4X6HA

Development of n-(functionalized benzoyl)-homocycloleucyl-glycinonitriles as potent cathepsin k inhibitors.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Development of N-(Functionalized benzoyl)-homocycloleucyl-glycinonitriles as Potent Cathepsin K Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4x6hA00
6PADA 1EWMA 3QT4A 1U5IA 4YYWA 5F02A 1Y08A 1MHWA 1QDQA 5CHTA 1AYUA 2OP3A 2IPPB 3I3TA 3BPMA 2JQFR 1AU3A 2P0RA 1DF0A 4OEMA 4CDEB 4PADA 2FRAA 1CS8A 4AXLA 3N3GA 1A6RA 2G8JA 1IWDA 2FYEA 4QRVA 3OF9A 3F5VA 2F1GA 1BP4A 4W4UA 4PP2E 3PNRA 4WA6A 3MHSA 1NB5A 1CPJA 4MSXA 5JA7A 2HHNA 2R9MA 2YJCA 4DMYA 4BQVA 1KFXL 2DC8A 3KWBX 3IMAA 1YK7A 2R9NA 2DZZA 4X6IA 3KWZA 1PXVA 2FQ9A 1ATKA 2DJFB 2ARYA 1MIRA 1GLOA 3BWKA 1MDWA 3PBHA 1CV8A 3TNXA 2G6DA 2CIOA 1PIPA 2P86A 1CJLA 2FUDA 1F2CA 4KLBA 1SP4B 2DCCA 1Q6KA 2FRQA 2O6XA 1PE6A 1ITOA 1NB3A 2DCDA 4Q8HA 2AUXA 2H7JA 3H6SA 3H89A 1GCBA 3KX1A 3OVZA 3KFQA 1EWOA 2B1MA 3P5UA 8PCHA 2GHUA 2NQIA 3AI8A 1YK8A 3QSDA 2F7DA 1CVZA 1M6DA 1KXRA 3N3KA 1JQPA 2ACTA 2FTDA 1VJVA 3H8CA 5PADA 1AU2A 1NPZA 1NLJA 1TU6A 4YVAA 2DC6A 4QBBA 2G8EA 4OELA 2XU3A 1F2BA 3PW3A 2CB5A 1EWLA 3O1GA 2DJGB 3LFYA 3OISA 4FK5A 2C0YA 3C9EA 3BC3A 3USVA 3BCNA 3RVWA 2GFOA 3P5WA 1PBHA 2G7YA 1PPPA 3WXGA 1TL9A 3IEJA 2AUZA 4PI3A 5K16A 3CH3X 4YYUA 2FT2A 3BPFA 3RVVA 2YJ9A 3O0UA 2ATOA 5EGWA 2VHSA 3QJ3A 2E00A 2E01A 4N8WA 1CSBB 1ZIVA 3IUTA 1EF7A 3M99A 2AYOA 2AU1A 3U8EA 1U9XA 4CDCB 3P5VA 1O0EA 2BDZA 4BS6A 5EF4A 3S3RA 3IOQA 1GMYA 2PREA 4QRXA 3F75A 2XU5A 2NQGA 1MEMA 1YT7A 4CDFB 1STFE 1AU4A 2PNSA 4YYVA 5A24A 1U9WA 4I04A 3GCBA 2AYNA 5J94A 1PPDA 9PAPA 2WBFX 3MHHA 1U9VA 3OF8A 4N79A 1NQCA 4MZOA 2DC7A 1ME4A 3WXFA 3N4CA 2Y6EA 1F2AA 2R9OA 3HHIA 1K3BB 5CVNB 2R6NA 4XR7A 4MZSA 3RVXA 3H7DA 1Y4HA 1SNKA 1XKGA 3DF0A 4BSQA 1F29A 1KFUL 3I06A 4PP1A 1POPA 2E03A 1BY8A 3BOWA 3OVXA 3K9MA 2DCBA 1HUCB 4I07A 1DEUA 1U9QX 4P6GA 3B79A 1BGOA 2E02A 2VHFA 2IBIA 3KKUA 1QXPA 2B1NA 1YVBA 5JH3A 3HD3A 2HXZA 3KW9A 2HD5A 1GECE 2PBHA 4N4ZA 2R9FA 3CBKA 1MS6A 4DMXA 4Q8GA 2OULA 4YYRA 3KSEA 2AS8A 1AYWA 4W5BA 1THEA 1AIMA 2AIMA 4CDDB 4K7CA 2DZYA 2P7UA 3P5XA 2FO5A 3MORA 2AVWA 1PCIA 4YYQA 2DC9A 4BPVA 1AECA 1FH0A 3ERVA 3HHAA 2PADA 3CH2X 1ZCMA 2YJBA 2OZ2A 1X9YA 3K24A 3IHPA 4W5CA 1CTEA 4G54A 4YYSA 1CQDA 4FIPA 3HWNA 4QH6A 4X6JA 3PDFA 4AXMA 2Y5BA 3D6SA 2DCAA 4RY2A 4I05A 1S4VA 4YV8A 3LXSA 3H8BA 5CVOB 3CBJA 3IV2A 4FJCA 7PCKA 1YALA 1KHQA 1QMYA 3NHEA 3K8UA 4P6EA 1TLOA 4X6HA 2XU1A 1KHPA 2HH5A 3V6CA 4XUIA 1MEGA 1ME3A 1NL6A 3S3QA 1CB5A 3V6EA 5CVMA 1PPOA 1BQIA 1PPNA 2BDLA 1PADA 1QOLA 2YJ2A 2XU4A 3WXEA 1EWPA 1VSNA 1AYVA 3E1ZB 2NQDB 3MTNA 4BS5A 2JQGR 5CHVA 2YJ8A 2R9CA 4HWYA 3ZUAA 4ZUXU 1AU0A 4QRGA 1ICFA 2NQAA 4CZWA 5FPWA
chains in the Genus database with same CATH superfamily
3OQCA 6PADA 1EWMA 4ZTBA 3TRKA 3QT4A 1U5IA 4YYWA 5F02A 1Y08A 1MHWA 1QDQA 5CHTA 1AYUA 2OP3A 2IPPB 3I3TA 3BPMA 4D8BA 2JQFR 1AU3A 2P0RA 1DF0A 4OEMA 5EZSA 4CDEB 4PADA 2FRAA 1CS8A 4AXLA 3N3GA 1A6RA 2G8JA 1IWDA 2FYEA 4QRVA 3BBAA 4RF1A 3OF9A 3F5VA 2F1GA 1BP4A 4W4UA 4PP2E 3BB7A 3PNRA 4WA6A 3MHSA 1NB5A 2BU3A 1CPJA 4MSXA 5JA7A 2HHNA 2R9MA 2YJCA 4DMYA 4BQVA 1KFXL 2DC8A 3KWBX 3IMAA 1YK7A 2R9NA 1UKFA 2DZZA 4X6IA 3KWZA 1PXVA 4P16A 2FQ9A 1ATKA 2DJFB 2ARYA 1MIRA 4RNAA 1GLOA 3BWKA 1MDWA 3PBHA 1CV8A 3TNXA 4OVZA 2G6DA 2CIOA 1PIPA 2P86A 1CJLA 2FUDA 4BOSA 1F2CA 1PVJA 3IFUA 4KLBA 1SP4B 3W30A 2DCCA 1Q6KA 2FRQA 2O6XA 1PE6A 1ITOA 1NB3A 2DCDA 3PRPA 4RF0A 4IP3A 4Q8HA 2AUXA 2H7JA 3H6SA 3H89A 1GCBA 3KX1A 3OVZA 2UZJA 3KFQA 1EWOA 2B1MA 3P5UA 8PCHA 2GHUA 2NQIA 3AI8A 1YK8A 3QSDA 2F7DA 1CVZA 1M6DA 1KXRA 3PSEA 3N3KA 1JQPA 2ACTA 2FTDA 1VJVA 2AGAA 3H8CA 5PADA 1AU2A 1NPZA 2FE8A 1NLJA 1TU6A 5KO3A 4YVAA 2DC6A 4QBBA 2G8EA 4OELA 4HXDB 2XU3A 3W31A 1F2BA 3PW3A 2CB5A 1EWLA 3O1GA 2DJGB 3TMPA 3LFYA 3OISA 4FK5A 2C0YA 3C9EA 3MTVA 4WURA 3O65A 3BC3A 3USVA 3RNVA 3BCNA 4IUMA 3RVWA 2GFOA 3P5WA 1PBHA 2G7YA 1PPPA 3WXGA 1TL9A 3IEJA 2AUZA 4PI3A 5K16A 3CH3X 4YYUA 4M0WA 4XZXA 2FT2A 3BPFA 3RVVA 2YJ9A 3O0UA 3C0RA 2ATOA 5EGWA 2VHSA 3QJ3A 2E00A 2E01A 4N8WA 1CSBB 4BOPA 1ZIVA 3IUTA 1EF7A 1DKIA 3M99A 2AYOA 2AU1A 2BTWB 3U8EA 4MI7A 1U9XA 4CDCB 5E6JA 3P5VA 1O0EA 2BDZA 4BS6A 5EF4A 3S3RA 3IOQA 1GMYA 2PREA 4BOQA 4QRXA 3F75A 2XU5A 2NQGA 1MEMA 1YT7A 3PHXA 4CDFB 3B21A 1STFE 1AU4A 2PNSA 4YYVA 5A24A 1U9WA 2J7QA 4I04A 4BOZA 3GCBA 2AYNA 3PRMA 1PPDA 5J94A 9PAPA 2WBFX 3MHHA 4REZA 1U9VA 3OF8A 4D8EA 4N79A 1NQCA 4MZOA 2DC7A 2HWKA 2DOSA 1ME4A 3WXFA 3N4CA 2Y6EA 1F2AA 2R9OA 3HHIA 1K3BB 4MM3B 5CVNB 2R6NA 4XR7A 4MZSA 3RVXA 3H7DA 1Y4HA 1SNKA 1XKGA 3MP2A 3DF0A 4BSQA 1F29A 1KFUL 3I06A 4PP1A 1POPA 2E03A 1BY8A 3BOWA 4BOUA 3OVXA 3K9MA 2DCBA 1HUCB 4I07A 4OW0A 1DEUA 1U9QX 4P6GA 3B79A 1BGOA 2E02A 2VHFA 2IBIA 3KKUA 1QXPA 2B1NA 3PHWA 1YVBA 4GUAA 5JH3A 3HD3A 2HXZA 5EZQA 3KW9A 2HD5A 1GECE 2PBHA 4N4ZA 2R9FA 3CBKA 1MS6A 4DMXA 4Q8GA 3MJ5A 2OULA 4YYRA 3KSEA 2AS8A 1AYWA 4PT5A 4W5BA 1THEA 3E9SA 1AIMA 2J7QC 2AIMA 4CDDB 4K7CA 2DZYA 5JZEA 2P7UA 3P5XA 4OVZB 2FO5A 3MORA 2AVWA 1PCIA 4YYQA 2DC9A 4BPVA 1AECA 1FH0A 3ERVA 3HHAA 2PADA 3CH2X 1ZCMA 1YZBA 2JTCA 2JRIA 2YJBA 2OZ2A 1X9YA 3K24A 3IHPA 4W5CA 1CTEA 4G54A 2Z84A 3PT2A 4YYSA 1CQDA 4FIPA 3HWNA 4QH6A 4X6JA 3PDFA 4AXMA 2Y5BA 3D6SA 2DCAA 4RY2A 4A5UA 4I05A 1S4VA 4YV8A 3LXSA 3H8BA 3BY4A 5CVOB 3CBJA 3PHUA 3IV2A 4FJCA 7PCKA 2BTWA 1YALA 1KHQA 1QMYA 3NHEA 3K8UA 4P6EA 1TLOA 4X6HA 2XU1A 1KHPA 2HH5A 3V6CA 4XUIA 4D8IA 1MEGA 1ME3A 1NL6A 3S3QA 1CB5A 3V6EA 5CVMA 1PPOA 3ZNHA 1BQIA 1PPNA 2BDLA 1PADA 1QOLA 2YJ2A 2XU4A 3WXEA 4R3DA 1EWPA 1VSNA 1AYVA 3E1ZB 2NQDB 3MTNA 4BS5A 4RKXA 2JQGR 5CHVA 2YJ8A 2R9CA 4HWYA 3ZUAA 4ZUXU 1AU0A 4QRGA 1ICFA 2NQAA 4CZWA 5FPWA
chains in the Genus database with same CATH topology
6PADA 1EWMA 3QT4A 1U5IA 4YYWA 5F02A 1Y08A 1MHWA 1QDQA 5CHTA 1AYUA 3LTWA 2OP3A 2IPPB 3I3TA 3BPMA 2JQFR 1AU3A 2P0RA 1DF0A 4OEMA 4CDEB 4PADA 2FRAA 1CS8A 4AXLA 3N3GA 1A6RA 2G8JA 1IWDA 2FYEA 4QRVA 3OF9A 3F5VA 2F1GA 1BP4A 4W4UA 4PP2E 3PNRA 4WA6A 3MHSA 1NB5A 1CPJA 4MSXA 5JA7A 2HHNA 2R9MA 2YJCA 4DMYA 4BQVA 1KFXL 2DC8A 3KWBX 3IMAA 1YK7A 2R9NA 2DZZA 4X6IA 3KWZA 1PXVA 2FQ9A 1ATKA 2DJFB 2ARYA 1MIRA 1GLOA 3BWKA 1MDWA 3PBHA 1CV8A 3TNXA 2G6DA 2CIOA 1PIPA 2P86A 1CJLA 2FUDA 1F2CA 4KLBA 1SP4B 2DCCA 1Q6KA 2FRQA 2O6XA 1PE6A 1ITOA 1NB3A 2DCDA 3D9WA 4Q8HA 2AUXA 2H7JA 3H6SA 3H89A 1GCBA 1W5RA 3KX1A 3OVZA 3KFQA 1EWOA 2B1MA 3P5UA 8PCHA 2GHUA 2NQIA 3AI8A 1YK8A 3QSDA 2F7DA 1CVZA 1M6DA 1KXRA 3N3KA 1JQPA 2ACTA 2FTDA 1VJVA 3H8CA 5PADA 1AU2A 1NPZA 1NLJA 1TU6A 4YVAA 2DC6A 4QBBA 2G8EA 4OELA 2XU3A 1F2BA 3PW3A 2CB5A 1EWLA 3O1GA 2DJGB 3LFYA 3OISA 4FK5A 2C0YA 3C9EA 3BC3A 3USVA 3BCNA 3RVWA 2GFOA 1E2TA 3P5WA 1PBHA 2G7YA 1PPPA 4NV7A 3WXGA 1TL9A 3IEJA 2AUZA 4PI3A 5K16A 3CH3X 4YYUA 2FT2A 1W4TA 3BPFA 3RVVA 2YJ9A 3O0UA 2ATOA 5EGWA 2VHSA 3QJ3A 2E00A 2E01A 4GUZA 4N8WA 1CSBB 1GX3A 1ZIVA 3IUTA 1EF7A 3M99A 2AYOA 2AU1A 3U8EA 1U9XA 4CDCB 3P5VA 1O0EA 2BDZA 4BS6A 5EF4A 3S3RA 3IOQA 1GMYA 2PREA 4QRXA 3F75A 2XU5A 2NQGA 1MEMA 1YT7A 4CDFB 1STFE 1W6FA 1AU4A 2PNSA 4YYVA 5A24A 1U9WA 4I04A 3GCBA 2AYNA 5J94A 1PPDA 9PAPA 2WBFX 3MHHA 1U9VA 3OF8A 4N79A 1NQCA 4MZOA 2DC7A 1ME4A 3WXFA 3N4CA 2Y6EA 1F2AA 2R9OA 3HHIA 1K3BB 5CVNB 2R6NA 4XR7A 4MZSA 3RVXA 3H7DA 1Y4HA 1SNKA 1XKGA 3DF0A 4BSQA 1F29A 1KFUL 3I06A 4PP1A 1POPA 2E03A 1BY8A 3BOWA 3OVXA 3K9MA 2DCBA 1HUCB 4I07A 1DEUA 1U9QX 4P6GA 3B79A 1BGOA 2E02A 2VHFA 2IBIA 3KKUA 1QXPA 2B1NA 1YVBA 2BSZA 5JH3A 3HD3A 2HXZA 3KW9A 2HD5A 1GECE 2PBHA 4N4ZA 2R9FA 3CBKA 1MS6A 4DMXA 4Q8GA 2OULA 4NV8A 4YYRA 3KSEA 2AS8A 1AYWA 4W5BA 1THEA 1AIMA 2AIMA 4CDDB 4K7CA 2DZYA 2P7UA 3P5XA 2FO5A 3MORA 2AVWA 1PCIA 4YYQA 2DC9A 2VFBA 4BPVA 1AECA 1FH0A 3ERVA 3HHAA 2PADA 3CH2X 1ZCMA 2YJBA 2OZ2A 4BGFA 1X9YA 3K24A 3IHPA 4W5CA 1CTEA 4G54A 4YYSA 1CQDA 4FIPA 3HWNA 4QH6A 4X6JA 4C5PA 3PDFA 4B55A 4AXMA 2Y5BA 3D6SA 2DCAA 4RY2A 4I05A 1S4VA 4YV8A 3LXSA 3H8BA 5CVOB 3CBJA 3IV2A 4FJCA 7PCKA 1YALA 1KHQA 1QMYA 3NHEA 3K8UA 4P6EA 1TLOA 4X6HA 2XU1A 1KHPA 2HH5A 3V6CA 4XUIA 2VFCA 1MEGA 1ME3A 1NL6A 3S3QA 1CB5A 3V6EA 5CVMA 1PPOA 1BQIA 1PPNA 2BDLA 1PADA 1QOLA 2YJ2A 2XU4A 3WXEA 1EWPA 1VSNA 1AYVA 3E1ZB 2NQDB 3MTNA 4BS5A 2JQGR 5CHVA 2YJ8A 2R9CA 4HWYA 3ZUAA 4ZUXU 1AU0A 4QRGA 1ICFA 2NQAA 4CZWA 5FPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6PAD A;  1EWM A;  3QT4 A;  1U5I A;  4YYW A;  5F02 A;  1Y08 A;  1MHW A;  1QDQ A;  5CHT A;  1AYU A;  2OP3 A;  2IPP B;  3I3T A;  3BPM A;  2JQF R;  1AU3 A;  2P0R A;  1DF0 A;  4OEM A;  4CDE B;  4PAD A;  2FRA A;  1CS8 A;  4AXL A;  3N3G A;  1A6R A;  2G8J A;  1IWD A;  2FYE A;  4QRV A;  3OF9 A;  3F5V A;  2F1G A;  1BP4 A;  4W4U A;  4PP2 E;  3PNR A;  4WA6 A;  3MHS A;  1NB5 A;  1CPJ A;  4MSX A;  5JA7 A;  2HHN A;  2R9M A;  2YJC A;  4DMY A;  4BQV A;  1KFX L;  2DC8 A;  3KWB X;  3IMA A;  1YK7 A;  2R9N A;  2DZZ A;  4X6I A;  3KWZ A;  1PXV A;  2FQ9 A;  1ATK A;  2DJF B;  2ARY A;  1MIR A;  1GLO A;  3BWK A;  1MDW A;  3PBH A;  1CV8 A;  3TNX A;  2G6D A;  2CIO A;  1PIP A;  2P86 A;  1CJL A;  2FUD A;  1F2C A;  4KLB A;  1SP4 B;  2DCC A;  1Q6K A;  2FRQ A;  2O6X A;  1PE6 A;  1ITO A;  1NB3 A;  2DCD A;  4Q8H A;  2AUX A;  2H7J A;  3H6S A;  3H89 A;  1GCB A;  3KX1 A;  3OVZ A;  3KFQ A;  1EWO A;  2B1M A;  3P5U A;  8PCH A;  2GHU A;  2NQI A;  3AI8 A;  1YK8 A;  3QSD A;  2F7D A;  1CVZ A;  1M6D A;  1KXR A;  3N3K A;  1JQP A;  2ACT A;  2FTD A;  1VJV A;  3H8C A;  5PAD A;  1AU2 A;  1NPZ A;  1NLJ A;  1TU6 A;  4YVA A;  2DC6 A;  4QBB A;  2G8E A;  4OEL A;  2XU3 A;  1F2B A;  3PW3 A;  2CB5 A;  1EWL A;  3O1G A;  2DJG B;  3LFY A;  3OIS A;  4FK5 A;  2C0Y A;  3C9E A;  3BC3 A;  3USV A;  3BCN A;  3RVW A;  2GFO A;  3P5W A;  1PBH A;  2G7Y A;  1PPP A;  3WXG A;  1TL9 A;  3IEJ A;  2AUZ A;  4PI3 A;  5K16 A;  3CH3 X;  4YYU A;  2FT2 A;  3BPF A;  3RVV A;  2YJ9 A;  3O0U A;  2ATO A;  5EGW A;  2VHS A;  3QJ3 A;  2E00 A;  2E01 A;  4N8W A;  1CSB B;  1ZIV A;  3IUT A;  1EF7 A;  3M99 A;  2AYO A;  2AU1 A;  3U8E A;  1U9X A;  4CDC B;  3P5V A;  1O0E A;  2BDZ A;  4BS6 A;  5EF4 A;  3S3R A;  3IOQ A;  1GMY A;  2PRE A;  4QRX A;  3F75 A;  2XU5 A;  2NQG A;  1MEM A;  1YT7 A;  4CDF B;  1STF E;  1AU4 A;  2PNS A;  4YYV A;  5A24 A;  1U9W A;  4I04 A;  3GCB A;  2AYN A;  5J94 A;  1PPD A;  9PAP A;  2WBF X;  3MHH A;  1U9V A;  3OF8 A;  4N79 A;  1NQC A;  4MZO A;  2DC7 A;  1ME4 A;  3WXF A;  3N4C A;  2Y6E A;  1F2A A;  2R9O A;  3HHI A;  1K3B B;  5CVN B;  2R6N A;  4XR7 A;  4MZS A;  3RVX A;  3H7D A;  1Y4H A;  1SNK A;  1XKG A;  3DF0 A;  4BSQ A;  1F29 A;  1KFU L;  3I06 A;  4PP1 A;  1POP A;  2E03 A;  1BY8 A;  3BOW A;  3OVX A;  3K9M A;  2DCB A;  1HUC B;  4I07 A;  1DEU A;  1U9Q X;  4P6G A;  3B79 A;  1BGO A;  2E02 A;  2VHF A;  2IBI A;  3KKU A;  1QXP A;  2B1N A;  1YVB A;  5JH3 A;  3HD3 A;  2HXZ A;  3KW9 A;  2HD5 A;  1GEC E;  2PBH A;  4N4Z A;  2R9F A;  3CBK A;  1MS6 A;  4DMX A;  4Q8G A;  2OUL A;  4YYR A;  3KSE A;  2AS8 A;  1AYW A;  4W5B A;  1THE A;  1AIM A;  2AIM A;  4CDD B;  4K7C A;  2DZY A;  2P7U A;  3P5X A;  2FO5 A;  3MOR A;  2AVW A;  1PCI A;  4YYQ A;  2DC9 A;  4BPV A;  1AEC A;  1FH0 A;  3ERV A;  3HHA A;  2PAD A;  3CH2 X;  1ZCM A;  2YJB A;  2OZ2 A;  1X9Y A;  3K24 A;  3IHP A;  4W5C A;  1CTE A;  4G54 A;  4YYS A;  1CQD A;  4FIP A;  3HWN A;  4QH6 A;  4X6J A;  3PDF A;  4AXM A;  2Y5B A;  3D6S A;  2DCA A;  4RY2 A;  4I05 A;  1S4V A;  4YV8 A;  3LXS A;  3H8B A;  5CVO B;  3CBJ A;  3IV2 A;  4FJC A;  7PCK A;  1YAL A;  1KHQ A;  1QMY A;  3NHE A;  3K8U A;  4P6E A;  1TLO A;  4X6H A;  2XU1 A;  1KHP A;  2HH5 A;  3V6C A;  4XUI A;  1MEG A;  1ME3 A;  1NL6 A;  3S3Q A;  1CB5 A;  3V6E A;  5CVM A;  1PPO A;  1BQI A;  1PPN A;  2BDL A;  1PAD A;  1QOL A;  2YJ2 A;  2XU4 A;  3WXE A;  1EWP A;  1VSN A;  1AYV A;  3E1Z B;  2NQD B;  3MTN A;  4BS5 A;  2JQG R;  5CHV A;  2YJ8 A;  2R9C A;  4HWY A;  3ZUA A;  4ZUX U;  1AU0 A;  4QRG A;  1ICF A;  2NQA A;  4CZW A;  5FPW A; 
#chains in the Genus database with same CATH topology
 3OQC A;  6PAD A;  1EWM A;  4ZTB A;  3TRK A;  3QT4 A;  1U5I A;  4YYW A;  5F02 A;  1Y08 A;  1MHW A;  1QDQ A;  5CHT A;  1AYU A;  2OP3 A;  2IPP B;  3I3T A;  3BPM A;  4D8B A;  2JQF R;  1AU3 A;  2P0R A;  1DF0 A;  4OEM A;  5EZS A;  4CDE B;  4PAD A;  2FRA A;  1CS8 A;  4AXL A;  3N3G A;  1A6R A;  2G8J A;  1IWD A;  2FYE A;  4QRV A;  3BBA A;  4RF1 A;  3OF9 A;  3F5V A;  2F1G A;  1BP4 A;  4W4U A;  4PP2 E;  3BB7 A;  3PNR A;  4WA6 A;  3MHS A;  1NB5 A;  2BU3 A;  1CPJ A;  4MSX A;  5JA7 A;  2HHN A;  2R9M A;  2YJC A;  4DMY A;  4BQV A;  1KFX L;  2DC8 A;  3KWB X;  3IMA A;  1YK7 A;  2R9N A;  1UKF A;  2DZZ A;  4X6I A;  3KWZ A;  1PXV A;  4P16 A;  2FQ9 A;  1ATK A;  2DJF B;  2ARY A;  1MIR A;  4RNA A;  1GLO A;  3BWK A;  1MDW A;  3PBH A;  1CV8 A;  3TNX A;  4OVZ A;  2G6D A;  2CIO A;  1PIP A;  2P86 A;  1CJL A;  2FUD A;  4BOS A;  1F2C A;  1PVJ A;  3IFU A;  4KLB A;  1SP4 B;  3W30 A;  2DCC A;  1Q6K A;  2FRQ A;  2O6X A;  1PE6 A;  1ITO A;  1NB3 A;  2DCD A;  3PRP A;  4RF0 A;  4IP3 A;  4Q8H A;  2AUX A;  2H7J A;  3H6S A;  3H89 A;  1GCB A;  3KX1 A;  3OVZ A;  2UZJ A;  3KFQ A;  1EWO A;  2B1M A;  3P5U A;  8PCH A;  2GHU A;  2NQI A;  3AI8 A;  1YK8 A;  3QSD A;  2F7D A;  1CVZ A;  1M6D A;  1KXR A;  3PSE A;  3N3K A;  1JQP A;  2ACT A;  2FTD A;  1VJV A;  2AGA A;  3H8C A;  5PAD A;  1AU2 A;  1NPZ A;  2FE8 A;  1NLJ A;  1TU6 A;  5KO3 A;  4YVA A;  2DC6 A;  4QBB A;  2G8E A;  4OEL A;  4HXD B;  2XU3 A;  3W31 A;  1F2B A;  3PW3 A;  2CB5 A;  1EWL A;  3O1G A;  2DJG B;  3TMP A;  3LFY A;  3OIS A;  4FK5 A;  2C0Y A;  3C9E A;  3MTV A;  4WUR A;  3O65 A;  3BC3 A;  3USV A;  3RNV A;  3BCN A;  4IUM A;  3RVW A;  2GFO A;  3P5W A;  1PBH A;  2G7Y A;  1PPP A;  3WXG A;  1TL9 A;  3IEJ A;  2AUZ A;  4PI3 A;  5K16 A;  3CH3 X;  4YYU A;  4M0W A;  4XZX A;  2FT2 A;  3BPF A;  3RVV A;  2YJ9 A;  3O0U A;  3C0R A;  2ATO A;  5EGW A;  2VHS A;  3QJ3 A;  2E00 A;  2E01 A;  4N8W A;  1CSB B;  4BOP A;  1ZIV A;  3IUT A;  1EF7 A;  1DKI A;  3M99 A;  2AYO A;  2AU1 A;  2BTW B;  3U8E A;  4MI7 A;  1U9X A;  4CDC B;  5E6J A;  3P5V A;  1O0E A;  2BDZ A;  4BS6 A;  5EF4 A;  3S3R A;  3IOQ A;  1GMY A;  2PRE A;  4BOQ A;  4QRX A;  3F75 A;  2XU5 A;  2NQG A;  1MEM A;  1YT7 A;  3PHX A;  4CDF B;  3B21 A;  1STF E;  1AU4 A;  2PNS A;  4YYV A;  5A24 A;  1U9W A;  2J7Q A;  4I04 A;  4BOZ A;  3GCB A;  2AYN A;  3PRM A;  1PPD A;  5J94 A;  9PAP A;  2WBF X;  3MHH A;  4REZ A;  1U9V A;  3OF8 A;  4D8E A;  4N79 A;  1NQC A;  4MZO A;  2DC7 A;  2HWK A;  2DOS A;  1ME4 A;  3WXF A;  3N4C A;  2Y6E A;  1F2A A;  2R9O A;  3HHI A;  1K3B B;  4MM3 B;  5CVN B;  2R6N A;  4XR7 A;  4MZS A;  3RVX A;  3H7D A;  1Y4H A;  1SNK A;  1XKG A;  3MP2 A;  3DF0 A;  4BSQ A;  1F29 A;  1KFU L;  3I06 A;  4PP1 A;  1POP A;  2E03 A;  1BY8 A;  3BOW A;  4BOU A;  3OVX A;  3K9M A;  2DCB A;  1HUC B;  4I07 A;  4OW0 A;  1DEU A;  1U9Q X;  4P6G A;  3B79 A;  1BGO A;  2E02 A;  2VHF A;  2IBI A;  3KKU A;  1QXP A;  2B1N A;  3PHW A;  1YVB A;  4GUA A;  5JH3 A;  3HD3 A;  2HXZ A;  5EZQ A;  3KW9 A;  2HD5 A;  1GEC E;  2PBH A;  4N4Z A;  2R9F A;  3CBK A;  1MS6 A;  4DMX A;  4Q8G A;  3MJ5 A;  2OUL A;  4YYR A;  3KSE A;  2AS8 A;  1AYW A;  4PT5 A;  4W5B A;  1THE A;  3E9S A;  1AIM A;  2J7Q C;  2AIM A;  4CDD B;  4K7C A;  2DZY A;  5JZE A;  2P7U A;  3P5X A;  4OVZ B;  2FO5 A;  3MOR A;  2AVW A;  1PCI A;  4YYQ A;  2DC9 A;  4BPV A;  1AEC A;  1FH0 A;  3ERV A;  3HHA A;  2PAD A;  3CH2 X;  1ZCM A;  1YZB A;  2JTC A;  2JRI A;  2YJB A;  2OZ2 A;  1X9Y A;  3K24 A;  3IHP A;  4W5C A;  1CTE A;  4G54 A;  2Z84 A;  3PT2 A;  4YYS A;  1CQD A;  4FIP A;  3HWN A;  4QH6 A;  4X6J A;  3PDF A;  4AXM A;  2Y5B A;  3D6S A;  2DCA A;  4RY2 A;  4A5U A;  4I05 A;  1S4V A;  4YV8 A;  3LXS A;  3H8B A;  3BY4 A;  5CVO B;  3CBJ A;  3PHU A;  3IV2 A;  4FJC A;  7PCK A;  2BTW A;  1YAL A;  1KHQ A;  1QMY A;  3NHE A;  3K8U A;  4P6E A;  1TLO A;  4X6H A;  2XU1 A;  1KHP A;  2HH5 A;  3V6C A;  4XUI A;  4D8I A;  1MEG A;  1ME3 A;  1NL6 A;  3S3Q A;  1CB5 A;  3V6E A;  5CVM A;  1PPO A;  3ZNH A;  1BQI A;  1PPN A;  2BDL A;  1PAD A;  1QOL A;  2YJ2 A;  2XU4 A;  3WXE A;  4R3D A;  1EWP A;  1VSN A;  1AYV A;  3E1Z B;  2NQD B;  3MTN A;  4BS5 A;  4RKX A;  2JQG R;  5CHV A;  2YJ8 A;  2R9C A;  4HWY A;  3ZUA A;  4ZUX U;  1AU0 A;  4QRG A;  1ICF A;  2NQA A;  4CZW A;  5FPW A; 
#chains in the Genus database with same CATH homology
 6PAD A;  1EWM A;  3QT4 A;  1U5I A;  4YYW A;  5F02 A;  1Y08 A;  1MHW A;  1QDQ A;  5CHT A;  1AYU A;  3LTW A;  2OP3 A;  2IPP B;  3I3T A;  3BPM A;  2JQF R;  1AU3 A;  2P0R A;  1DF0 A;  4OEM A;  4CDE B;  4PAD A;  2FRA A;  1CS8 A;  4AXL A;  3N3G A;  1A6R A;  2G8J A;  1IWD A;  2FYE A;  4QRV A;  3OF9 A;  3F5V A;  2F1G A;  1BP4 A;  4W4U A;  4PP2 E;  3PNR A;  4WA6 A;  3MHS A;  1NB5 A;  1CPJ A;  4MSX A;  5JA7 A;  2HHN A;  2R9M A;  2YJC A;  4DMY A;  4BQV A;  1KFX L;  2DC8 A;  3KWB X;  3IMA A;  1YK7 A;  2R9N A;  2DZZ A;  4X6I A;  3KWZ A;  1PXV A;  2FQ9 A;  1ATK A;  2DJF B;  2ARY A;  1MIR A;  1GLO A;  3BWK A;  1MDW A;  3PBH A;  1CV8 A;  3TNX A;  2G6D A;  2CIO A;  1PIP A;  2P86 A;  1CJL A;  2FUD A;  1F2C A;  4KLB A;  1SP4 B;  2DCC A;  1Q6K A;  2FRQ A;  2O6X A;  1PE6 A;  1ITO A;  1NB3 A;  2DCD A;  3D9W A;  4Q8H A;  2AUX A;  2H7J A;  3H6S A;  3H89 A;  1GCB A;  1W5R A;  3KX1 A;  3OVZ A;  3KFQ A;  1EWO A;  2B1M A;  3P5U A;  8PCH A;  2GHU A;  2NQI A;  3AI8 A;  1YK8 A;  3QSD A;  2F7D A;  1CVZ A;  1M6D A;  1KXR A;  3N3K A;  1JQP A;  2ACT A;  2FTD A;  1VJV A;  3H8C A;  5PAD A;  1AU2 A;  1NPZ A;  1NLJ A;  1TU6 A;  4YVA A;  2DC6 A;  4QBB A;  2G8E A;  4OEL A;  2XU3 A;  1F2B A;  3PW3 A;  2CB5 A;  1EWL A;  3O1G A;  2DJG B;  3LFY A;  3OIS A;  4FK5 A;  2C0Y A;  3C9E A;  3BC3 A;  3USV A;  3BCN A;  3RVW A;  2GFO A;  1E2T A;  3P5W A;  1PBH A;  2G7Y A;  1PPP A;  4NV7 A;  3WXG A;  1TL9 A;  3IEJ A;  2AUZ A;  4PI3 A;  5K16 A;  3CH3 X;  4YYU A;  2FT2 A;  1W4T A;  3BPF A;  3RVV A;  2YJ9 A;  3O0U A;  2ATO A;  5EGW A;  2VHS A;  3QJ3 A;  2E00 A;  2E01 A;  4GUZ A;  4N8W A;  1CSB B;  1GX3 A;  1ZIV A;  3IUT A;  1EF7 A;  3M99 A;  2AYO A;  2AU1 A;  3U8E A;  1U9X A;  4CDC B;  3P5V A;  1O0E A;  2BDZ A;  4BS6 A;  5EF4 A;  3S3R A;  3IOQ A;  1GMY A;  2PRE A;  4QRX A;  3F75 A;  2XU5 A;  2NQG A;  1MEM A;  1YT7 A;  4CDF B;  1STF E;  1W6F A;  1AU4 A;  2PNS A;  4YYV A;  5A24 A;  1U9W A;  4I04 A;  3GCB A;  2AYN A;  5J94 A;  1PPD A;  9PAP A;  2WBF X;  3MHH A;  1U9V A;  3OF8 A;  4N79 A;  1NQC A;  4MZO A;  2DC7 A;  1ME4 A;  3WXF A;  3N4C A;  2Y6E A;  1F2A A;  2R9O A;  3HHI A;  1K3B B;  5CVN B;  2R6N A;  4XR7 A;  4MZS A;  3RVX A;  3H7D A;  1Y4H A;  1SNK A;  1XKG A;  3DF0 A;  4BSQ A;  1F29 A;  1KFU L;  3I06 A;  4PP1 A;  1POP A;  2E03 A;  1BY8 A;  3BOW A;  3OVX A;  3K9M A;  2DCB A;  1HUC B;  4I07 A;  1DEU A;  1U9Q X;  4P6G A;  3B79 A;  1BGO A;  2E02 A;  2VHF A;  2IBI A;  3KKU A;  1QXP A;  2B1N A;  1YVB A;  2BSZ A;  5JH3 A;  3HD3 A;  2HXZ A;  3KW9 A;  2HD5 A;  1GEC E;  2PBH A;  4N4Z A;  2R9F A;  3CBK A;  1MS6 A;  4DMX A;  4Q8G A;  2OUL A;  4NV8 A;  4YYR A;  3KSE A;  2AS8 A;  1AYW A;  4W5B A;  1THE A;  1AIM A;  2AIM A;  4CDD B;  4K7C A;  2DZY A;  2P7U A;  3P5X A;  2FO5 A;  3MOR A;  2AVW A;  1PCI A;  4YYQ A;  2DC9 A;  2VFB A;  4BPV A;  1AEC A;  1FH0 A;  3ERV A;  3HHA A;  2PAD A;  3CH2 X;  1ZCM A;  2YJB A;  2OZ2 A;  4BGF A;  1X9Y A;  3K24 A;  3IHP A;  4W5C A;  1CTE A;  4G54 A;  4YYS A;  1CQD A;  4FIP A;  3HWN A;  4QH6 A;  4X6J A;  4C5P A;  3PDF A;  4B55 A;  4AXM A;  2Y5B A;  3D6S A;  2DCA A;  4RY2 A;  4I05 A;  1S4V A;  4YV8 A;  3LXS A;  3H8B A;  5CVO B;  3CBJ A;  3IV2 A;  4FJC A;  7PCK A;  1YAL A;  1KHQ A;  1QMY A;  3NHE A;  3K8U A;  4P6E A;  1TLO A;  4X6H A;  2XU1 A;  1KHP A;  2HH5 A;  3V6C A;  4XUI A;  2VFC A;  1MEG A;  1ME3 A;  1NL6 A;  3S3Q A;  1CB5 A;  3V6E A;  5CVM A;  1PPO A;  1BQI A;  1PPN A;  2BDL A;  1PAD A;  1QOL A;  2YJ2 A;  2XU4 A;  3WXE A;  1EWP A;  1VSN A;  1AYV A;  3E1Z B;  2NQD B;  3MTN A;  4BS5 A;  2JQG R;  5CHV A;  2YJ8 A;  2R9C A;  4HWY A;  3ZUA A;  4ZUX U;  1AU0 A;  4QRG A;  1ICF A;  2NQA A;  4CZW A;  5FPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...