2OP3A

The structure of cathepsin s with a novel 2-arylphenoxyacetaldehyde inhibitor derived by the substrate activity screening (sas) method
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Characterization and optimization of selective, nonpeptidic inhibitors of cathepsin S with an unprecedented binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2op3A00
2AIMA 2H7JA 2B1MA 1QXPA 1CS8A 1MEGA 3BWKA 4CDEB 3IEJA 2OULA 2JQGR 4Q8HA 4AXMA 1KHQA 3P5VA 4BQVA 2DC6A 1X9YA 3BCNA 2PNSA 1PPNA 4I07A 3ERVA 3IUTA 2CB5A 3ZUAA 3OVZA 3H7DA 3OISA 5CVOB 4CZWA 3QJ3A 3PW3A 2YJ8A 3KWZA 4ZUXU 1BP4A 2R9FA 1AU3A 2PREA 3BPFA 3K8UA 4N4ZA 1CVZA 3WXEA 1STFE 1AU4A 3KFQA 3OF9A 4P6EA 1NL6A 2YJCA 1F2CA 1K3BB 3BPMA 1YALA 1DEUA 3CBKA 1DF0A 4XR7A 1YVBA 2DC8A 4MZOA 5J94A 3OF8A 4W5BA 5F02A 4FIPA 4OEMA 3IOQA 2AUXA 1AU0A 4P6GA 3P5UA 1YK7A 2R9MA 4Q8GA 3RVXA 3WXGA 1Y08A 3H8BA 1U5IA 4PP1A 3H6SA 1GCBA 2ACTA 4QRXA 2HHNA 3CBJA 1KHPA 5JA7A 4X6HA 4BSQA 1YT7A 2E01A 4XUIA 4RY2A 2DCAA 2DZZA 4PADA 2C0YA 5K16A 2R9NA 3HWNA 4KLBA 4YVAA 1PE6A 4OELA 6PADA 3HHAA 4PI3A 2G7YA 2OP3A 3I06A 3K9MA 1MEMA 1A6RA 3S3QA 1ME4A 2XU1A 4HWYA 3CH3X 1ATKA 3E1ZB 2NQIA 1ZIVA 2G6DA 1CQDA 2HH5A 3BC3A 5CHVA 4AXLA 3F5VA 1CB5A 1MHWA 3QSDA 2DZYA 4FJCA 2ATOA 3PBHA 3CH2X 3N4CA 2YJBA 1CSBB 1CJLA 3V6CA 2G8JA 4CDDB 1PPOA 1PBHA 1ME3A 2XU4A 4YV8A 2NQGA 2IBIA 5EGWA 2AS8A 4YYQA 4FK5A 1VSNA 2BDZA 2E03A 4YYWA 2Y6EA 1EWMA 4MSXA 2R6NA 2AYOA 5CHTA 2AYNA 3O1GA 1NPZA 3USVA 2P86A 4X6JA 2VHFA 2P0RA 1SP4B 2XU5A 3PNRA 2ARYA 1CTEA 1POPA 3K24A 1NQCA 3AI8A 1PPPA 4K7CA 4N79A 4YYRA 3BOWA 1S4VA 1PXVA 3KWBX 4YYSA 1QMYA 2IPPB 5FPWA 4N8WA 1ITOA 3HHIA 3MHSA 5PADA 2DCDA 2DC7A 3N3KA 8PCHA 2F7DA 1M6DA 1BGOA 1THEA 3KW9A 1AIMA 1BQIA 2P7UA 2HD5A 2WBFX 2GFOA 2R9CA 2DCBA 4PP2E 1GMYA 3DF0A 2F1GA 2BDLA 1EWPA 5CVNB 1U9XA 1AU2A 1SNKA 2YJ9A 1EWOA 1BY8A 3RVWA 1NB3A 3N3GA 3GCBA 1TU6A 2YJ2A 4W4UA 3TNXA 1MDWA 3B79A 1PIPA 3I3TA 3H89A 2AUZA 2DC9A 3M99A 1YK8A 1TL9A 2PBHA 3D6SA 2Y5BA 7PCKA 3KX1A 3QT4A 1HUCB 1TLOA 2FUDA 2FTDA 3F75A 1IWDA 2PADA 3NHEA 2JQFR 2FYEA 3P5XA 4YYUA 3WXFA 2FRAA 3S3RA 1GECE 3MORA 2O6XA 1KFUL 2FO5A 4DMYA 1EWLA 4CDCB 1CV8A 3LFYA 4QRVA 3LXSA 3KKUA 1AYWA 1KXRA 3PDFA 2AU1A 1EF7A 2DJFB 4WA6A 2XU3A 2B1NA 4BS6A 4DMXA 4W5CA 1Q6KA 1NLJA 3C9EA 2HXZA 1XKGA 1MIRA 1CPJA 2FT2A 4X6IA 4CDFB 1AECA 2AVWA 2E00A 3HD3A 2DJGB 1Y4HA 1PPDA 1JQPA 1PADA 5CVMA 4QH6A 2NQDB 1F2AA 4YYVA 1F2BA 2NQAA 4G54A 1ICFA 2G8EA 3P5WA 2FQ9A 2CIOA 1FH0A 4MZSA 2E02A 1O0EA 1AYVA 1PCIA 9PAPA 3MTNA 1NB5A 3H8CA 1U9WA 1VJVA 4I04A 3U8EA 1U9VA 2DCCA 1ZCMA 2GHUA 3O0UA 3V6EA 1QDQA 1MS6A 2FRQA 4BS5A 1F29A 3MHHA 4I05A 3RVVA 3IV2A 3IHPA 2VHSA 1KFXL 3IMAA 5A24A 5JH3A 5EF4A 1AYUA 1GLOA 2OZ2A 4BPVA 2R9OA 3OVXA 4QRGA 1U9QX 3KSEA 1QOLA 4QBBA
chains in the Genus database with same CATH superfamily
2AIMA 2H7JA 2B1MA 1QXPA 1CS8A 2HWKA 3MJ5A 1MEGA 3BWKA 4CDEB 3IEJA 2OULA 2JQGR 4Q8HA 4AXMA 1KHQA 3BB7A 3P5VA 4R3DA 4BQVA 2DC6A 1X9YA 3BCNA 2PNSA 1PPNA 4I07A 3ERVA 3IUTA 2CB5A 3ZUAA 3OVZA 3H7DA 3OISA 5CVOB 4CZWA 3E9SA 3QJ3A 3PW3A 2YJ8A 2FE8A 3KWZA 4ZUXU 1BP4A 2R9FA 1AU3A 2PREA 3BPFA 3K8UA 4HXDB 4N4ZA 1CVZA 3WXEA 1STFE 1AU4A 3KFQA 5KO3A 3OF9A 4P6EA 1NL6A 2YJCA 1F2CA 1K3BB 3BPMA 1YALA 1DEUA 3CBKA 4IUMA 1DF0A 4XR7A 2JRIA 1YVBA 2DC8A 4MZOA 5J94A 3OF8A 4W5BA 5F02A 4FIPA 4OEMA 4REZA 4A5UA 3IOQA 2AUXA 1AU0A 4P6GA 3P5UA 1YK7A 2R9MA 4Q8GA 3RVXA 3WXGA 1Y08A 3H8BA 1U5IA 4PP1A 2UZJA 3H6SA 1GCBA 2ACTA 4QRXA 2HHNA 3CBJA 1KHPA 5JA7A 4X6HA 4BSQA 3PHUA 1YT7A 2E01A 4XUIA 4RY2A 3PRPA 2DCAA 2DZZA 3RNVA 4PADA 2C0YA 4MI7A 5K16A 2R9NA 3HWNA 4KLBA 4YVAA 1PE6A 4OELA 4OVZB 6PADA 3HHAA 4PI3A 2G7YA 2OP3A 3I06A 3K9MA 1MEMA 4RF1A 1A6RA 3S3QA 1ME4A 4GUAA 2XU1A 3W30A 4HWYA 3CH3X 1ATKA 3E1ZB 3PT2A 2NQIA 1ZIVA 2G6DA 1CQDA 2HH5A 1UKFA 3BC3A 5CHVA 4AXLA 3F5VA 1CB5A 1MHWA 3QSDA 2DZYA 4FJCA 2ATOA 3PBHA 3CH2X 3N4CA 2YJBA 1CSBB 1CJLA 3V6CA 2G8JA 4CDDB 1PPOA 1PBHA 1ME3A 2BTWA 4D8IA 2XU4A 2Z84A 4YV8A 3ZNHA 3OQCA 5EZSA 2NQGA 2IBIA 5EGWA 2AS8A 4YYQA 4FK5A 1VSNA 2BDZA 2E03A 4YYWA 2Y6EA 1EWMA 4MSXA 2R6NA 2AYOA 3TMPA 5CHTA 2AYNA 3PHXA 3O1GA 1NPZA 3USVA 2P86A 4X6JA 2VHFA 2P0RA 4ZTBA 1SP4B 3PHWA 2XU5A 3PNRA 2ARYA 1CTEA 3O65A 5JZEA 1POPA 3K24A 1NQCA 3AI8A 1PPPA 4K7CA 4N79A 4YYRA 3MP2A 4P16A 3BOWA 1S4VA 1PXVA 3KWBX 4YYSA 1QMYA 2IPPB 3BY4A 5FPWA 4N8WA 1ITOA 4MM3B 2J7QA 3HHIA 3MHSA 5PADA 2J7QC 4PT5A 2DCDA 2DC7A 3N3KA 8PCHA 4BOUA 2F7DA 1M6DA 1BGOA 1THEA 2DOSA 3KW9A 1AIMA 1BQIA 2P7UA 2HD5A 2WBFX 2GFOA 2R9CA 2DCBA 4PP2E 1GMYA 3DF0A 2F1GA 2BDLA 1EWPA 5CVNB 1U9XA 5E6JA 1AU2A 1SNKA 2YJ9A 3BBAA 1EWOA 1BY8A 1PVJA 3RVWA 1NB3A 3N3GA 4D8BA 3GCBA 4BOPA 1TU6A 2YJ2A 4W4UA 3TNXA 1MDWA 3B79A 1PIPA 3I3TA 4OW0A 4WURA 3H89A 5EZQA 2AUZA 2DC9A 3M99A 1YK8A 1TL9A 2PBHA 3D6SA 3IFUA 2Y5BA 7PCKA 3KX1A 3QT4A 1HUCB 1TLOA 2FUDA 2FTDA 3F75A 4D8EA 1IWDA 2PADA 3NHEA 2JQFR 2FYEA 3P5XA 4YYUA 3WXFA 2FRAA 3S3RA 1GECE 3MORA 2O6XA 1KFUL 2FO5A 4DMYA 1EWLA 4CDCB 1CV8A 3LFYA 4QRVA 3LXSA 3KKUA 1AYWA 1KXRA 3PRMA 3PSEA 3PDFA 2AU1A 1EF7A 2DJFB 4WA6A 2XU3A 2B1NA 4BS6A 4DMXA 4W5CA 1Q6KA 1NLJA 3C9EA 2HXZA 1XKGA 1MIRA 1CPJA 3MTVA 2JTCA 4IP3A 2FT2A 4X6IA 3W31A 3TRKA 1YZBA 4CDFB 1AECA 2AVWA 2E00A 4RNAA 3HD3A 4RF0A 2DJGB 1Y4HA 1PPDA 1JQPA 4OVZA 1PADA 2BU3A 5CVMA 4QH6A 2NQDB 4BOSA 1F2AA 4YYVA 1F2BA 2BTWB 2NQAA 4G54A 1ICFA 2G8EA 3P5WA 1DKIA 2FQ9A 2CIOA 1FH0A 2AGAA 4MZSA 2E02A 1O0EA 1AYVA 1PCIA 9PAPA 3MTNA 1NB5A 3H8CA 1U9WA 1VJVA 4I04A 3U8EA 1U9VA 4BOZA 3C0RA 2DCCA 1ZCMA 2GHUA 3O0UA 4BOQA 3V6EA 1QDQA 1MS6A 2FRQA 4BS5A 1F29A 3MHHA 4I05A 3RVVA 3IV2A 3IHPA 2VHSA 1KFXL 3IMAA 5A24A 3B21A 5JH3A 4RKXA 5EF4A 1AYUA 4M0WA 1GLOA 2OZ2A 4BPVA 2R9OA 3OVXA 4XZXA 4QRGA 1U9QX 3KSEA 1QOLA 4QBBA
chains in the Genus database with same CATH topology
2AIMA 2H7JA 2B1MA 1QXPA 1CS8A 3LTWA 1MEGA 3BWKA 4CDEB 3IEJA 2OULA 2JQGR 4Q8HA 4AXMA 1KHQA 3P5VA 4BQVA 2DC6A 4GUZA 1X9YA 3BCNA 2PNSA 1PPNA 4I07A 3ERVA 3IUTA 2CB5A 3ZUAA 3OVZA 3H7DA 3OISA 5CVOB 4CZWA 3QJ3A 3PW3A 2YJ8A 3KWZA 4ZUXU 1BP4A 2R9FA 1AU3A 2PREA 3BPFA 3K8UA 4N4ZA 1CVZA 3WXEA 1STFE 1AU4A 3KFQA 3OF9A 4P6EA 1NL6A 2YJCA 1F2CA 1K3BB 3BPMA 1YALA 1DEUA 3CBKA 1DF0A 4XR7A 1YVBA 2DC8A 4MZOA 5J94A 3OF8A 4W5BA 5F02A 4FIPA 4OEMA 3IOQA 2AUXA 1AU0A 4P6GA 3P5UA 1YK7A 2R9MA 4Q8GA 3RVXA 3WXGA 1Y08A 3H8BA 1U5IA 4PP1A 3H6SA 1GCBA 2ACTA 4QRXA 2HHNA 3CBJA 1KHPA 5JA7A 4X6HA 4BSQA 1YT7A 2E01A 4XUIA 4RY2A 2DCAA 2DZZA 4PADA 2C0YA 5K16A 2R9NA 3HWNA 4KLBA 4YVAA 1PE6A 4OELA 6PADA 3HHAA 4PI3A 4NV7A 2G7YA 2OP3A 3I06A 3K9MA 1MEMA 1A6RA 3S3QA 1ME4A 2XU1A 4HWYA 3CH3X 1ATKA 3E1ZB 2NQIA 1ZIVA 2G6DA 1CQDA 2HH5A 3BC3A 5CHVA 4AXLA 3F5VA 1CB5A 1MHWA 3QSDA 2DZYA 4FJCA 2ATOA 3PBHA 3CH2X 3N4CA 2YJBA 1CSBB 1CJLA 3V6CA 2G8JA 4CDDB 1PPOA 1PBHA 1ME3A 2XU4A 4C5PA 4YV8A 2NQGA 2IBIA 5EGWA 2AS8A 4YYQA 2BSZA 4FK5A 1VSNA 2BDZA 2E03A 4YYWA 2Y6EA 1EWMA 4MSXA 2R6NA 2AYOA 5CHTA 2AYNA 3O1GA 1NPZA 3USVA 2P86A 4X6JA 2VHFA 2P0RA 1SP4B 2XU5A 3PNRA 2ARYA 1CTEA 1POPA 3K24A 4B55A 1NQCA 3AI8A 1PPPA 4K7CA 4N79A 4YYRA 3BOWA 1S4VA 1PXVA 3KWBX 4YYSA 1QMYA 2IPPB 5FPWA 4N8WA 1ITOA 1W4TA 3HHIA 3MHSA 5PADA 2DCDA 2DC7A 3N3KA 8PCHA 2VFCA 2F7DA 1M6DA 1BGOA 1THEA 3KW9A 1AIMA 1BQIA 2P7UA 2HD5A 2WBFX 2GFOA 2R9CA 2DCBA 4PP2E 1GMYA 3DF0A 2F1GA 2BDLA 1EWPA 5CVNB 1U9XA 1AU2A 1SNKA 2YJ9A 1EWOA 1BY8A 3RVWA 1NB3A 3N3GA 3GCBA 1TU6A 2YJ2A 4W4UA 3TNXA 1MDWA 3B79A 1PIPA 3I3TA 3H89A 2AUZA 2DC9A 3M99A 1YK8A 1TL9A 2PBHA 3D6SA 2Y5BA 7PCKA 3KX1A 3QT4A 1HUCB 1TLOA 2FUDA 2FTDA 3F75A 1IWDA 2PADA 3NHEA 2JQFR 2FYEA 3P5XA 4YYUA 1GX3A 3WXFA 2FRAA 3S3RA 1GECE 3MORA 2O6XA 1KFUL 2FO5A 4DMYA 1EWLA 4CDCB 2VFBA 1CV8A 3LFYA 4QRVA 3LXSA 3KKUA 4BGFA 1AYWA 1KXRA 3PDFA 2AU1A 1EF7A 2DJFB 4WA6A 2XU3A 2B1NA 4BS6A 4DMXA 1E2TA 3D9WA 4W5CA 1Q6KA 1NLJA 3C9EA 2HXZA 1XKGA 1MIRA 1CPJA 2FT2A 4X6IA 4CDFB 1AECA 2AVWA 2E00A 3HD3A 2DJGB 1Y4HA 1PPDA 1JQPA 1PADA 5CVMA 4QH6A 2NQDB 1F2AA 4YYVA 1F2BA 2NQAA 4G54A 1ICFA 2G8EA 4NV8A 3P5WA 2FQ9A 2CIOA 1FH0A 4MZSA 2E02A 1O0EA 1AYVA 1PCIA 9PAPA 3MTNA 1NB5A 3H8CA 1U9WA 1VJVA 4I04A 3U8EA 1U9VA 2DCCA 1ZCMA 2GHUA 1W5RA 3O0UA 3V6EA 1QDQA 1MS6A 2FRQA 4BS5A 1F29A 3MHHA 4I05A 3RVVA 3IV2A 3IHPA 2VHSA 1KFXL 3IMAA 5A24A 5JH3A 5EF4A 1AYUA 1GLOA 1W6FA 2OZ2A 4BPVA 2R9OA 3OVXA 4QRGA 1U9QX 3KSEA 1QOLA 4QBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIM A;  2H7J A;  2B1M A;  1QXP A;  1CS8 A;  1MEG A;  3BWK A;  4CDE B;  3IEJ A;  2OUL A;  2JQG R;  4Q8H A;  4AXM A;  1KHQ A;  3P5V A;  4BQV A;  2DC6 A;  1X9Y A;  3BCN A;  2PNS A;  1PPN A;  4I07 A;  3ERV A;  3IUT A;  2CB5 A;  3ZUA A;  3OVZ A;  3H7D A;  3OIS A;  5CVO B;  4CZW A;  3QJ3 A;  3PW3 A;  2YJ8 A;  3KWZ A;  4ZUX U;  1BP4 A;  2R9F A;  1AU3 A;  2PRE A;  3BPF A;  3K8U A;  4N4Z A;  1CVZ A;  3WXE A;  1STF E;  1AU4 A;  3KFQ A;  3OF9 A;  4P6E A;  1NL6 A;  2YJC A;  1F2C A;  1K3B B;  3BPM A;  1YAL A;  1DEU A;  3CBK A;  1DF0 A;  4XR7 A;  1YVB A;  2DC8 A;  4MZO A;  5J94 A;  3OF8 A;  4W5B A;  5F02 A;  4FIP A;  4OEM A;  3IOQ A;  2AUX A;  1AU0 A;  4P6G A;  3P5U A;  1YK7 A;  2R9M A;  4Q8G A;  3RVX A;  3WXG A;  1Y08 A;  3H8B A;  1U5I A;  4PP1 A;  3H6S A;  1GCB A;  2ACT A;  4QRX A;  2HHN A;  3CBJ A;  1KHP A;  5JA7 A;  4X6H A;  4BSQ A;  1YT7 A;  2E01 A;  4XUI A;  4RY2 A;  2DCA A;  2DZZ A;  4PAD A;  2C0Y A;  5K16 A;  2R9N A;  3HWN A;  4KLB A;  4YVA A;  1PE6 A;  4OEL A;  6PAD A;  3HHA A;  4PI3 A;  2G7Y A;  2OP3 A;  3I06 A;  3K9M A;  1MEM A;  1A6R A;  3S3Q A;  1ME4 A;  2XU1 A;  4HWY A;  3CH3 X;  1ATK A;  3E1Z B;  2NQI A;  1ZIV A;  2G6D A;  1CQD A;  2HH5 A;  3BC3 A;  5CHV A;  4AXL A;  3F5V A;  1CB5 A;  1MHW A;  3QSD A;  2DZY A;  4FJC A;  2ATO A;  3PBH A;  3CH2 X;  3N4C A;  2YJB A;  1CSB B;  1CJL A;  3V6C A;  2G8J A;  4CDD B;  1PPO A;  1PBH A;  1ME3 A;  2XU4 A;  4YV8 A;  2NQG A;  2IBI A;  5EGW A;  2AS8 A;  4YYQ A;  4FK5 A;  1VSN A;  2BDZ A;  2E03 A;  4YYW A;  2Y6E A;  1EWM A;  4MSX A;  2R6N A;  2AYO A;  5CHT A;  2AYN A;  3O1G A;  1NPZ A;  3USV A;  2P86 A;  4X6J A;  2VHF A;  2P0R A;  1SP4 B;  2XU5 A;  3PNR A;  2ARY A;  1CTE A;  1POP A;  3K24 A;  1NQC A;  3AI8 A;  1PPP A;  4K7C A;  4N79 A;  4YYR A;  3BOW A;  1S4V A;  1PXV A;  3KWB X;  4YYS A;  1QMY A;  2IPP B;  5FPW A;  4N8W A;  1ITO A;  3HHI A;  3MHS A;  5PAD A;  2DCD A;  2DC7 A;  3N3K A;  8PCH A;  2F7D A;  1M6D A;  1BGO A;  1THE A;  3KW9 A;  1AIM A;  1BQI A;  2P7U A;  2HD5 A;  2WBF X;  2GFO A;  2R9C A;  2DCB A;  4PP2 E;  1GMY A;  3DF0 A;  2F1G A;  2BDL A;  1EWP A;  5CVN B;  1U9X A;  1AU2 A;  1SNK A;  2YJ9 A;  1EWO A;  1BY8 A;  3RVW A;  1NB3 A;  3N3G A;  3GCB A;  1TU6 A;  2YJ2 A;  4W4U A;  3TNX A;  1MDW A;  3B79 A;  1PIP A;  3I3T A;  3H89 A;  2AUZ A;  2DC9 A;  3M99 A;  1YK8 A;  1TL9 A;  2PBH A;  3D6S A;  2Y5B A;  7PCK A;  3KX1 A;  3QT4 A;  1HUC B;  1TLO A;  2FUD A;  2FTD A;  3F75 A;  1IWD A;  2PAD A;  3NHE A;  2JQF R;  2FYE A;  3P5X A;  4YYU A;  3WXF A;  2FRA A;  3S3R A;  1GEC E;  3MOR A;  2O6X A;  1KFU L;  2FO5 A;  4DMY A;  1EWL A;  4CDC B;  1CV8 A;  3LFY A;  4QRV A;  3LXS A;  3KKU A;  1AYW A;  1KXR A;  3PDF A;  2AU1 A;  1EF7 A;  2DJF B;  4WA6 A;  2XU3 A;  2B1N A;  4BS6 A;  4DMX A;  4W5C A;  1Q6K A;  1NLJ A;  3C9E A;  2HXZ A;  1XKG A;  1MIR A;  1CPJ A;  2FT2 A;  4X6I A;  4CDF B;  1AEC A;  2AVW A;  2E00 A;  3HD3 A;  2DJG B;  1Y4H A;  1PPD A;  1JQP A;  1PAD A;  5CVM A;  4QH6 A;  2NQD B;  1F2A A;  4YYV A;  1F2B A;  2NQA A;  4G54 A;  1ICF A;  2G8E A;  3P5W A;  2FQ9 A;  2CIO A;  1FH0 A;  4MZS A;  2E02 A;  1O0E A;  1AYV A;  1PCI A;  9PAP A;  3MTN A;  1NB5 A;  3H8C A;  1U9W A;  1VJV A;  4I04 A;  3U8E A;  1U9V A;  2DCC A;  1ZCM A;  2GHU A;  3O0U A;  3V6E A;  1QDQ A;  1MS6 A;  2FRQ A;  4BS5 A;  1F29 A;  3MHH A;  4I05 A;  3RVV A;  3IV2 A;  3IHP A;  2VHS A;  1KFX L;  3IMA A;  5A24 A;  5JH3 A;  5EF4 A;  1AYU A;  1GLO A;  2OZ2 A;  4BPV A;  2R9O A;  3OVX A;  4QRG A;  1U9Q X;  3KSE A;  1QOL A;  4QBB A; 
#chains in the Genus database with same CATH topology
 2AIM A;  2H7J A;  2B1M A;  1QXP A;  1CS8 A;  2HWK A;  3MJ5 A;  1MEG A;  3BWK A;  4CDE B;  3IEJ A;  2OUL A;  2JQG R;  4Q8H A;  4AXM A;  1KHQ A;  3BB7 A;  3P5V A;  4R3D A;  4BQV A;  2DC6 A;  1X9Y A;  3BCN A;  2PNS A;  1PPN A;  4I07 A;  3ERV A;  3IUT A;  2CB5 A;  3ZUA A;  3OVZ A;  3H7D A;  3OIS A;  5CVO B;  4CZW A;  3E9S A;  3QJ3 A;  3PW3 A;  2YJ8 A;  2FE8 A;  3KWZ A;  4ZUX U;  1BP4 A;  2R9F A;  1AU3 A;  2PRE A;  3BPF A;  3K8U A;  4HXD B;  4N4Z A;  1CVZ A;  3WXE A;  1STF E;  1AU4 A;  3KFQ A;  5KO3 A;  3OF9 A;  4P6E A;  1NL6 A;  2YJC A;  1F2C A;  1K3B B;  3BPM A;  1YAL A;  1DEU A;  3CBK A;  4IUM A;  1DF0 A;  4XR7 A;  2JRI A;  1YVB A;  2DC8 A;  4MZO A;  5J94 A;  3OF8 A;  4W5B A;  5F02 A;  4FIP A;  4OEM A;  4REZ A;  4A5U A;  3IOQ A;  2AUX A;  1AU0 A;  4P6G A;  3P5U A;  1YK7 A;  2R9M A;  4Q8G A;  3RVX A;  3WXG A;  1Y08 A;  3H8B A;  1U5I A;  4PP1 A;  2UZJ A;  3H6S A;  1GCB A;  2ACT A;  4QRX A;  2HHN A;  3CBJ A;  1KHP A;  5JA7 A;  4X6H A;  4BSQ A;  3PHU A;  1YT7 A;  2E01 A;  4XUI A;  4RY2 A;  3PRP A;  2DCA A;  2DZZ A;  3RNV A;  4PAD A;  2C0Y A;  4MI7 A;  5K16 A;  2R9N A;  3HWN A;  4KLB A;  4YVA A;  1PE6 A;  4OEL A;  4OVZ B;  6PAD A;  3HHA A;  4PI3 A;  2G7Y A;  2OP3 A;  3I06 A;  3K9M A;  1MEM A;  4RF1 A;  1A6R A;  3S3Q A;  1ME4 A;  4GUA A;  2XU1 A;  3W30 A;  4HWY A;  3CH3 X;  1ATK A;  3E1Z B;  3PT2 A;  2NQI A;  1ZIV A;  2G6D A;  1CQD A;  2HH5 A;  1UKF A;  3BC3 A;  5CHV A;  4AXL A;  3F5V A;  1CB5 A;  1MHW A;  3QSD A;  2DZY A;  4FJC A;  2ATO A;  3PBH A;  3CH2 X;  3N4C A;  2YJB A;  1CSB B;  1CJL A;  3V6C A;  2G8J A;  4CDD B;  1PPO A;  1PBH A;  1ME3 A;  2BTW A;  4D8I A;  2XU4 A;  2Z84 A;  4YV8 A;  3ZNH A;  3OQC A;  5EZS A;  2NQG A;  2IBI A;  5EGW A;  2AS8 A;  4YYQ A;  4FK5 A;  1VSN A;  2BDZ A;  2E03 A;  4YYW A;  2Y6E A;  1EWM A;  4MSX A;  2R6N A;  2AYO A;  3TMP A;  5CHT A;  2AYN A;  3PHX A;  3O1G A;  1NPZ A;  3USV A;  2P86 A;  4X6J A;  2VHF A;  2P0R A;  4ZTB A;  1SP4 B;  3PHW A;  2XU5 A;  3PNR A;  2ARY A;  1CTE A;  3O65 A;  5JZE A;  1POP A;  3K24 A;  1NQC A;  3AI8 A;  1PPP A;  4K7C A;  4N79 A;  4YYR A;  3MP2 A;  4P16 A;  3BOW A;  1S4V A;  1PXV A;  3KWB X;  4YYS A;  1QMY A;  2IPP B;  3BY4 A;  5FPW A;  4N8W A;  1ITO A;  4MM3 B;  2J7Q A;  3HHI A;  3MHS A;  5PAD A;  2J7Q C;  4PT5 A;  2DCD A;  2DC7 A;  3N3K A;  8PCH A;  4BOU A;  2F7D A;  1M6D A;  1BGO A;  1THE A;  2DOS A;  3KW9 A;  1AIM A;  1BQI A;  2P7U A;  2HD5 A;  2WBF X;  2GFO A;  2R9C A;  2DCB A;  4PP2 E;  1GMY A;  3DF0 A;  2F1G A;  2BDL A;  1EWP A;  5CVN B;  1U9X A;  5E6J A;  1AU2 A;  1SNK A;  2YJ9 A;  3BBA A;  1EWO A;  1BY8 A;  1PVJ A;  3RVW A;  1NB3 A;  3N3G A;  4D8B A;  3GCB A;  4BOP A;  1TU6 A;  2YJ2 A;  4W4U A;  3TNX A;  1MDW A;  3B79 A;  1PIP A;  3I3T A;  4OW0 A;  4WUR A;  3H89 A;  5EZQ A;  2AUZ A;  2DC9 A;  3M99 A;  1YK8 A;  1TL9 A;  2PBH A;  3D6S A;  3IFU A;  2Y5B A;  7PCK A;  3KX1 A;  3QT4 A;  1HUC B;  1TLO A;  2FUD A;  2FTD A;  3F75 A;  4D8E A;  1IWD A;  2PAD A;  3NHE A;  2JQF R;  2FYE A;  3P5X A;  4YYU A;  3WXF A;  2FRA A;  3S3R A;  1GEC E;  3MOR A;  2O6X A;  1KFU L;  2FO5 A;  4DMY A;  1EWL A;  4CDC B;  1CV8 A;  3LFY A;  4QRV A;  3LXS A;  3KKU A;  1AYW A;  1KXR A;  3PRM A;  3PSE A;  3PDF A;  2AU1 A;  1EF7 A;  2DJF B;  4WA6 A;  2XU3 A;  2B1N A;  4BS6 A;  4DMX A;  4W5C A;  1Q6K A;  1NLJ A;  3C9E A;  2HXZ A;  1XKG A;  1MIR A;  1CPJ A;  3MTV A;  2JTC A;  4IP3 A;  2FT2 A;  4X6I A;  3W31 A;  3TRK A;  1YZB A;  4CDF B;  1AEC A;  2AVW A;  2E00 A;  4RNA A;  3HD3 A;  4RF0 A;  2DJG B;  1Y4H A;  1PPD A;  1JQP A;  4OVZ A;  1PAD A;  2BU3 A;  5CVM A;  4QH6 A;  2NQD B;  4BOS A;  1F2A A;  4YYV A;  1F2B A;  2BTW B;  2NQA A;  4G54 A;  1ICF A;  2G8E A;  3P5W A;  1DKI A;  2FQ9 A;  2CIO A;  1FH0 A;  2AGA A;  4MZS A;  2E02 A;  1O0E A;  1AYV A;  1PCI A;  9PAP A;  3MTN A;  1NB5 A;  3H8C A;  1U9W A;  1VJV A;  4I04 A;  3U8E A;  1U9V A;  4BOZ A;  3C0R A;  2DCC A;  1ZCM A;  2GHU A;  3O0U A;  4BOQ A;  3V6E A;  1QDQ A;  1MS6 A;  2FRQ A;  4BS5 A;  1F29 A;  3MHH A;  4I05 A;  3RVV A;  3IV2 A;  3IHP A;  2VHS A;  1KFX L;  3IMA A;  5A24 A;  3B21 A;  5JH3 A;  4RKX A;  5EF4 A;  1AYU A;  4M0W A;  1GLO A;  2OZ2 A;  4BPV A;  2R9O A;  3OVX A;  4XZX A;  4QRG A;  1U9Q X;  3KSE A;  1QOL A;  4QBB A; 
#chains in the Genus database with same CATH homology
 2AIM A;  2H7J A;  2B1M A;  1QXP A;  1CS8 A;  3LTW A;  1MEG A;  3BWK A;  4CDE B;  3IEJ A;  2OUL A;  2JQG R;  4Q8H A;  4AXM A;  1KHQ A;  3P5V A;  4BQV A;  2DC6 A;  4GUZ A;  1X9Y A;  3BCN A;  2PNS A;  1PPN A;  4I07 A;  3ERV A;  3IUT A;  2CB5 A;  3ZUA A;  3OVZ A;  3H7D A;  3OIS A;  5CVO B;  4CZW A;  3QJ3 A;  3PW3 A;  2YJ8 A;  3KWZ A;  4ZUX U;  1BP4 A;  2R9F A;  1AU3 A;  2PRE A;  3BPF A;  3K8U A;  4N4Z A;  1CVZ A;  3WXE A;  1STF E;  1AU4 A;  3KFQ A;  3OF9 A;  4P6E A;  1NL6 A;  2YJC A;  1F2C A;  1K3B B;  3BPM A;  1YAL A;  1DEU A;  3CBK A;  1DF0 A;  4XR7 A;  1YVB A;  2DC8 A;  4MZO A;  5J94 A;  3OF8 A;  4W5B A;  5F02 A;  4FIP A;  4OEM A;  3IOQ A;  2AUX A;  1AU0 A;  4P6G A;  3P5U A;  1YK7 A;  2R9M A;  4Q8G A;  3RVX A;  3WXG A;  1Y08 A;  3H8B A;  1U5I A;  4PP1 A;  3H6S A;  1GCB A;  2ACT A;  4QRX A;  2HHN A;  3CBJ A;  1KHP A;  5JA7 A;  4X6H A;  4BSQ A;  1YT7 A;  2E01 A;  4XUI A;  4RY2 A;  2DCA A;  2DZZ A;  4PAD A;  2C0Y A;  5K16 A;  2R9N A;  3HWN A;  4KLB A;  4YVA A;  1PE6 A;  4OEL A;  6PAD A;  3HHA A;  4PI3 A;  4NV7 A;  2G7Y A;  2OP3 A;  3I06 A;  3K9M A;  1MEM A;  1A6R A;  3S3Q A;  1ME4 A;  2XU1 A;  4HWY A;  3CH3 X;  1ATK A;  3E1Z B;  2NQI A;  1ZIV A;  2G6D A;  1CQD A;  2HH5 A;  3BC3 A;  5CHV A;  4AXL A;  3F5V A;  1CB5 A;  1MHW A;  3QSD A;  2DZY A;  4FJC A;  2ATO A;  3PBH A;  3CH2 X;  3N4C A;  2YJB A;  1CSB B;  1CJL A;  3V6C A;  2G8J A;  4CDD B;  1PPO A;  1PBH A;  1ME3 A;  2XU4 A;  4C5P A;  4YV8 A;  2NQG A;  2IBI A;  5EGW A;  2AS8 A;  4YYQ A;  2BSZ A;  4FK5 A;  1VSN A;  2BDZ A;  2E03 A;  4YYW A;  2Y6E A;  1EWM A;  4MSX A;  2R6N A;  2AYO A;  5CHT A;  2AYN A;  3O1G A;  1NPZ A;  3USV A;  2P86 A;  4X6J A;  2VHF A;  2P0R A;  1SP4 B;  2XU5 A;  3PNR A;  2ARY A;  1CTE A;  1POP A;  3K24 A;  4B55 A;  1NQC A;  3AI8 A;  1PPP A;  4K7C A;  4N79 A;  4YYR A;  3BOW A;  1S4V A;  1PXV A;  3KWB X;  4YYS A;  1QMY A;  2IPP B;  5FPW A;  4N8W A;  1ITO A;  1W4T A;  3HHI A;  3MHS A;  5PAD A;  2DCD A;  2DC7 A;  3N3K A;  8PCH A;  2VFC A;  2F7D A;  1M6D A;  1BGO A;  1THE A;  3KW9 A;  1AIM A;  1BQI A;  2P7U A;  2HD5 A;  2WBF X;  2GFO A;  2R9C A;  2DCB A;  4PP2 E;  1GMY A;  3DF0 A;  2F1G A;  2BDL A;  1EWP A;  5CVN B;  1U9X A;  1AU2 A;  1SNK A;  2YJ9 A;  1EWO A;  1BY8 A;  3RVW A;  1NB3 A;  3N3G A;  3GCB A;  1TU6 A;  2YJ2 A;  4W4U A;  3TNX A;  1MDW A;  3B79 A;  1PIP A;  3I3T A;  3H89 A;  2AUZ A;  2DC9 A;  3M99 A;  1YK8 A;  1TL9 A;  2PBH A;  3D6S A;  2Y5B A;  7PCK A;  3KX1 A;  3QT4 A;  1HUC B;  1TLO A;  2FUD A;  2FTD A;  3F75 A;  1IWD A;  2PAD A;  3NHE A;  2JQF R;  2FYE A;  3P5X A;  4YYU A;  1GX3 A;  3WXF A;  2FRA A;  3S3R A;  1GEC E;  3MOR A;  2O6X A;  1KFU L;  2FO5 A;  4DMY A;  1EWL A;  4CDC B;  2VFB A;  1CV8 A;  3LFY A;  4QRV A;  3LXS A;  3KKU A;  4BGF A;  1AYW A;  1KXR A;  3PDF A;  2AU1 A;  1EF7 A;  2DJF B;  4WA6 A;  2XU3 A;  2B1N A;  4BS6 A;  4DMX A;  1E2T A;  3D9W A;  4W5C A;  1Q6K A;  1NLJ A;  3C9E A;  2HXZ A;  1XKG A;  1MIR A;  1CPJ A;  2FT2 A;  4X6I A;  4CDF B;  1AEC A;  2AVW A;  2E00 A;  3HD3 A;  2DJG B;  1Y4H A;  1PPD A;  1JQP A;  1PAD A;  5CVM A;  4QH6 A;  2NQD B;  1F2A A;  4YYV A;  1F2B A;  2NQA A;  4G54 A;  1ICF A;  2G8E A;  4NV8 A;  3P5W A;  2FQ9 A;  2CIO A;  1FH0 A;  4MZS A;  2E02 A;  1O0E A;  1AYV A;  1PCI A;  9PAP A;  3MTN A;  1NB5 A;  3H8C A;  1U9W A;  1VJV A;  4I04 A;  3U8E A;  1U9V A;  2DCC A;  1ZCM A;  2GHU A;  1W5R A;  3O0U A;  3V6E A;  1QDQ A;  1MS6 A;  2FRQ A;  4BS5 A;  1F29 A;  3MHH A;  4I05 A;  3RVV A;  3IV2 A;  3IHP A;  2VHS A;  1KFX L;  3IMA A;  5A24 A;  5JH3 A;  5EF4 A;  1AYU A;  1GLO A;  1W6F A;  2OZ2 A;  4BPV A;  2R9O A;  3OVX A;  4QRG A;  1U9Q X;  3KSE A;  1QOL A;  4QBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...