2OP3A

The structure of cathepsin s with a novel 2-arylphenoxyacetaldehyde inhibitor derived by the substrate activity screening (sas) method
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and optimization of selective, nonpeptidic inhibitors of cathepsin S with an unprecedented binding mode.
pubmed doi rcsb
molecule keywords Cathepsin S
molecule tags Hydrolase
source organism Homo sapiens
total genus 70
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2op3A00
2B1MA 4KLBA 2DCCA 4QRVA 5J94A 1F29A 1F2CA 3IV2A 1MDWA 3BPFA 4BS6A 3H7DA 1CSBB 5PADA 2VHSA 3NHEA 3S3RA 3WXGA 3O0UA 2DC9A 5EF4A 3PNRA 1PCIA 1HUCB 1VSNA 4WA6A 1POPA 2NQAA 2XU4A 3KW9A 7PCKA 2DCBA 3K8UA 3F75A 2P0RA 4ZUXU 2OZ2A 3GCBA 3KKUA 3P5UA 4X6HA 4CDFB 1A6RA 1M6DA 2AS8A 1MS6A 4CZWA 1YT7A 1PADA 3CH3X 2JQFR 1ITOA 3AI8A 3P5XA 2FYEA 4BSQA 3BC3A 1MEGA 2PBHA 1NPZA 1U9QX 1AU4A 2C0YA 4MSXA 1PBHA 5CVOB 2IBIA 4MZOA 2AUZA 1MHWA 3K24A 3I06A 4RY2A 3OVZA 2DC8A 4FK5A 2OP3A 1TL9A 2E00A 3HWNA 4BS5A 2HD5A 3IHPA 2R9NA 1JQPA 1KFXL 1XKGA 2DC7A 1QXPA 4G54A 4N8WA 4Q8HA 4W5CA 1ME3A 1GMYA 1AECA 3M99A 4QBBA 3QSDA 3H8BA 2NQDB 4YYSA 3OVXA 2E03A 3I3TA 4YV8A 3HHIA 2YJ2A 2G8EA 4QH6A 3N3GA 1FH0A 1CJLA 1CS8A 4CDDB 1U5IA 1SP4B 2R9CA 4YVAA 3MTNA 3KWBX 4W4UA 4CDEB 2E01A 2XU3A 4AXMA 1EWPA 3KSEA 3P5VA 1DF0A 2AU1A 2NQIA 4OELA 4P6GA 3KWZA 2G7YA 3TNXA 1GECE 2CB5A 1PE6A 5F02A 4BQVA 4I04A 2O6XA 1EWOA 1PIPA 1QMYA 1NB5A 4DMXA 2IPPB 4BPVA 4FIPA 5CVNB 2YJBA 1KHPA 1ZCMA 1EWMA 2DC6A 3C9EA 3BWKA 4K7CA 3E1ZB 3OISA 4P6EA 4YYVA 2YJCA 2DJGB 1TU6A 2F7DA 2FRAA 4I05A 9PAPA 2FO5A 1YVBA 4YYQA 2GHUA 2ATOA 3BPMA 3N3KA 4X6IA 8PCHA 2P7UA 1U9VA 3RVVA 5CVMA 3U8EA 3USVA 2PADA 3H89A 1STFE 4X6JA 4AXLA 1EWLA 1BQIA 2AIMA 5A24A 3KX1A 1MEMA 1NL6A 4HWYA 3BOWA 2DZZA 3ZUAA 2BDLA 4DMYA 4N4ZA 2B1NA 4YYWA 1IWDA 3D6SA 2JQGR 1YALA 1THEA 3F5VA 3MORA 3P5WA 2R6NA 1AU0A 5JH3A 1CB5A 1MIRA 3WXFA 1U9XA 1PXVA 1AU2A 3H6SA 5JA7A 3CH2X 2AUXA 1CV8A 4QRXA 1CVZA 3PDFA 2FTDA 3V6EA 5FPWA 1X9YA 1GLOA 3WXEA 2Y5BA 3OF8A 2GFOA 5K16A 1KXRA 1SNKA 2FRQA 2YJ9A 1K3BB 2AYOA 4MZSA 3MHHA 1Y4HA 2WBFX 3B79A 1CTEA 1O0EA 4PP1A 2AYNA 5EGWA 4XR7A 2R9OA 3PW3A 2YJ8A 2FUDA 2VHFA 2BDZA 3QJ3A 1CQDA 1F2AA 2CIOA 2DCDA 1Y08A 1NQCA 2G8JA 1KHQA 1BGOA 4FJCA 1NB3A 4YYUA 1Q6KA 3LXSA 2FT2A 4PP2E 3DF0A 3HD3A 2DCAA 1TLOA 2ARYA 4OEMA 4CDCB 2DJFB 2HHNA 2HXZA 1S4VA 1ZIVA 5CHVA 3ERVA 1AU3A 2DZYA 1EF7A 3K9MA 1DEUA 2PREA 1VJVA 3IOQA 4I07A 1U9WA 1PPNA 3CBJA 4YYRA 1BP4A 1PPPA 1AYVA 2XU5A 3OF9A 3RVWA 5CHTA 2FQ9A 1GCBA 2E02A 3S3QA 3KFQA 1YK8A 3O1GA 4PADA 3CBKA 3LFYA 2F1GA 1KFUL 3IUTA 3MHSA 4QRGA 3PBHA 3IMAA 1BY8A 1PPOA 1ME4A 2XU1A 1ATKA 2ACTA 2R9FA 2OULA 1NLJA 4W5BA 1AYUA 2AVWA 3IEJA 6PADA 4Q8GA 3N4CA 3QT4A 1F2BA 3H8CA 4PI3A 2NQGA 2Y6EA 1AYWA 4N79A 3RVXA 1QOLA 1ICFA 4XUIA 2H7JA 2R9MA 3BCNA 2P86A 2G6DA 3V6CA 1YK7A 2HH5A 1PPDA 1AIMA 1QDQA 3HHAA 2PNSA 1CPJA
chains in the Genus database with same CATH superfamily
2B1MA 4KLBA 2DCCA 3B21A 4QRVA 5J94A 1F29A 1F2CA 3IV2A 1MDWA 3BPFA 4BS6A 3H7DA 1CSBB 5PADA 2VHSA 3NHEA 4BOUA 3S3RA 4RF1A 3WXGA 3O0UA 2DC9A 5EF4A 3PNRA 1PCIA 1HUCB 1VSNA 4WA6A 1POPA 2NQAA 2XU4A 3KW9A 7PCKA 2DCBA 3K8UA 3F75A 3PRPA 4BOZA 2P0RA 4ZUXU 2OZ2A 3GCBA 3KKUA 3P5UA 4X6HA 4CDFB 1A6RA 4OVZB 1M6DA 2AS8A 1MS6A 4CZWA 1YT7A 1PADA 2J7QA 3CH3X 2JQFR 4D8EA 1ITOA 3AI8A 3P5XA 2FYEA 4BSQA 3BC3A 1MEGA 2PBHA 4D8BA 1NPZA 1U9QX 1AU4A 4RKXA 2C0YA 4MSXA 1PBHA 5CVOB 2IBIA 4MZOA 2AUZA 1MHWA 3K24A 3I06A 4RY2A 3OVZA 2DC8A 3PT2A 4FK5A 3O65A 2OP3A 1TL9A 2E00A 3HWNA 4BS5A 2HD5A 3IHPA 2R9NA 3TMPA 1JQPA 1KFXL 1XKGA 2DC7A 1QXPA 4G54A 4N8WA 4Q8HA 4REZA 2BU3A 4W5CA 1ME3A 1GMYA 4A5UA 1AECA 3M99A 3MJ5A 1YZBA 4OW0A 4QBBA 3QSDA 3MTVA 2HWKA 2NQDB 3H8BA 4YYSA 3OVXA 2E03A 2UZJA 3I3TA 4YV8A 3HHIA 4PT5A 2YJ2A 4BOQA 2G8EA 4QH6A 3N3GA 1FH0A 1CJLA 1CS8A 4CDDB 1U5IA 1SP4B 3IFUA 2R9CA 4YVAA 5EZSA 3MTNA 3KWBX 4R3DA 4W4UA 4CDEB 3W30A 3BY4A 2E01A 2BTWA 2XU3A 4AXMA 1EWPA 3KSEA 3P5VA 1DF0A 2AU1A 2NQIA 4OELA 4P6GA 3KWZA 2G7YA 3TNXA 4BOPA 1GECE 2CB5A 2JRIA 1PE6A 5F02A 4BQVA 4I04A 2O6XA 1EWOA 1PIPA 1QMYA 1NB5A 4DMXA 2FE8A 2IPPB 4BPVA 4FIPA 5CVNB 2YJBA 1KHPA 4IP3A 1ZCMA 1EWMA 2DC6A 3C9EA 1PVJA 2DOSA 3BWKA 4K7CA 3E1ZB 3OISA 1UKFA 4P6EA 4YYVA 3PHXA 2YJCA 2DJGB 3W31A 1TU6A 2F7DA 2FRAA 4I05A 9PAPA 2FO5A 1YVBA 4YYQA 2GHUA 2ATOA 3BPMA 3N3KA 4X6IA 8PCHA 2BTWB 2P7UA 1U9VA 3RVVA 5CVMA 3U8EA 3USVA 2PADA 3H89A 3ZNHA 1STFE 4X6JA 4AXLA 1EWLA 1BQIA 2AIMA 5A24A 3KX1A 3TRKA 1MEMA 4D8IA 1NL6A 4HWYA 3BOWA 2DZZA 3ZUAA 2BDLA 4DMYA 4RF0A 4N4ZA 2B1NA 3BB7A 4YYWA 1IWDA 3D6SA 3PSEA 2JQGR 1YALA 1THEA 3F5VA 3MORA 3BBAA 1DKIA 3P5WA 2R6NA 1AU0A 5JH3A 1CB5A 1MIRA 3WXFA 1U9XA 1PXVA 1AU2A 3H6SA 5JA7A 3CH2X 2AUXA 1CV8A 4QRXA 1CVZA 3PDFA 4MM3B 2FTDA 4M0WA 4ZTBA 3V6EA 5FPWA 4HXDB 1X9YA 1GLOA 3WXEA 2Y5BA 3OF8A 2GFOA 5K16A 1KXRA 1SNKA 2FRQA 2YJ9A 1K3BB 3C0RA 2AYOA 4MZSA 3MHHA 1Y4HA 2WBFX 3B79A 1CTEA 1O0EA 4PP1A 2AYNA 5EGWA 4XR7A 2R9OA 3RNVA 3PW3A 2YJ8A 2FUDA 2VHFA 2BDZA 3QJ3A 1CQDA 1F2AA 3OQCA 2CIOA 2DCDA 1Y08A 1NQCA 4P16A 2G8JA 1KHQA 1BGOA 2JTCA 4FJCA 1NB3A 4YYUA 1Q6KA 3LXSA 2FT2A 4PP2E 3DF0A 3HD3A 2DCAA 1TLOA 3PHWA 2ARYA 4OEMA 4CDCB 4XZXA 2DJFB 2HHNA 2HXZA 5EZQA 1S4VA 4GUAA 1ZIVA 5CHVA 2AGAA 3ERVA 1AU3A 2DZYA 1EF7A 3K9MA 2J7QC 4IUMA 1DEUA 5JZEA 2PREA 1VJVA 3IOQA 4I07A 1U9WA 1PPNA 3CBJA 2Z84A 4YYRA 1BP4A 1PPPA 1AYVA 5KO3A 2XU5A 3OF9A 3RVWA 5CHTA 2FQ9A 4WURA 1GCBA 2E02A 3S3QA 3KFQA 1YK8A 3O1GA 4PADA 3CBKA 3LFYA 2F1GA 1KFUL 3IUTA 3MHSA 4QRGA 3PBHA 3IMAA 1BY8A 1PPOA 1ME4A 2XU1A 1ATKA 2ACTA 2R9FA 2OULA 1NLJA 4W5BA 1AYUA 2AVWA 3IEJA 6PADA 4Q8GA 3N4CA 5E6JA 3QT4A 1F2BA 3H8CA 3E9SA 3PRMA 4PI3A 3PHUA 2NQGA 2Y6EA 1AYWA 4N79A 3RVXA 4RNAA 1QOLA 1ICFA 4XUIA 4OVZA 2H7JA 2R9MA 3BCNA 2P86A 2G6DA 3V6CA 1YK7A 2HH5A 1PPDA 3MP2A 1AIMA 4MI7A 1QDQA 3HHAA 4BOSA 2PNSA 1CPJA
chains in the Genus database with same CATH topology
2B1MA 4KLBA 2DCCA 4QRVA 5J94A 1F29A 1F2CA 3IV2A 1MDWA 3BPFA 4BS6A 3H7DA 1CSBB 5PADA 2VHSA 3NHEA 3S3RA 1W4TA 3WXGA 3O0UA 2DC9A 5EF4A 3PNRA 1PCIA 1HUCB 1VSNA 4WA6A 1POPA 2NQAA 2XU4A 3KW9A 7PCKA 2DCBA 3LTWA 3K8UA 3F75A 2P0RA 4ZUXU 2OZ2A 3GCBA 3KKUA 3P5UA 4X6HA 4CDFB 2VFBA 1A6RA 1M6DA 2AS8A 1MS6A 4CZWA 1YT7A 1PADA 3CH3X 2JQFR 1ITOA 3AI8A 3P5XA 2FYEA 4BSQA 3BC3A 1MEGA 2PBHA 1NPZA 1U9QX 1AU4A 2C0YA 4MSXA 1E2TA 1PBHA 5CVOB 2IBIA 4MZOA 2AUZA 1GX3A 1MHWA 1W5RA 3K24A 3I06A 4RY2A 3OVZA 2VFCA 2DC8A 4FK5A 2OP3A 1TL9A 2E00A 3HWNA 4BS5A 2HD5A 3IHPA 2R9NA 1JQPA 1KFXL 1XKGA 2DC7A 1QXPA 4G54A 4N8WA 4Q8HA 4W5CA 1ME3A 1GMYA 1AECA 3M99A 4QBBA 3QSDA 3H8BA 2NQDB 4YYSA 3OVXA 2E03A 3I3TA 4YV8A 3HHIA 2YJ2A 2G8EA 4QH6A 3N3GA 1FH0A 4BGFA 1CJLA 1CS8A 4CDDB 1U5IA 1SP4B 2R9CA 4YVAA 3MTNA 3KWBX 4W4UA 4CDEB 2E01A 2XU3A 4AXMA 1EWPA 3KSEA 3P5VA 1DF0A 2AU1A 2NQIA 4OELA 4P6GA 3KWZA 2G7YA 3TNXA 1GECE 2CB5A 1PE6A 5F02A 4BQVA 4I04A 2O6XA 1EWOA 1PIPA 1QMYA 1NB5A 4DMXA 2IPPB 4BPVA 4FIPA 5CVNB 2YJBA 1KHPA 1ZCMA 1EWMA 2DC6A 3C9EA 3BWKA 4K7CA 3E1ZB 3OISA 4P6EA 4YYVA 2YJCA 2DJGB 1TU6A 2F7DA 2FRAA 4I05A 9PAPA 2FO5A 1YVBA 4YYQA 2GHUA 2ATOA 3BPMA 3N3KA 4X6IA 8PCHA 2P7UA 1U9VA 3RVVA 5CVMA 3U8EA 3USVA 2PADA 3H89A 1STFE 4X6JA 4AXLA 1EWLA 1BQIA 2AIMA 5A24A 3KX1A 1MEMA 1NL6A 4HWYA 3BOWA 2DZZA 4B55A 3ZUAA 2BDLA 4DMYA 4N4ZA 2B1NA 4YYWA 1IWDA 3D6SA 2JQGR 1YALA 1THEA 3F5VA 3MORA 3P5WA 2R6NA 1AU0A 5JH3A 4NV8A 1CB5A 1MIRA 3WXFA 1U9XA 1PXVA 1AU2A 3H6SA 5JA7A 3CH2X 2AUXA 1CV8A 4QRXA 1CVZA 3PDFA 2FTDA 4GUZA 3V6EA 5FPWA 4NV7A 1W6FA 1X9YA 1GLOA 3WXEA 2Y5BA 3OF8A 2GFOA 5K16A 1KXRA 1SNKA 2FRQA 2YJ9A 1K3BB 2AYOA 4MZSA 3MHHA 1Y4HA 2WBFX 3B79A 1CTEA 1O0EA 4PP1A 2AYNA 5EGWA 4XR7A 2R9OA 3PW3A 2YJ8A 2FUDA 2VHFA 2BDZA 3QJ3A 1CQDA 1F2AA 2CIOA 2DCDA 1Y08A 1NQCA 2G8JA 1KHQA 1BGOA 4FJCA 1NB3A 4YYUA 1Q6KA 3LXSA 2FT2A 4PP2E 3DF0A 3HD3A 2DCAA 1TLOA 2ARYA 4OEMA 4CDCB 2DJFB 2HHNA 2HXZA 1S4VA 1ZIVA 5CHVA 3ERVA 1AU3A 2DZYA 1EF7A 3K9MA 1DEUA 2PREA 1VJVA 3IOQA 4I07A 1U9WA 1PPNA 3CBJA 4YYRA 1BP4A 1PPPA 1AYVA 2XU5A 3OF9A 3RVWA 5CHTA 2FQ9A 1GCBA 2E02A 3S3QA 3KFQA 1YK8A 3O1GA 4PADA 3CBKA 3LFYA 2F1GA 1KFUL 3IUTA 3MHSA 4QRGA 3PBHA 3IMAA 1BY8A 1PPOA 2BSZA 1ME4A 2XU1A 3D9WA 1ATKA 2ACTA 2R9FA 2OULA 1NLJA 4W5BA 1AYUA 2AVWA 3IEJA 6PADA 4Q8GA 3N4CA 3QT4A 1F2BA 3H8CA 4PI3A 4C5PA 2NQGA 2Y6EA 1AYWA 4N79A 3RVXA 1QOLA 1ICFA 4XUIA 2H7JA 2R9MA 3BCNA 2P86A 2G6DA 3V6CA 1YK7A 2HH5A 1PPDA 1AIMA 1QDQA 3HHAA 2PNSA 1CPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1M A;  4KLB A;  2DCC A;  4QRV A;  5J94 A;  1F29 A;  1F2C A;  3IV2 A;  1MDW A;  3BPF A;  4BS6 A;  3H7D A;  1CSB B;  5PAD A;  2VHS A;  3NHE A;  3S3R A;  3WXG A;  3O0U A;  2DC9 A;  5EF4 A;  3PNR A;  1PCI A;  1HUC B;  1VSN A;  4WA6 A;  1POP A;  2NQA A;  2XU4 A;  3KW9 A;  7PCK A;  2DCB A;  3K8U A;  3F75 A;  2P0R A;  4ZUX U;  2OZ2 A;  3GCB A;  3KKU A;  3P5U A;  4X6H A;  4CDF B;  1A6R A;  1M6D A;  2AS8 A;  1MS6 A;  4CZW A;  1YT7 A;  1PAD A;  3CH3 X;  2JQF R;  1ITO A;  3AI8 A;  3P5X A;  2FYE A;  4BSQ A;  3BC3 A;  1MEG A;  2PBH A;  1NPZ A;  1U9Q X;  1AU4 A;  2C0Y A;  4MSX A;  1PBH A;  5CVO B;  2IBI A;  4MZO A;  2AUZ A;  1MHW A;  3K24 A;  3I06 A;  4RY2 A;  3OVZ A;  2DC8 A;  4FK5 A;  2OP3 A;  1TL9 A;  2E00 A;  3HWN A;  4BS5 A;  2HD5 A;  3IHP A;  2R9N A;  1JQP A;  1KFX L;  1XKG A;  2DC7 A;  1QXP A;  4G54 A;  4N8W A;  4Q8H A;  4W5C A;  1ME3 A;  1GMY A;  1AEC A;  3M99 A;  4QBB A;  3QSD A;  3H8B A;  2NQD B;  4YYS A;  3OVX A;  2E03 A;  3I3T A;  4YV8 A;  3HHI A;  2YJ2 A;  2G8E A;  4QH6 A;  3N3G A;  1FH0 A;  1CJL A;  1CS8 A;  4CDD B;  1U5I A;  1SP4 B;  2R9C A;  4YVA A;  3MTN A;  3KWB X;  4W4U A;  4CDE B;  2E01 A;  2XU3 A;  4AXM A;  1EWP A;  3KSE A;  3P5V A;  1DF0 A;  2AU1 A;  2NQI A;  4OEL A;  4P6G A;  3KWZ A;  2G7Y A;  3TNX A;  1GEC E;  2CB5 A;  1PE6 A;  5F02 A;  4BQV A;  4I04 A;  2O6X A;  1EWO A;  1PIP A;  1QMY A;  1NB5 A;  4DMX A;  2IPP B;  4BPV A;  4FIP A;  5CVN B;  2YJB A;  1KHP A;  1ZCM A;  1EWM A;  2DC6 A;  3C9E A;  3BWK A;  4K7C A;  3E1Z B;  3OIS A;  4P6E A;  4YYV A;  2YJC A;  2DJG B;  1TU6 A;  2F7D A;  2FRA A;  4I05 A;  9PAP A;  2FO5 A;  1YVB A;  4YYQ A;  2GHU A;  2ATO A;  3BPM A;  3N3K A;  4X6I A;  8PCH A;  2P7U A;  1U9V A;  3RVV A;  5CVM A;  3U8E A;  3USV A;  2PAD A;  3H89 A;  1STF E;  4X6J A;  4AXL A;  1EWL A;  1BQI A;  2AIM A;  5A24 A;  3KX1 A;  1MEM A;  1NL6 A;  4HWY A;  3BOW A;  2DZZ A;  3ZUA A;  2BDL A;  4DMY A;  4N4Z A;  2B1N A;  4YYW A;  1IWD A;  3D6S A;  2JQG R;  1YAL A;  1THE A;  3F5V A;  3MOR A;  3P5W A;  2R6N A;  1AU0 A;  5JH3 A;  1CB5 A;  1MIR A;  3WXF A;  1U9X A;  1PXV A;  1AU2 A;  3H6S A;  5JA7 A;  3CH2 X;  2AUX A;  1CV8 A;  4QRX A;  1CVZ A;  3PDF A;  2FTD A;  3V6E A;  5FPW A;  1X9Y A;  1GLO A;  3WXE A;  2Y5B A;  3OF8 A;  2GFO A;  5K16 A;  1KXR A;  1SNK A;  2FRQ A;  2YJ9 A;  1K3B B;  2AYO A;  4MZS A;  3MHH A;  1Y4H A;  2WBF X;  3B79 A;  1CTE A;  1O0E A;  4PP1 A;  2AYN A;  5EGW A;  4XR7 A;  2R9O A;  3PW3 A;  2YJ8 A;  2FUD A;  2VHF A;  2BDZ A;  3QJ3 A;  1CQD A;  1F2A A;  2CIO A;  2DCD A;  1Y08 A;  1NQC A;  2G8J A;  1KHQ A;  1BGO A;  4FJC A;  1NB3 A;  4YYU A;  1Q6K A;  3LXS A;  2FT2 A;  4PP2 E;  3DF0 A;  3HD3 A;  2DCA A;  1TLO A;  2ARY A;  4OEM A;  4CDC B;  2DJF B;  2HHN A;  2HXZ A;  1S4V A;  1ZIV A;  5CHV A;  3ERV A;  1AU3 A;  2DZY A;  1EF7 A;  3K9M A;  1DEU A;  2PRE A;  1VJV A;  3IOQ A;  4I07 A;  1U9W A;  1PPN A;  3CBJ A;  4YYR A;  1BP4 A;  1PPP A;  1AYV A;  2XU5 A;  3OF9 A;  3RVW A;  5CHT A;  2FQ9 A;  1GCB A;  2E02 A;  3S3Q A;  3KFQ A;  1YK8 A;  3O1G A;  4PAD A;  3CBK A;  3LFY A;  2F1G A;  1KFU L;  3IUT A;  3MHS A;  4QRG A;  3PBH A;  3IMA A;  1BY8 A;  1PPO A;  1ME4 A;  2XU1 A;  1ATK A;  2ACT A;  2R9F A;  2OUL A;  1NLJ A;  4W5B A;  1AYU A;  2AVW A;  3IEJ A;  6PAD A;  4Q8G A;  3N4C A;  3QT4 A;  1F2B A;  3H8C A;  4PI3 A;  2NQG A;  2Y6E A;  1AYW A;  4N79 A;  3RVX A;  1QOL A;  1ICF A;  4XUI A;  2H7J A;  2R9M A;  3BCN A;  2P86 A;  2G6D A;  3V6C A;  1YK7 A;  2HH5 A;  1PPD A;  1AIM A;  1QDQ A;  3HHA A;  2PNS A;  1CPJ A; 
#chains in the Genus database with same CATH topology
 2B1M A;  4KLB A;  2DCC A;  3B21 A;  4QRV A;  5J94 A;  1F29 A;  1F2C A;  3IV2 A;  1MDW A;  3BPF A;  4BS6 A;  3H7D A;  1CSB B;  5PAD A;  2VHS A;  3NHE A;  4BOU A;  3S3R A;  4RF1 A;  3WXG A;  3O0U A;  2DC9 A;  5EF4 A;  3PNR A;  1PCI A;  1HUC B;  1VSN A;  4WA6 A;  1POP A;  2NQA A;  2XU4 A;  3KW9 A;  7PCK A;  2DCB A;  3K8U A;  3F75 A;  3PRP A;  4BOZ A;  2P0R A;  4ZUX U;  2OZ2 A;  3GCB A;  3KKU A;  3P5U A;  4X6H A;  4CDF B;  1A6R A;  4OVZ B;  1M6D A;  2AS8 A;  1MS6 A;  4CZW A;  1YT7 A;  1PAD A;  2J7Q A;  3CH3 X;  2JQF R;  4D8E A;  1ITO A;  3AI8 A;  3P5X A;  2FYE A;  4BSQ A;  3BC3 A;  1MEG A;  2PBH A;  4D8B A;  1NPZ A;  1U9Q X;  1AU4 A;  4RKX A;  2C0Y A;  4MSX A;  1PBH A;  5CVO B;  2IBI A;  4MZO A;  2AUZ A;  1MHW A;  3K24 A;  3I06 A;  4RY2 A;  3OVZ A;  2DC8 A;  3PT2 A;  4FK5 A;  3O65 A;  2OP3 A;  1TL9 A;  2E00 A;  3HWN A;  4BS5 A;  2HD5 A;  3IHP A;  2R9N A;  3TMP A;  1JQP A;  1KFX L;  1XKG A;  2DC7 A;  1QXP A;  4G54 A;  4N8W A;  4Q8H A;  4REZ A;  2BU3 A;  4W5C A;  1ME3 A;  1GMY A;  4A5U A;  1AEC A;  3M99 A;  3MJ5 A;  1YZB A;  4OW0 A;  4QBB A;  3QSD A;  3MTV A;  2HWK A;  2NQD B;  3H8B A;  4YYS A;  3OVX A;  2E03 A;  2UZJ A;  3I3T A;  4YV8 A;  3HHI A;  4PT5 A;  2YJ2 A;  4BOQ A;  2G8E A;  4QH6 A;  3N3G A;  1FH0 A;  1CJL A;  1CS8 A;  4CDD B;  1U5I A;  1SP4 B;  3IFU A;  2R9C A;  4YVA A;  5EZS A;  3MTN A;  3KWB X;  4R3D A;  4W4U A;  4CDE B;  3W30 A;  3BY4 A;  2E01 A;  2BTW A;  2XU3 A;  4AXM A;  1EWP A;  3KSE A;  3P5V A;  1DF0 A;  2AU1 A;  2NQI A;  4OEL A;  4P6G A;  3KWZ A;  2G7Y A;  3TNX A;  4BOP A;  1GEC E;  2CB5 A;  2JRI A;  1PE6 A;  5F02 A;  4BQV A;  4I04 A;  2O6X A;  1EWO A;  1PIP A;  1QMY A;  1NB5 A;  4DMX A;  2FE8 A;  2IPP B;  4BPV A;  4FIP A;  5CVN B;  2YJB A;  1KHP A;  4IP3 A;  1ZCM A;  1EWM A;  2DC6 A;  3C9E A;  1PVJ A;  2DOS A;  3BWK A;  4K7C A;  3E1Z B;  3OIS A;  1UKF A;  4P6E A;  4YYV A;  3PHX A;  2YJC A;  2DJG B;  3W31 A;  1TU6 A;  2F7D A;  2FRA A;  4I05 A;  9PAP A;  2FO5 A;  1YVB A;  4YYQ A;  2GHU A;  2ATO A;  3BPM A;  3N3K A;  4X6I A;  8PCH A;  2BTW B;  2P7U A;  1U9V A;  3RVV A;  5CVM A;  3U8E A;  3USV A;  2PAD A;  3H89 A;  3ZNH A;  1STF E;  4X6J A;  4AXL A;  1EWL A;  1BQI A;  2AIM A;  5A24 A;  3KX1 A;  3TRK A;  1MEM A;  4D8I A;  1NL6 A;  4HWY A;  3BOW A;  2DZZ A;  3ZUA A;  2BDL A;  4DMY A;  4RF0 A;  4N4Z A;  2B1N A;  3BB7 A;  4YYW A;  1IWD A;  3D6S A;  3PSE A;  2JQG R;  1YAL A;  1THE A;  3F5V A;  3MOR A;  3BBA A;  1DKI A;  3P5W A;  2R6N A;  1AU0 A;  5JH3 A;  1CB5 A;  1MIR A;  3WXF A;  1U9X A;  1PXV A;  1AU2 A;  3H6S A;  5JA7 A;  3CH2 X;  2AUX A;  1CV8 A;  4QRX A;  1CVZ A;  3PDF A;  4MM3 B;  2FTD A;  4M0W A;  4ZTB A;  3V6E A;  5FPW A;  4HXD B;  1X9Y A;  1GLO A;  3WXE A;  2Y5B A;  3OF8 A;  2GFO A;  5K16 A;  1KXR A;  1SNK A;  2FRQ A;  2YJ9 A;  1K3B B;  3C0R A;  2AYO A;  4MZS A;  3MHH A;  1Y4H A;  2WBF X;  3B79 A;  1CTE A;  1O0E A;  4PP1 A;  2AYN A;  5EGW A;  4XR7 A;  2R9O A;  3RNV A;  3PW3 A;  2YJ8 A;  2FUD A;  2VHF A;  2BDZ A;  3QJ3 A;  1CQD A;  1F2A A;  3OQC A;  2CIO A;  2DCD A;  1Y08 A;  1NQC A;  4P16 A;  2G8J A;  1KHQ A;  1BGO A;  2JTC A;  4FJC A;  1NB3 A;  4YYU A;  1Q6K A;  3LXS A;  2FT2 A;  4PP2 E;  3DF0 A;  3HD3 A;  2DCA A;  1TLO A;  3PHW A;  2ARY A;  4OEM A;  4CDC B;  4XZX A;  2DJF B;  2HHN A;  2HXZ A;  5EZQ A;  1S4V A;  4GUA A;  1ZIV A;  5CHV A;  2AGA A;  3ERV A;  1AU3 A;  2DZY A;  1EF7 A;  3K9M A;  2J7Q C;  4IUM A;  1DEU A;  5JZE A;  2PRE A;  1VJV A;  3IOQ A;  4I07 A;  1U9W A;  1PPN A;  3CBJ A;  2Z84 A;  4YYR A;  1BP4 A;  1PPP A;  1AYV A;  5KO3 A;  2XU5 A;  3OF9 A;  3RVW A;  5CHT A;  2FQ9 A;  4WUR A;  1GCB A;  2E02 A;  3S3Q A;  3KFQ A;  1YK8 A;  3O1G A;  4PAD A;  3CBK A;  3LFY A;  2F1G A;  1KFU L;  3IUT A;  3MHS A;  4QRG A;  3PBH A;  3IMA A;  1BY8 A;  1PPO A;  1ME4 A;  2XU1 A;  1ATK A;  2ACT A;  2R9F A;  2OUL A;  1NLJ A;  4W5B A;  1AYU A;  2AVW A;  3IEJ A;  6PAD A;  4Q8G A;  3N4C A;  5E6J A;  3QT4 A;  1F2B A;  3H8C A;  3E9S A;  3PRM A;  4PI3 A;  3PHU A;  2NQG A;  2Y6E A;  1AYW A;  4N79 A;  3RVX A;  4RNA A;  1QOL A;  1ICF A;  4XUI A;  4OVZ A;  2H7J A;  2R9M A;  3BCN A;  2P86 A;  2G6D A;  3V6C A;  1YK7 A;  2HH5 A;  1PPD A;  3MP2 A;  1AIM A;  4MI7 A;  1QDQ A;  3HHA A;  4BOS A;  2PNS A;  1CPJ A; 
#chains in the Genus database with same CATH homology
 2B1M A;  4KLB A;  2DCC A;  4QRV A;  5J94 A;  1F29 A;  1F2C A;  3IV2 A;  1MDW A;  3BPF A;  4BS6 A;  3H7D A;  1CSB B;  5PAD A;  2VHS A;  3NHE A;  3S3R A;  1W4T A;  3WXG A;  3O0U A;  2DC9 A;  5EF4 A;  3PNR A;  1PCI A;  1HUC B;  1VSN A;  4WA6 A;  1POP A;  2NQA A;  2XU4 A;  3KW9 A;  7PCK A;  2DCB A;  3LTW A;  3K8U A;  3F75 A;  2P0R A;  4ZUX U;  2OZ2 A;  3GCB A;  3KKU A;  3P5U A;  4X6H A;  4CDF B;  2VFB A;  1A6R A;  1M6D A;  2AS8 A;  1MS6 A;  4CZW A;  1YT7 A;  1PAD A;  3CH3 X;  2JQF R;  1ITO A;  3AI8 A;  3P5X A;  2FYE A;  4BSQ A;  3BC3 A;  1MEG A;  2PBH A;  1NPZ A;  1U9Q X;  1AU4 A;  2C0Y A;  4MSX A;  1E2T A;  1PBH A;  5CVO B;  2IBI A;  4MZO A;  2AUZ A;  1GX3 A;  1MHW A;  1W5R A;  3K24 A;  3I06 A;  4RY2 A;  3OVZ A;  2VFC A;  2DC8 A;  4FK5 A;  2OP3 A;  1TL9 A;  2E00 A;  3HWN A;  4BS5 A;  2HD5 A;  3IHP A;  2R9N A;  1JQP A;  1KFX L;  1XKG A;  2DC7 A;  1QXP A;  4G54 A;  4N8W A;  4Q8H A;  4W5C A;  1ME3 A;  1GMY A;  1AEC A;  3M99 A;  4QBB A;  3QSD A;  3H8B A;  2NQD B;  4YYS A;  3OVX A;  2E03 A;  3I3T A;  4YV8 A;  3HHI A;  2YJ2 A;  2G8E A;  4QH6 A;  3N3G A;  1FH0 A;  4BGF A;  1CJL A;  1CS8 A;  4CDD B;  1U5I A;  1SP4 B;  2R9C A;  4YVA A;  3MTN A;  3KWB X;  4W4U A;  4CDE B;  2E01 A;  2XU3 A;  4AXM A;  1EWP A;  3KSE A;  3P5V A;  1DF0 A;  2AU1 A;  2NQI A;  4OEL A;  4P6G A;  3KWZ A;  2G7Y A;  3TNX A;  1GEC E;  2CB5 A;  1PE6 A;  5F02 A;  4BQV A;  4I04 A;  2O6X A;  1EWO A;  1PIP A;  1QMY A;  1NB5 A;  4DMX A;  2IPP B;  4BPV A;  4FIP A;  5CVN B;  2YJB A;  1KHP A;  1ZCM A;  1EWM A;  2DC6 A;  3C9E A;  3BWK A;  4K7C A;  3E1Z B;  3OIS A;  4P6E A;  4YYV A;  2YJC A;  2DJG B;  1TU6 A;  2F7D A;  2FRA A;  4I05 A;  9PAP A;  2FO5 A;  1YVB A;  4YYQ A;  2GHU A;  2ATO A;  3BPM A;  3N3K A;  4X6I A;  8PCH A;  2P7U A;  1U9V A;  3RVV A;  5CVM A;  3U8E A;  3USV A;  2PAD A;  3H89 A;  1STF E;  4X6J A;  4AXL A;  1EWL A;  1BQI A;  2AIM A;  5A24 A;  3KX1 A;  1MEM A;  1NL6 A;  4HWY A;  3BOW A;  2DZZ A;  4B55 A;  3ZUA A;  2BDL A;  4DMY A;  4N4Z A;  2B1N A;  4YYW A;  1IWD A;  3D6S A;  2JQG R;  1YAL A;  1THE A;  3F5V A;  3MOR A;  3P5W A;  2R6N A;  1AU0 A;  5JH3 A;  4NV8 A;  1CB5 A;  1MIR A;  3WXF A;  1U9X A;  1PXV A;  1AU2 A;  3H6S A;  5JA7 A;  3CH2 X;  2AUX A;  1CV8 A;  4QRX A;  1CVZ A;  3PDF A;  2FTD A;  4GUZ A;  3V6E A;  5FPW A;  4NV7 A;  1W6F A;  1X9Y A;  1GLO A;  3WXE A;  2Y5B A;  3OF8 A;  2GFO A;  5K16 A;  1KXR A;  1SNK A;  2FRQ A;  2YJ9 A;  1K3B B;  2AYO A;  4MZS A;  3MHH A;  1Y4H A;  2WBF X;  3B79 A;  1CTE A;  1O0E A;  4PP1 A;  2AYN A;  5EGW A;  4XR7 A;  2R9O A;  3PW3 A;  2YJ8 A;  2FUD A;  2VHF A;  2BDZ A;  3QJ3 A;  1CQD A;  1F2A A;  2CIO A;  2DCD A;  1Y08 A;  1NQC A;  2G8J A;  1KHQ A;  1BGO A;  4FJC A;  1NB3 A;  4YYU A;  1Q6K A;  3LXS A;  2FT2 A;  4PP2 E;  3DF0 A;  3HD3 A;  2DCA A;  1TLO A;  2ARY A;  4OEM A;  4CDC B;  2DJF B;  2HHN A;  2HXZ A;  1S4V A;  1ZIV A;  5CHV A;  3ERV A;  1AU3 A;  2DZY A;  1EF7 A;  3K9M A;  1DEU A;  2PRE A;  1VJV A;  3IOQ A;  4I07 A;  1U9W A;  1PPN A;  3CBJ A;  4YYR A;  1BP4 A;  1PPP A;  1AYV A;  2XU5 A;  3OF9 A;  3RVW A;  5CHT A;  2FQ9 A;  1GCB A;  2E02 A;  3S3Q A;  3KFQ A;  1YK8 A;  3O1G A;  4PAD A;  3CBK A;  3LFY A;  2F1G A;  1KFU L;  3IUT A;  3MHS A;  4QRG A;  3PBH A;  3IMA A;  1BY8 A;  1PPO A;  2BSZ A;  1ME4 A;  2XU1 A;  3D9W A;  1ATK A;  2ACT A;  2R9F A;  2OUL A;  1NLJ A;  4W5B A;  1AYU A;  2AVW A;  3IEJ A;  6PAD A;  4Q8G A;  3N4C A;  3QT4 A;  1F2B A;  3H8C A;  4PI3 A;  4C5P A;  2NQG A;  2Y6E A;  1AYW A;  4N79 A;  3RVX A;  1QOL A;  1ICF A;  4XUI A;  2H7J A;  2R9M A;  3BCN A;  2P86 A;  2G6D A;  3V6C A;  1YK7 A;  2HH5 A;  1PPD A;  1AIM A;  1QDQ A;  3HHA A;  2PNS A;  1CPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...