOA 2FQ9A 3DF0A 1AU2A 4AXLA 3BWKA 1EWLA 2DC7A 2HH5A 4YYUA 5K16A 1MIRA 4X6IA 2AUZA 3P5UA 1TU6A 3ZUAA 4Q8GA 1U9VA 4CDCB 1ME4A 3IV2A 3MHSA 3QSDA 4MZOA 1PBHA 1Y08A 5EGWA 4W5BA 2JQFR 1NQCA 4I07A 4PP2E 3USVA 1TLOA 1Y4HA 3CBKA 4X6HA 5A24A 4W4UA 2R9FA 2VHSA 3CH3X 3QJ3A 2G8EA 4BQVA 5JA7A 2GHUA 3BOWA 2P86A 3H8BA 1PPOA 3KW9A 2XU5A 1PCIA 4MZSA 1GCBA 4FJCA 4RY2A 3K24A 1QDQA 3U8EA 2FRQA 2DCBA 3TNXA 1ICFA 3D6SA 3P5WA 3KWZA 4BS6A 3KX1A 3RVVA 1YK7A 3N3GA 1MS6A 1CVZA 4YYRA 1U9WA 3E1ZB 2DCCA 2OZ2A 9PAPA 4PADA 3P5VA 2YJ2A 4N79A 3KWBX 2DCAA
chains in the Genus database with same CATH superfamily
4X6JA 1CPJA 1BGOA 1PPNA 1MHWA 2Y5BA 1QOLA 1KHPA 5E6JA 2O6XA 5CVMA 1HUCB 3BY4A 4WA6A 3KSEA 3BCNA 2JQGR 3V6EA 2G7YA 3F5VA 2NQDB 3H8CA 3NHEA 2XU1A 4I05A 4IP3A 2FTDA 3OF9A 1POPA 1F2BA 1EWPA 1AIMA 1AU0A 1UKFA 1BP4A 3PDFA 3O1GA 3PRMA 4FK5A 8PCHA 4OVZB 2R9NA 2DJGB 2FUDA 3BPFA 1ZIVA 3OISA 2AYNA 4P16A 4N4ZA 4CZWA 3IOQA 3OVZA 4QRGA 1KHQA 1QXPA 3ERVA 1YZBA 1FH0A 3O65A 2DC8A 2JRIA 1CSBB 3W30A 2E03A 2B1MA 2BU3A 1CB5A 5JH3A 4CDFB 2YJ9A 4N8WA 1AU4A 4PI3A 4PP1A 4BOSA 2E01A 3MTNA 2JTCA 2B1NA 3HHAA 4XR7A 2G8JA 2AUXA 3K9MA 1XKGA 2AIMA 2HHNA 1A6RA 4D8IA 1S4VA 1F2AA 1YK8A 3PHWA 4ZTBA 4RKXA 1MEGA 2DZZA 4R3DA 2E00A 1PIPA 3MJ5A 1Q6KA 3K8UA 1EF7A 3IEJA 1ATKA 2AU1A 1NB5A 4IUMA 5J94A 5CHVA 3IUTA 2ATOA 4BOQA 1PADA 2R9CA 2XU4A 3N4CA 5EZSA 3I06A 2DZYA 2G6DA 3RVWA 2YJCA 3V6CA 2PBHA 2HD5A 2FO5A 6PADA 1GMYA 2PREA 4XUIA 1O0EA 1PPPA 3PNRA 2P7UA 4BSQA 1U9QX 3PW3A 1SNKA 3I3TA 3H89A 4REZA 4BS5A 4YV8A 1CS8A 1U5IA 1VSNA 3P5XA 4OW0A 4QH6A 1AECA 2R9OA 2R9MA 5EZQA 4YVAA 2AVWA 3QT4A 1AYWA 1KXRA 4RNAA 4YYQA 4P6EA 3IMAA 1AYVA 2ARYA 1GECE 2R6NA 3AI8A 5CHTA 1ZCMA 4CDEB 2OULA 4P6GA 1K3BB 4OELA 3H6SA 1EWMA 2PADA 2P0RA 2DC6A 4OEMA 3OQCA 2PNSA 3MORA 2Z84A 3WXFA 4KLBA 4FIPA 3CBJA 4YYSA 3OVXA 3WXGA 1AU3A 1CV8A 1DEUA 2CIOA 3B21A 5FPWA 3HD3A 4BOPA 3RNVA 1TL9A 2J7QC 1KFUL 2BDZA 1M6DA 1X9YA 1SP4B 2DJFB 5PADA 4Q8HA 1NL6A 2NQGA 3H7DA 2BDLA 2XU3A 2NQAA 3PBHA 4ZUXU 5EF4A 4RF1A 2IBIA 1U9XA 2YJBA 3LFYA 1PPDA 4DMYA 5F02A 3OF8A 4DMXA 3M99A 1CQDA 2FRAA 3BPMA 3S3QA 2E02A 2F7DA 4BOZA 1YVBA 5CVOB 4YYWA 2AS8A 4QRXA 2WBFX 2FE8A 4D8EA 3IHPA 3TRKA 1NB3A 3HHIA 1VJVA 5CVNB 4CDDB 3WXEA 1BY8A 2DC9A 2GFOA 4WURA 1EWOA 1DKIA 3W31A 1AYUA 2OP3A 3KFQA 2FYEA 3PHXA 1PE6A 1YALA 7PCKA 1ITOA 4GUAA 4XZXA 2CB5A 3PSEA 1F2CA 3ZNHA 4HWYA 4BPVA 3BB7A 1CTEA 3TMPA 1THEA 2NQIA 4YYVA 1NLJA 1NPZA 1MDWA 2YJ8A 3C9EA 2IPPB 1GLOA 4PT5A 2C0YA 2HXZA 2Y6EA 3HWNA 3GCBA 4QBBA 4W5CA 3B79A 3O0UA 4K7CA 3S3RA 3IFUA 3PRPA 1ME3A 4G54A 2VHFA 3RVXA 1IWDA 3MTVA 1STFE 2DCDA 1KFXL 2H7JA 1MEMA 4AXMA 1YT7A 3KKUA 1JQPA 3LXSA 4I04A 1F29A 4QRVA 1BQIA 1DF0A 1CJLA 1QMYA 3N3KA 3BC3A 4MSXA 3CH2X 1PXVA 3MHHA 2ACTA 2F1GA 3F75A 3MP2A 2FT2A 4MI7A 2HWKA 2AYOA 2AGAA 3C0RA 2FQ9A 3DF0A 1AU2A 2BTWA 3BBAA 4HXDB 4AXLA 3BWKA 3PHUA 1EWLA 2J7QA 2DC7A 2DOSA 2HH5A 4YYUA 4D8BA 4RF0A 5K16A 1MIRA 4X6IA 2AUZA 3P5UA 1TU6A 3ZUAA 4Q8GA 1U9VA 4CDCB 4M0WA 5KO3A 1ME4A 3IV2A 3MHSA 3QSDA 4MZOA 1PBHA 1Y08A 5EGWA 4W5BA 2JQFR 1NQCA 4I07A 4PP2E 3USVA 1TLOA 1Y4HA 3CBKA 3PT2A 4X6HA 5A24A 4W4UA 2R9FA 1PVJA 2VHSA 3CH3X 3QJ3A 2G8EA 4BQVA 5JA7A 2GHUA 3BOWA 2P86A 3H8BA 1PPOA 3KW9A 5JZEA 2XU5A 1PCIA 2BTWB 4MZSA 1GCBA 4FJCA 4RY2A 3K24A 4BOUA 4OVZA 3E9SA 1QDQA 3U8EA 2FRQA 2DCBA 3TNXA 1ICFA 3D6SA 3P5WA 3KWZA 4BS6A 3KX1A 3RVVA 1YK7A 3N3GA 1MS6A 1CVZA 4YYRA 1U9WA 3E1ZB 2DCCA 2OZ2A 9PAPA 4PADA 3P5VA 2YJ2A 4A5UA 4N79A 2UZJA 3KWBX 4MM3B 2DCAA
chains in the Genus database with same CATH topology
4X6JA 1CPJA 1BGOA 1PPNA 1MHWA 2Y5BA 1QOLA 1KHPA 2O6XA 5CVMA 1HUCB 4WA6A 3KSEA 3BCNA 2JQGR 3V6EA 2G7YA 3F5VA 2NQDB 3H8CA 3NHEA 2XU1A 4I05A 2FTDA 3OF9A 1POPA 1F2BA 1EWPA 4B55A 1AIMA 1AU0A 4FK5A 1BP4A 3PDFA 3O1GA 8PCHA 2R9NA 2DJGB 2FUDA 3BPFA 1ZIVA 3OISA 2AYNA 4N4ZA 4CZWA 3IOQA 3OVZA 4QRGA 1GX3A 1KHQA 1QXPA 3ERVA 1FH0A 2DC8A 1CSBB 2E03A 2B1MA 1CB5A 5JH3A 4CDFB 2YJ9A 4N8WA 1AU4A 4PI3A 4PP1A 2E01A 3MTNA 2B1NA 3HHAA 4XR7A 2G8JA 2VFCA 2AUXA 3K9MA 1XKGA 2AIMA 2HHNA 1A6RA 1S4VA 1F2AA 1YK8A 1MEGA 2DZZA 3D9WA 2E00A 1PIPA 1Q6KA 3K8UA 1EF7A 3IEJA 1ATKA 2AU1A 1NB5A 5J94A 5CHVA 3IUTA 2ATOA 1PADA 2R9CA 2XU4A 3N4CA 3I06A 2DZYA 2G6DA 3RVWA 2YJCA 3V6CA 2PBHA 2HD5A 2FO5A 6PADA 1GMYA 2PREA 4XUIA 1O0EA 1PPPA 3PNRA 2P7UA 4BSQA 1U9QX 3PW3A 1SNKA 3I3TA 3H89A 4BS5A 4YV8A 1CS8A 1U5IA 1VSNA 3P5XA 4QH6A 1AECA 2R9OA 2R9MA 4YVAA 2AVWA 3QT4A 1AYWA 1KXRA 4YYQA 4C5PA 4P6EA 3IMAA 4NV8A 2BSZA 1AYVA 2ARYA 1GECE 2R6NA 3AI8A 5CHTA 1ZCMA 4CDEB 2OULA 4P6GA 1K3BB 4OELA 3H6SA 1EWMA 2PADA 2P0RA 2DC6A 4OEMA 2PNSA 3MORA 3WXFA 4KLBA 4FIPA 3CBJA 4YYSA 3OVXA 3WXGA 1AU3A 1CV8A 1DEUA 2CIOA 5FPWA 3HD3A 1TL9A 1KFUL 2BDZA 1M6DA 1X9YA 1SP4B 2DJFB 5PADA 4Q8HA 1NL6A 2NQGA 3H7DA 2BDLA 2XU3A 2NQAA 3PBHA 1W4TA 4ZUXU 5EF4A 2IBIA 1U9XA 2YJBA 3LFYA 1PPDA 4DMYA 5F02A 3OF8A 4DMXA 3M99A 1CQDA 2FRAA 3BPMA 3S3QA 3LTWA 2E02A 2F7DA 4GUZA 1YVBA 5CVOB 4YYWA 2AS8A 4QRXA 2WBFX 3IHPA 1NB3A 3HHIA 1VJVA 5CVNB 4CDDB 3WXEA 1BY8A 2DC9A 2GFOA 1EWOA 1AYUA 2OP3A 3KFQA 2FYEA 1PE6A 1YALA 7PCKA 1ITOA 2CB5A 1F2CA 4HWYA 4BPVA 1CTEA 1THEA 2NQIA 4YYVA 1NLJA 1NPZA 1MDWA 2YJ8A 3C9EA 2IPPB 1GLOA 2C0YA 2HXZA 2Y6EA 3HWNA 3GCBA 4QBBA 4W5CA 3B79A 3O0UA 4K7CA 3S3RA 1ME3A 4G54A 2VHFA 3RVXA 1IWDA 1STFE 2DCDA 1KFXL 2H7JA 1MEMA 4AXMA 1YT7A 3KKUA 1JQPA 3LXSA 4I04A 1F29A 4QRVA 1BQIA 1DF0A 1CJLA 1QMYA 3N3KA 3BC3A 4MSXA 3CH2X 1PXVA 3MHHA 2ACTA 2F1GA 3F75A 2FT2A 2AYOA 2FQ9A 3DF0A 1AU2A 4AXLA 3BWKA 1EWLA 2DC7A 2HH5A 4YYUA 5K16A 1MIRA 4X6IA 2AUZA 3P5UA 1TU6A 3ZUAA 1W5RA 4Q8GA 1U9VA 4CDCB 1ME4A 3IV2A 3MHSA 3QSDA 4MZOA 1PBHA 1Y08A 5EGWA 4W5BA 2JQFR 1NQCA 4I07A 4PP2E 3USVA 1TLOA 1Y4HA 3CBKA 4X6HA 5A24A 4W4UA 4BGFA 2R9FA 2VHSA 3CH3X 3QJ3A 2G8EA 4NV7A 4BQVA 5JA7A 2GHUA 3BOWA 2P86A 3H8BA 1PPOA 3KW9A 2XU5A 1PCIA 4MZSA 1GCBA 4FJCA 4RY2A 1W6FA 3K24A 1QDQA 3U8EA 2FRQA 1E2TA 2DCBA 3TNXA 1ICFA 3D6SA 3P5WA 3KWZA 4BS6A 3KX1A 3RVVA 1YK7A 3N3GA 1MS6A 1CVZA 4YYRA 1U9WA 3E1ZB 2DCCA 2VFBA 2OZ2A 9PAPA 4PADA 3P5VA 2YJ2A 4N79A 3KWBX 2DCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6J A;  1CPJ A;  1BGO A;  1PPN A;  1MHW A;  2Y5B A;  1QOL A;  1KHP A;  2O6X A;  5CVM A;  1HUC B;  4WA6 A;  3KSE A;  3BCN A;  2JQG R;  3V6E A;  2G7Y A;  3F5V A;  2NQD B;  3H8C A;  3NHE A;  2XU1 A;  4I05 A;  2FTD A;  3OF9 A;  1POP A;  1F2B A;  1EWP A;  1AIM A;  1AU0 A;  4FK5 A;  1BP4 A;  3PDF A;  3O1G A;  8PCH A;  2R9N A;  2DJG B;  2FUD A;  3BPF A;  1ZIV A;  3OIS A;  2AYN A;  4N4Z A;  4CZW A;  3IOQ A;  3OVZ A;  4QRG A;  1KHQ A;  1QXP A;  3ERV A;  1FH0 A;  2DC8 A;  1CSB B;  2E03 A;  2B1M A;  1CB5 A;  5JH3 A;  4CDF B;  2YJ9 A;  4N8W A;  1AU4 A;  4PI3 A;  4PP1 A;  2E01 A;  3MTN A;  2B1N A;  3HHA A;  4XR7 A;  2G8J A;  2AUX A;  3K9M A;  1XKG A;  2AIM A;  2HHN A;  1A6R A;  1S4V A;  1F2A A;  1YK8 A;  1MEG A;  2DZZ A;  2E00 A;  1PIP A;  1Q6K A;  3K8U A;  1EF7 A;  3IEJ A;  1ATK A;  2AU1 A;  1NB5 A;  5J94 A;  5CHV A;  3IUT A;  2ATO A;  1PAD A;  2R9C A;  2XU4 A;  3N4C A;  3I06 A;  2DZY A;  2G6D A;  3RVW A;  2YJC A;  3V6C A;  2PBH A;  2HD5 A;  2FO5 A;  6PAD A;  1GMY A;  2PRE A;  4XUI A;  1O0E A;  1PPP A;  3PNR A;  2P7U A;  4BSQ A;  1U9Q X;  3PW3 A;  1SNK A;  3I3T A;  3H89 A;  4BS5 A;  4YV8 A;  1CS8 A;  1U5I A;  1VSN A;  3P5X A;  4QH6 A;  1AEC A;  2R9O A;  2R9M A;  4YVA A;  2AVW A;  3QT4 A;  1AYW A;  1KXR A;  4YYQ A;  4P6E A;  3IMA A;  1AYV A;  2ARY A;  1GEC E;  2R6N A;  3AI8 A;  5CHT A;  1ZCM A;  4CDE B;  2OUL A;  4P6G A;  1K3B B;  4OEL A;  3H6S A;  1EWM A;  2PAD A;  2P0R A;  2DC6 A;  4OEM A;  2PNS A;  3MOR A;  3WXF A;  4KLB A;  4FIP A;  3CBJ A;  4YYS A;  3OVX A;  3WXG A;  1AU3 A;  1CV8 A;  1DEU A;  2CIO A;  5FPW A;  3HD3 A;  1TL9 A;  1KFU L;  2BDZ A;  1M6D A;  1X9Y A;  1SP4 B;  2DJF B;  5PAD A;  4Q8H A;  1NL6 A;  2NQG A;  3H7D A;  2BDL A;  2XU3 A;  2NQA A;  3PBH A;  4ZUX U;  5EF4 A;  2IBI A;  1U9X A;  2YJB A;  3LFY A;  1PPD A;  4DMY A;  5F02 A;  3OF8 A;  4DMX A;  3M99 A;  1CQD A;  2FRA A;  3BPM A;  3S3Q A;  2E02 A;  2F7D A;  1YVB A;  5CVO B;  4YYW A;  2AS8 A;  4QRX A;  2WBF X;  3IHP A;  1NB3 A;  3HHI A;  1VJV A;  5CVN B;  4CDD B;  3WXE A;  1BY8 A;  2DC9 A;  2GFO A;  1EWO A;  1AYU A;  2OP3 A;  3KFQ A;  2FYE A;  1PE6 A;  1YAL A;  7PCK A;  1ITO A;  2CB5 A;  1F2C A;  4HWY A;  4BPV A;  1CTE A;  1THE A;  2NQI A;  4YYV A;  1NLJ A;  1NPZ A;  1MDW A;  2YJ8 A;  3C9E A;  2IPP B;  1GLO A;  2C0Y A;  2HXZ A;  2Y6E A;  3HWN A;  3GCB A;  4QBB A;  4W5C A;  3B79 A;  3O0U A;  4K7C A;  3S3R A;  1ME3 A;  4G54 A;  2VHF A;  3RVX A;  1IWD A;  1STF E;  2DCD A;  1KFX L;  2H7J A;  1MEM A;  4AXM A;  1YT7 A;  3KKU A;  1JQP A;  3LXS A;  4I04 A;  1F29 A;  4QRV A;  1BQI A;  1DF0 A;  1CJL A;  1QMY A;  3N3K A;  3BC3 A;  4MSX A;  3CH2 X;  1PXV A;  3MHH A;  2ACT A;  2F1G A;  3F75 A;  2FT2 A;  2AYO A;  2FQ9 A;  3DF0 A;  1AU2 A;  4AXL A;  3BWK A;  1EWL A;  2DC7 A;  2HH5 A;  4YYU A;  5K16 A;  1MIR A;  4X6I A;  2AUZ A;  3P5U A;  1TU6 A;  3ZUA A;  4Q8G A;  1U9V A;  4CDC B;  1ME4 A;  3IV2 A;  3MHS A;  3QSD A;  4MZO A;  1PBH A;  1Y08 A;  5EGW A;  4W5B A;  2JQF R;  1NQC A;  4I07 A;  4PP2 E;  3USV A;  1TLO A;  1Y4H A;  3CBK A;  4X6H A;  5A24 A;  4W4U A;  2R9F A;  2VHS A;  3CH3 X;  3QJ3 A;  2G8E A;  4BQV A;  5JA7 A;  2GHU A;  3BOW A;  2P86 A;  3H8B A;  1PPO A;  3KW9 A;  2XU5 A;  1PCI A;  4MZS A;  1GCB A;  4FJC A;  4RY2 A;  3K24 A;  1QDQ A;  3U8E A;  2FRQ A;  2DCB A;  3TNX A;  1ICF A;  3D6S A;  3P5W A;  3KWZ A;  4BS6 A;  3KX1 A;  3RVV A;  1YK7 A;  3N3G A;  1MS6 A;  1CVZ A;  4YYR A;  1U9W A;  3E1Z B;  2DCC A;  2OZ2 A;  9PAP A;  4PAD A;  3P5V A;  2YJ2 A;  4N79 A;  3KWB X;  2DCA A; 
#chains in the Genus database with same CATH topology
 4X6J A;  1CPJ A;  1BGO A;  1PPN A;  1MHW A;  2Y5B A;  1QOL A;  1KHP A;  5E6J A;  2O6X A;  5CVM A;  1HUC B;  3BY4 A;  4WA6 A;  3KSE A;  3BCN A;  2JQG R;  3V6E A;  2G7Y A;  3F5V A;  2NQD B;  3H8C A;  3NHE A;  2XU1 A;  4I05 A;  4IP3 A;  2FTD A;  3OF9 A;  1POP A;  1F2B A;  1EWP A;  1AIM A;  1AU0 A;  1UKF A;  1BP4 A;  3PDF A;  3O1G A;  3PRM A;  4FK5 A;  8PCH A;  4OVZ B;  2R9N A;  2DJG B;  2FUD A;  3BPF A;  1ZIV A;  3OIS A;  2AYN A;  4P16 A;  4N4Z A;  4CZW A;  3IOQ A;  3OVZ A;  4QRG A;  1KHQ A;  1QXP A;  3ERV A;  1YZB A;  1FH0 A;  3O65 A;  2DC8 A;  2JRI A;  1CSB B;  3W30 A;  2E03 A;  2B1M A;  2BU3 A;  1CB5 A;  5JH3 A;  4CDF B;  2YJ9 A;  4N8W A;  1AU4 A;  4PI3 A;  4PP1 A;  4BOS A;  2E01 A;  3MTN A;  2JTC A;  2B1N A;  3HHA A;  4XR7 A;  2G8J A;  2AUX A;  3K9M A;  1XKG A;  2AIM A;  2HHN A;  1A6R A;  4D8I A;  1S4V A;  1F2A A;  1YK8 A;  3PHW A;  4ZTB A;  4RKX A;  1MEG A;  2DZZ A;  4R3D A;  2E00 A;  1PIP A;  3MJ5 A;  1Q6K A;  3K8U A;  1EF7 A;  3IEJ A;  1ATK A;  2AU1 A;  1NB5 A;  4IUM A;  5J94 A;  5CHV A;  3IUT A;  2ATO A;  4BOQ A;  1PAD A;  2R9C A;  2XU4 A;  3N4C A;  5EZS A;  3I06 A;  2DZY A;  2G6D A;  3RVW A;  2YJC A;  3V6C A;  2PBH A;  2HD5 A;  2FO5 A;  6PAD A;  1GMY A;  2PRE A;  4XUI A;  1O0E A;  1PPP A;  3PNR A;  2P7U A;  4BSQ A;  1U9Q X;  3PW3 A;  1SNK A;  3I3T A;  3H89 A;  4REZ A;  4BS5 A;  4YV8 A;  1CS8 A;  1U5I A;  1VSN A;  3P5X A;  4OW0 A;  4QH6 A;  1AEC A;  2R9O A;  2R9M A;  5EZQ A;  4YVA A;  2AVW A;  3QT4 A;  1AYW A;  1KXR A;  4RNA A;  4YYQ A;  4P6E A;  3IMA A;  1AYV A;  2ARY A;  1GEC E;  2R6N A;  3AI8 A;  5CHT A;  1ZCM A;  4CDE B;  2OUL A;  4P6G A;  1K3B B;  4OEL A;  3H6S A;  1EWM A;  2PAD A;  2P0R A;  2DC6 A;  4OEM A;  3OQC A;  2PNS A;  3MOR A;  2Z84 A;  3WXF A;  4KLB A;  4FIP A;  3CBJ A;  4YYS A;  3OVX A;  3WXG A;  1AU3 A;  1CV8 A;  1DEU A;  2CIO A;  3B21 A;  5FPW A;  3HD3 A;  4BOP A;  3RNV A;  1TL9 A;  2J7Q C;  1KFU L;  2BDZ A;  1M6D A;  1X9Y A;  1SP4 B;  2DJF B;  5PAD A;  4Q8H A;  1NL6 A;  2NQG A;  3H7D A;  2BDL A;  2XU3 A;  2NQA A;  3PBH A;  4ZUX U;  5EF4 A;  4RF1 A;  2IBI A;  1U9X A;  2YJB A;  3LFY A;  1PPD A;  4DMY A;  5F02 A;  3OF8 A;  4DMX A;  3M99 A;  1CQD A;  2FRA A;  3BPM A;  3S3Q A;  2E02 A;  2F7D A;  4BOZ A;  1YVB A;  5CVO B;  4YYW A;  2AS8 A;  4QRX A;  2WBF X;  2FE8 A;  4D8E A;  3IHP A;  3TRK A;  1NB3 A;  3HHI A;  1VJV A;  5CVN B;  4CDD B;  3WXE A;  1BY8 A;  2DC9 A;  2GFO A;  4WUR A;  1EWO A;  1DKI A;  3W31 A;  1AYU A;  2OP3 A;  3KFQ A;  2FYE A;  3PHX A;  1PE6 A;  1YAL A;  7PCK A;  1ITO A;  4GUA A;  4XZX A;  2CB5 A;  3PSE A;  1F2C A;  3ZNH A;  4HWY A;  4BPV A;  3BB7 A;  1CTE A;  3TMP A;  1THE A;  2NQI A;  4YYV A;  1NLJ A;  1NPZ A;  1MDW A;  2YJ8 A;  3C9E A;  2IPP B;  1GLO A;  4PT5 A;  2C0Y A;  2HXZ A;  2Y6E A;  3HWN A;  3GCB A;  4QBB A;  4W5C A;  3B79 A;  3O0U A;  4K7C A;  3S3R A;  3IFU A;  3PRP A;  1ME3 A;  4G54 A;  2VHF A;  3RVX A;  1IWD A;  3MTV A;  1STF E;  2DCD A;  1KFX L;  2H7J A;  1MEM A;  4AXM A;  1YT7 A;  3KKU A;  1JQP A;  3LXS A;  4I04 A;  1F29 A;  4QRV A;  1BQI A;  1DF0 A;  1CJL A;  1QMY A;  3N3K A;  3BC3 A;  4MSX A;  3CH2 X;  1PXV A;  3MHH A;  2ACT A;  2F1G A;  3F75 A;  3MP2 A;  2FT2 A;  4MI7 A;  2HWK A;  2AYO A;  2AGA A;  3C0R A;  2FQ9 A;  3DF0 A;  1AU2 A;  2BTW A;  3BBA A;  4HXD B;  4AXL A;  3BWK A;  3PHU A;  1EWL A;  2J7Q A;  2DC7 A;  2DOS A;  2HH5 A;  4YYU A;  4D8B A;  4RF0 A;  5K16 A;  1MIR A;  4X6I A;  2AUZ A;  3P5U A;  1TU6 A;  3ZUA A;  4Q8G A;  1U9V A;  4CDC B;  4M0W A;  5KO3 A;  1ME4 A;  3IV2 A;  3MHS A;  3QSD A;  4MZO A;  1PBH A;  1Y08 A;  5EGW A;  4W5B A;  2JQF R;  1NQC A;  4I07 A;  4PP2 E;  3USV A;  1TLO A;  1Y4H A;  3CBK A;  3PT2 A;  4X6H A;  5A24 A;  4W4U A;  2R9F A;  1PVJ A;  2VHS A;  3CH3 X;  3QJ3 A;  2G8E A;  4BQV A;  5JA7 A;  2GHU A;  3BOW A;  2P86 A;  3H8B A;  1PPO A;  3KW9 A;  5JZE A;  2XU5 A;  1PCI A;  2BTW B;  4MZS A;  1GCB A;  4FJC A;  4RY2 A;  3K24 A;  4BOU A;  4OVZ A;  3E9S A;  1QDQ A;  3U8E A;  2FRQ A;  2DCB A;  3TNX A;  1ICF A;  3D6S A;  3P5W A;  3KWZ A;  4BS6 A;  3KX1 A;  3RVV A;  1YK7 A;  3N3G A;  1MS6 A;  1CVZ A;  4YYR A;  1U9W A;  3E1Z B;  2DCC A;  2OZ2 A;  9PAP A;  4PAD A;  3P5V A;  2YJ2 A;  4A5U A;  4N79 A;  2UZJ A;  3KWB X;  4MM3 B;  2DCA A; 
#chains in the Genus database with same CATH homology
 4X6J A;  1CPJ A;  1BGO A;  1PPN A;  1MHW A;  2Y5B A;  1QOL A;  1KHP A;  2O6X A;  5CVM A;  1HUC B;  4WA6 A;  3KSE A;  3BCN A;  2JQG R;  3V6E A;  2G7Y A;  3F5V A;  2NQD B;  3H8C A;  3NHE A;  2XU1 A;  4I05 A;  2FTD A;  3OF9 A;  1POP A;  1F2B A;  1EWP A;  4B55 A;  1AIM A;  1AU0 A;  4FK5 A;  1BP4 A;  3PDF A;  3O1G A;  8PCH A;  2R9N A;  2DJG B;  2FUD A;  3BPF A;  1ZIV A;  3OIS A;  2AYN A;  4N4Z A;  4CZW A;  3IOQ A;  3OVZ A;  4QRG A;  1GX3 A;  1KHQ A;  1QXP A;  3ERV A;  1FH0 A;  2DC8 A;  1CSB B;  2E03 A;  2B1M A;  1CB5 A;  5JH3 A;  4CDF B;  2YJ9 A;  4N8W A;  1AU4 A;  4PI3 A;  4PP1 A;  2E01 A;  3MTN A;  2B1N A;  3HHA A;  4XR7 A;  2G8J A;  2VFC A;  2AUX A;  3K9M A;  1XKG A;  2AIM A;  2HHN A;  1A6R A;  1S4V A;  1F2A A;  1YK8 A;  1MEG A;  2DZZ A;  3D9W A;  2E00 A;  1PIP A;  1Q6K A;  3K8U A;  1EF7 A;  3IEJ A;  1ATK A;  2AU1 A;  1NB5 A;  5J94 A;  5CHV A;  3IUT A;  2ATO A;  1PAD A;  2R9C A;  2XU4 A;  3N4C A;  3I06 A;  2DZY A;  2G6D A;  3RVW A;  2YJC A;  3V6C A;  2PBH A;  2HD5 A;  2FO5 A;  6PAD A;  1GMY A;  2PRE A;  4XUI A;  1O0E A;  1PPP A;  3PNR A;  2P7U A;  4BSQ A;  1U9Q X;  3PW3 A;  1SNK A;  3I3T A;  3H89 A;  4BS5 A;  4YV8 A;  1CS8 A;  1U5I A;  1VSN A;  3P5X A;  4QH6 A;  1AEC A;  2R9O A;  2R9M A;  4YVA A;  2AVW A;  3QT4 A;  1AYW A;  1KXR A;  4YYQ A;  4C5P A;  4P6E A;  3IMA A;  4NV8 A;  2BSZ A;  1AYV A;  2ARY A;  1GEC E;  2R6N A;  3AI8 A;  5CHT A;  1ZCM A;  4CDE B;  2OUL A;  4P6G A;  1K3B B;  4OEL A;  3H6S A;  1EWM A;  2PAD A;  2P0R A;  2DC6 A;  4OEM A;  2PNS A;  3MOR A;  3WXF A;  4KLB A;  4FIP A;  3CBJ A;  4YYS A;  3OVX A;  3WXG A;  1AU3 A;  1CV8 A;  1DEU A;  2CIO A;  5FPW A;  3HD3 A;  1TL9 A;  1KFU L;  2BDZ A;  1M6D A;  1X9Y A;  1SP4 B;  2DJF B;  5PAD A;  4Q8H A;  1NL6 A;  2NQG A;  3H7D A;  2BDL A;  2XU3 A;  2NQA A;  3PBH A;  1W4T A;  4ZUX U;  5EF4 A;  2IBI A;  1U9X A;  2YJB A;  3LFY A;  1PPD A;  4DMY A;  5F02 A;  3OF8 A;  4DMX A;  3M99 A;  1CQD A;  2FRA A;  3BPM A;  3S3Q A;  3LTW A;  2E02 A;  2F7D A;  4GUZ A;  1YVB A;  5CVO B;  4YYW A;  2AS8 A;  4QRX A;  2WBF X;  3IHP A;  1NB3 A;  3HHI A;  1VJV A;  5CVN B;  4CDD B;  3WXE A;  1BY8 A;  2DC9 A;  2GFO A;  1EWO A;  1AYU A;  2OP3 A;  3KFQ A;  2FYE A;  1PE6 A;  1YAL A;  7PCK A;  1ITO A;  2CB5 A;  1F2C A;  4HWY A;  4BPV A;  1CTE A;  1THE A;  2NQI A;  4YYV A;  1NLJ A;  1NPZ A;  1MDW A;  2YJ8 A;  3C9E A;  2IPP B;  1GLO A;  2C0Y A;  2HXZ A;  2Y6E A;  3HWN A;  3GCB A;  4QBB A;  4W5C A;  3B79 A;  3O0U A;  4K7C A;  3S3R A;  1ME3 A;  4G54 A;  2VHF A;  3RVX A;  1IWD A;  1STF E;  2DCD A;  1KFX L;  2H7J A;  1MEM A;  4AXM A;  1YT7 A;  3KKU A;  1JQP A;  3LXS A;  4I04 A;  1F29 A;  4QRV A;  1BQI A;  1DF0 A;  1CJL A;  1QMY A;  3N3K A;  3BC3 A;  4MSX A;  3CH2 X;  1PXV A;  3MHH A;  2ACT A;  2F1G A;  3F75 A;  2FT2 A;  2AYO A;  2FQ9 A;  3DF0 A;  1AU2 A;  4AXL A;  3BWK A;  1EWL A;  2DC7 A;  2HH5 A;  4YYU A;  5K16 A;  1MIR A;  4X6I A;  2AUZ A;  3P5U A;  1TU6 A;  3ZUA A;  1W5R A;  4Q8G A;  1U9V A;  4CDC B;  1ME4 A;  3IV2 A;  3MHS A;  3QSD A;  4MZO A;  1PBH A;  1Y08 A;  5EGW A;  4W5B A;  2JQF R;  1NQC A;  4I07 A;  4PP2 E;  3USV A;  1TLO A;  1Y4H A;  3CBK A;  4X6H A;  5A24 A;  4W4U A;  4BGF A;  2R9F A;  2VHS A;  3CH3 X;  3QJ3 A;  2G8E A;  4NV7 A;  4BQV A;  5JA7 A;  2GHU A;  3BOW A;  2P86 A;  3H8B A;  1PPO A;  3KW9 A;  2XU5 A;  1PCI A;  4MZS A;  1GCB A;  4FJC A;  4RY2 A;  1W6F A;  3K24 A;  1QDQ A;  3U8E A;  2FRQ A;  1E2T A;  2DCB A;  3TNX A;  1ICF A;  3D6S A;  3P5W A;  3KWZ A;  4BS6 A;  3KX1 A;  3RVV A;  1YK7 A;  3N3G A;  1MS6 A;  1CVZ A;  4YYR A;  1U9W A;  3E1Z B;  2DCC A;  2VFB A;  2OZ2 A;  9PAP A;  4PAD A;  3P5V A;  2YJ2 A;  4N79 A;  3KWB X;  2DCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...