3IMAA

Complex strcuture of tarocystatin and papain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex strcuture of tarocystatin and papain
rcsb
source organism Colocasia esculenta
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Papain
total genus 68
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3imaA00
4QH6A 3RVVA 1ICFA 3TNXA 1CQDA 3H8BA 2DJFB 2AUXA 3N4CA 4MSXA 2Y6EA 3M99A 2DCDA 1NB3A 4DMXA 5CVMA 2ARYA 1DF0A 4OELA 1QDQA 1TL9A 1CS8A 4N4ZA 4MZOA 3USVA 9PAPA 4PP2E 4WA6A 2F1GA 3IMAA 4QRGA 4ZUXU 1GECE 4DMYA 3O1GA 1POPA 2ATOA 4BQVA 2XU5A 3C9EA 2NQDB 2P0RA 5CVOB 3GCBA 3KWBX 5FPWA 1CVZA 2JQGR 4FJCA 1MS6A 1YALA 4Q8HA 4N79A 3HD3A 3MHHA 4XUIA 2AIMA 3LXSA 3N3KA 3ZUAA 6PADA 2CB5A 3N3GA 2OULA 1ATKA 2NQGA 5JH3A 1ZCMA 1CV8A 4N8WA 4I05A 2AS8A 2H7JA 1GLOA 1KHQA 1KFXL 2FYEA 2E01A 5CHTA 5J94A 3P5UA 1YK8A 2G7YA 3HHIA 1QMYA 1FH0A 3DF0A 3WXFA 1K3BB 1PIPA 2FRQA 4QRVA 3I06A 1Y4HA 4X6IA 1BY8A 2HH5A 2O6XA 5CVNB 2YJ8A 1MIRA 1AYVA 3K9MA 1VSNA 2DC8A 4I04A 2FO5A 3QT4A 3HWNA 1U9QX 4P6EA 3K8UA 1A6RA 2HD5A 2PBHA 3BWKA 4W4UA 3KKUA 1KXRA 3F75A 4PP1A 1PADA 1XKGA 3IUTA 1YT7A 1MEGA 4PADA 2YJCA 1M6DA 1AU4A 1NB5A 2P7UA 1S4VA 2GHUA 3BCNA 5EGWA 2IPPB 2OP3A 2BDZA 2FT2A 1ITOA 1EWPA 1CJLA 1QXPA 1PXVA 1U9VA 1AYUA 2Y5BA 1U9XA 1ME4A 1PBHA 3OISA 2VHFA 1ZIVA 4RY2A 2GFOA 3KX1A 2E02A 2YJ9A 3IOQA 2ACTA 1SP4B 2P86A 5CHVA 4CZWA 4PI3A 4YYRA 4FIPA 1CPJA 2DZZA 5EF4A 1TU6A 1EWOA 3B79A 1STFE 3OVXA 3P5WA 2CIOA 4KLBA 3WXEA 4CDFB 4CDCB 1NL6A 2B1NA 4YV8A 3ERVA 1U5IA 3BC3A 1GMYA 1PPOA 1NQCA 2OZ2A 4I07A 1Y08A 3D6SA 2R6NA 3BPFA 3CH3X 2PNSA 1AIMA 3PW3A 2F7DA 3S3RA 1HUCB 1F2AA 2AVWA 1PCIA 4MZSA 1BQIA 2AYNA 2DZYA 3AI8A 2YJBA 1KHPA 1MHWA 3V6EA 5A24A 4CDDB 4P6GA 4BS6A 4BSQA 4W5BA 2XU3A 3PDFA 3KSEA 1AU2A 1PPDA 1GCBA 2G8JA 2WBFX 3LFYA 3CH2X 1YVBA 3QJ3A 1AU0A 4CDEB 2AYOA 4BPVA 4YYQA 1VJVA 3H7DA 4AXLA 2DC9A 4X6JA 2NQAA 1YK7A 3RVXA 4YYSA 1QOLA 2R9FA 2R9CA 1SNKA 2XU1A 3MORA 1ME3A 4QRXA 3H6SA 2PADA 1PPPA 4X6HA 3O0UA 2FUDA 3IHPA 1CTEA 2DC7A 2XU4A 2DJGB 2C0YA 2G8EA 1CB5A 3IEJA 1KFUL 3P5VA 2FRAA 3QSDA 2NQIA 3PNRA 1BP4A 3CBJA 1X9YA 2VHSA 2E00A 1IWDA 4QBBA 5PADA 1MEMA 3IV2A 4YYWA 1DEUA 4HWYA 1NLJA 2DCAA 2FQ9A 1AECA 3H8CA 1EF7A 4G54A 1AU3A 3MHSA 1F2CA 1O0EA 2DCBA 3H89A 2AU1A 7PCKA 4OEMA 2R9MA 2JQFR 2DC6A 3U8EA 2FTDA 1Q6KA 3PBHA 3S3QA 8PCHA 1TLOA 4AXMA 4W5CA 3V6CA 4YYUA 5JA7A 1CSBB 3P5XA 1MDWA 4XR7A 3CBKA 4YVAA 1U9WA 1PE6A 1AYWA 2DCCA 1F29A 1EWMA 3KWZA 4Q8GA 2B1MA 3K24A 1PPNA 3KW9A 4K7CA 2PREA 2R9OA 3KFQA 2YJ2A 3BOWA 2IBIA 2AUZA 2HHNA 2G6DA 3RVWA 5F02A 1THEA 2E03A 3I3TA 3F5VA 3MTNA 3HHAA 1EWLA 5K16A 1BGOA 1NPZA 3E1ZB 4BS5A 3OF9A 3OF8A 3NHEA 1JQPA 2BDLA 2HXZA 4YYVA 1F2BA 2R9NA 4FK5A 3OVZA 3WXGA 3BPMA
chains in the Genus database with same CATH superfamily
4QH6A 3RVVA 5JZEA 3E9SA 1ICFA 3TNXA 1CQDA 3H8BA 2DJFB 2AUXA 3N4CA 4MSXA 2Y6EA 3M99A 2DCDA 1NB3A 4DMXA 5CVMA 2ARYA 1DF0A 4OELA 1QDQA 1TL9A 1CS8A 4N4ZA 4MZOA 3USVA 9PAPA 4PP2E 4WA6A 2F1GA 3IMAA 3PHXA 4QRGA 4ZUXU 1GECE 4DMYA 3O1GA 1POPA 2ATOA 4BQVA 2XU5A 4MI7A 3C9EA 2NQDB 2P0RA 5CVOB 4D8BA 3GCBA 3KWBX 5FPWA 4MM3B 1CVZA 2JQGR 3IFUA 4FJCA 1MS6A 1YALA 4Q8HA 4N79A 3HD3A 3MHHA 4XUIA 2AIMA 3LXSA 3N3KA 4WURA 3ZUAA 6PADA 3RNVA 4HXDB 2CB5A 3N3GA 2OULA 1ATKA 2NQGA 3W31A 5JH3A 1ZCMA 1CV8A 4N8WA 4I05A 2AS8A 2H7JA 1GLOA 1KHQA 1KFXL 2BU3A 2FYEA 2E01A 4ZTBA 5CHTA 4PT5A 2HWKA 5J94A 3P5UA 1YK8A 4R3DA 2G7YA 3HHIA 1QMYA 3PHWA 4D8IA 1FH0A 3DF0A 3WXFA 1K3BB 1PIPA 2FRQA 4QRVA 3I06A 1Y4HA 4X6IA 1BY8A 2HH5A 2O6XA 5CVNB 2YJ8A 1MIRA 1AYVA 3K9MA 1VSNA 2DC8A 4I04A 2FO5A 3QT4A 3HWNA 1U9QX 4P6EA 3K8UA 1A6RA 2HD5A 2PBHA 3BWKA 4W4UA 5EZSA 3KKUA 1KXRA 2BTWB 4BOZA 3F75A 4PP1A 1PADA 1XKGA 3IUTA 1YT7A 1MEGA 4BOSA 4PADA 2DOSA 2YJCA 1M6DA 1AU4A 4GUAA 1NB5A 2P7UA 4M0WA 1S4VA 2GHUA 3BCNA 5EGWA 2IPPB 2OP3A 2BDZA 2FT2A 1ITOA 1EWPA 1CJLA 1QXPA 2AGAA 1PXVA 1U9VA 1AYUA 2Y5BA 4XZXA 3PT2A 1U9XA 1ME4A 1PBHA 4RNAA 3OISA 2VHFA 1ZIVA 4RY2A 2GFOA 3BY4A 3KX1A 2E02A 1DKIA 1UKFA 2YJ9A 3IOQA 2ACTA 1SP4B 2P86A 5CHVA 4CZWA 4PI3A 4YYRA 4FIPA 3PHUA 1CPJA 2DZZA 5EF4A 1TU6A 1EWOA 3B79A 1STFE 2BTWA 3MP2A 4D8EA 3OVXA 3TMPA 3B21A 3P5WA 2CIOA 4KLBA 3WXEA 4RF0A 2UZJA 4CDFB 4CDCB 1NL6A 2B1NA 4YV8A 3ERVA 1U5IA 3BC3A 1GMYA 1PPOA 1NQCA 2OZ2A 3MJ5A 1Y08A 4I07A 3D6SA 2R6NA 3BPFA 3CH3X 2PNSA 1AIMA 3PW3A 2F7DA 3S3RA 1HUCB 1F2AA 2AVWA 1PCIA 4MZSA 1BQIA 2AYNA 4OVZB 2DZYA 3AI8A 2YJBA 1KHPA 2J7QC 1MHWA 3V6EA 5A24A 4CDDB 1PVJA 4P6GA 4BS6A 3BBAA 4BSQA 4W5BA 2XU3A 3PDFA 4OW0A 3KSEA 1AU2A 1PPDA 1GCBA 2G8JA 2WBFX 3LFYA 3CH2X 1YVBA 3TRKA 3QJ3A 1AU0A 2FE8A 4CDEB 2AYOA 4BPVA 4YYQA 1VJVA 5E6JA 3H7DA 4AXLA 2DC9A 4X6JA 2NQAA 1YK7A 3RVXA 3PRPA 4YYSA 1QOLA 2JRIA 2R9FA 5EZQA 2R9CA 1SNKA 2XU1A 3MORA 1ME3A 4A5UA 4QRXA 3H6SA 2PADA 1PPPA 4X6HA 3O0UA 4RKXA 2FUDA 3IHPA 1CTEA 4BOQA 2DC7A 2XU4A 2DJGB 2C0YA 2G8EA 1CB5A 1YZBA 3IEJA 1KFUL 3P5VA 2FRAA 3QSDA 2NQIA 3PNRA 1BP4A 3CBJA 1X9YA 2VHSA 2E00A 1IWDA 4QBBA 4RF1A 1MEMA 5PADA 3IV2A 4YYWA 1DEUA 4HWYA 1NLJA 2DCAA 2FQ9A 1AECA 3H8CA 1EF7A 4G54A 1AU3A 3MTVA 3O65A 3MHSA 1F2CA 1O0EA 2DCBA 3H89A 2AU1A 7PCKA 4OEMA 2R9MA 2JQFR 2DC6A 4REZA 3U8EA 2FTDA 1Q6KA 2JTCA 3PBHA 3PRMA 4BOPA 3S3QA 8PCHA 1TLOA 4AXMA 4W5CA 3V6CA 4YYUA 5JA7A 1CSBB 3P5XA 1MDWA 4XR7A 3C0RA 3CBKA 4YVAA 3BB7A 4P16A 1U9WA 1PE6A 3PSEA 1AYWA 2DCCA 5KO3A 1F29A 1EWMA 3KWZA 4Q8GA 2B1MA 3K24A 1PPNA 3KW9A 4K7CA 2PREA 2R9OA 3KFQA 2YJ2A 3BOWA 3W30A 2IBIA 2AUZA 2HHNA 2Z84A 2G6DA 3RVWA 5F02A 1THEA 2E03A 3I3TA 3F5VA 3MTNA 3OQCA 3HHAA 1EWLA 4BOUA 5K16A 1BGOA 1NPZA 3E1ZB 4BS5A 3OF9A 3OF8A 4OVZA 2J7QA 3NHEA 1JQPA 2BDLA 4IP3A 2HXZA 3ZNHA 4YYVA 4IUMA 1F2BA 2R9NA 4FK5A 3OVZA 3WXGA 3BPMA
chains in the Genus database with same CATH topology
4QH6A 3RVVA 1ICFA 3TNXA 1CQDA 3H8BA 2DJFB 2AUXA 3N4CA 4MSXA 1E2TA 2Y6EA 3M99A 2DCDA 1NB3A 4DMXA 5CVMA 2ARYA 1DF0A 4OELA 1QDQA 1TL9A 1CS8A 4N4ZA 4MZOA 3USVA 9PAPA 4PP2E 4WA6A 2F1GA 3IMAA 4QRGA 4ZUXU 1GECE 4DMYA 3O1GA 1POPA 2ATOA 4BQVA 2XU5A 3C9EA 2NQDB 2P0RA 5CVOB 3GCBA 3KWBX 5FPWA 1CVZA 2JQGR 4FJCA 1MS6A 1YALA 4Q8HA 4N79A 3HD3A 3MHHA 4XUIA 2AIMA 3LXSA 3N3KA 3ZUAA 6PADA 2CB5A 3N3GA 2OULA 1ATKA 4BGFA 2NQGA 5JH3A 1ZCMA 1CV8A 4N8WA 4I05A 2AS8A 2BSZA 2H7JA 1GLOA 1W5RA 1KHQA 1KFXL 2FYEA 2E01A 5CHTA 5J94A 3P5UA 1YK8A 2G7YA 3HHIA 1QMYA 1FH0A 3DF0A 3WXFA 1K3BB 1PIPA 2FRQA 1W4TA 4QRVA 3I06A 1Y4HA 4X6IA 1BY8A 2HH5A 2O6XA 5CVNB 2YJ8A 1MIRA 1AYVA 3K9MA 1VSNA 2DC8A 4I04A 2FO5A 3QT4A 3HWNA 1U9QX 4P6EA 3K8UA 1A6RA 2HD5A 2PBHA 3BWKA 4W4UA 3KKUA 1KXRA 3F75A 4PP1A 1PADA 1XKGA 3IUTA 1YT7A 1MEGA 4PADA 2YJCA 1M6DA 1AU4A 1NB5A 2P7UA 1S4VA 2GHUA 3BCNA 5EGWA 2IPPB 2OP3A 2BDZA 2FT2A 1ITOA 1EWPA 1CJLA 1QXPA 1PXVA 1U9VA 1AYUA 2Y5BA 1U9XA 1ME4A 1PBHA 3OISA 2VHFA 1ZIVA 4RY2A 2GFOA 3KX1A 2E02A 2YJ9A 3IOQA 2ACTA 1SP4B 2P86A 5CHVA 4B55A 4CZWA 4PI3A 4YYRA 4FIPA 1CPJA 2DZZA 5EF4A 1TU6A 1EWOA 3B79A 1STFE 3OVXA 3P5WA 2CIOA 4KLBA 3WXEA 4CDFB 4CDCB 3LTWA 1NL6A 2B1NA 4YV8A 3ERVA 1U5IA 3BC3A 1GMYA 1PPOA 1NQCA 2OZ2A 4I07A 1Y08A 3D6SA 2R6NA 3BPFA 3CH3X 2PNSA 1AIMA 3PW3A 2F7DA 3S3RA 1HUCB 1F2AA 2AVWA 1PCIA 4MZSA 1BQIA 2AYNA 2DZYA 3AI8A 2YJBA 1KHPA 1MHWA 3V6EA 5A24A 4C5PA 4CDDB 4P6GA 4BS6A 4BSQA 4W5BA 2XU3A 3PDFA 3KSEA 1AU2A 1PPDA 1GCBA 2G8JA 2WBFX 3LFYA 3CH2X 1YVBA 3QJ3A 1AU0A 4CDEB 2AYOA 4BPVA 4YYQA 1VJVA 3H7DA 4AXLA 2DC9A 2VFCA 4X6JA 2NQAA 1YK7A 3RVXA 4YYSA 1QOLA 2R9FA 2R9CA 1SNKA 2XU1A 3MORA 1ME3A 4QRXA 3H6SA 2PADA 1PPPA 4X6HA 3O0UA 2FUDA 3IHPA 1CTEA 2DC7A 2XU4A 2DJGB 2C0YA 2G8EA 1CB5A 3IEJA 1KFUL 3P5VA 2FRAA 3QSDA 2NQIA 3PNRA 1BP4A 3CBJA 1X9YA 2VHSA 2E00A 1IWDA 4QBBA 5PADA 1MEMA 3IV2A 4YYWA 1DEUA 4HWYA 1NLJA 2DCAA 2FQ9A 1AECA 3H8CA 1EF7A 4G54A 1AU3A 3MHSA 4GUZA 1F2CA 1O0EA 2DCBA 3H89A 1W6FA 2AU1A 7PCKA 4OEMA 2R9MA 2JQFR 2DC6A 3U8EA 2FTDA 1Q6KA 3PBHA 3S3QA 8PCHA 1TLOA 4AXMA 4W5CA 3V6CA 4YYUA 5JA7A 1CSBB 3P5XA 1MDWA 4XR7A 3CBKA 4YVAA 4NV7A 4NV8A 3D9WA 1U9WA 1PE6A 1AYWA 2DCCA 1F29A 1EWMA 3KWZA 4Q8GA 2B1MA 3K24A 1PPNA 3KW9A 4K7CA 2PREA 2R9OA 3KFQA 2YJ2A 3BOWA 2IBIA 2AUZA 2HHNA 2G6DA 3RVWA 5F02A 1THEA 2E03A 3I3TA 3F5VA 3MTNA 3HHAA 1GX3A 1EWLA 5K16A 1BGOA 1NPZA 3E1ZB 4BS5A 3OF9A 3OF8A 3NHEA 1JQPA 2BDLA 2HXZA 4YYVA 1F2BA 2R9NA 4FK5A 3OVZA 3WXGA 3BPMA 2VFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH6 A;  3RVV A;  1ICF A;  3TNX A;  1CQD A;  3H8B A;  2DJF B;  2AUX A;  3N4C A;  4MSX A;  2Y6E A;  3M99 A;  2DCD A;  1NB3 A;  4DMX A;  5CVM A;  2ARY A;  1DF0 A;  4OEL A;  1QDQ A;  1TL9 A;  1CS8 A;  4N4Z A;  4MZO A;  3USV A;  9PAP A;  4PP2 E;  4WA6 A;  2F1G A;  3IMA A;  4QRG A;  4ZUX U;  1GEC E;  4DMY A;  3O1G A;  1POP A;  2ATO A;  4BQV A;  2XU5 A;  3C9E A;  2NQD B;  2P0R A;  5CVO B;  3GCB A;  3KWB X;  5FPW A;  1CVZ A;  2JQG R;  4FJC A;  1MS6 A;  1YAL A;  4Q8H A;  4N79 A;  3HD3 A;  3MHH A;  4XUI A;  2AIM A;  3LXS A;  3N3K A;  3ZUA A;  6PAD A;  2CB5 A;  3N3G A;  2OUL A;  1ATK A;  2NQG A;  5JH3 A;  1ZCM A;  1CV8 A;  4N8W A;  4I05 A;  2AS8 A;  2H7J A;  1GLO A;  1KHQ A;  1KFX L;  2FYE A;  2E01 A;  5CHT A;  5J94 A;  3P5U A;  1YK8 A;  2G7Y A;  3HHI A;  1QMY A;  1FH0 A;  3DF0 A;  3WXF A;  1K3B B;  1PIP A;  2FRQ A;  4QRV A;  3I06 A;  1Y4H A;  4X6I A;  1BY8 A;  2HH5 A;  2O6X A;  5CVN B;  2YJ8 A;  1MIR A;  1AYV A;  3K9M A;  1VSN A;  2DC8 A;  4I04 A;  2FO5 A;  3QT4 A;  3HWN A;  1U9Q X;  4P6E A;  3K8U A;  1A6R A;  2HD5 A;  2PBH A;  3BWK A;  4W4U A;  3KKU A;  1KXR A;  3F75 A;  4PP1 A;  1PAD A;  1XKG A;  3IUT A;  1YT7 A;  1MEG A;  4PAD A;  2YJC A;  1M6D A;  1AU4 A;  1NB5 A;  2P7U A;  1S4V A;  2GHU A;  3BCN A;  5EGW A;  2IPP B;  2OP3 A;  2BDZ A;  2FT2 A;  1ITO A;  1EWP A;  1CJL A;  1QXP A;  1PXV A;  1U9V A;  1AYU A;  2Y5B A;  1U9X A;  1ME4 A;  1PBH A;  3OIS A;  2VHF A;  1ZIV A;  4RY2 A;  2GFO A;  3KX1 A;  2E02 A;  2YJ9 A;  3IOQ A;  2ACT A;  1SP4 B;  2P86 A;  5CHV A;  4CZW A;  4PI3 A;  4YYR A;  4FIP A;  1CPJ A;  2DZZ A;  5EF4 A;  1TU6 A;  1EWO A;  3B79 A;  1STF E;  3OVX A;  3P5W A;  2CIO A;  4KLB A;  3WXE A;  4CDF B;  4CDC B;  1NL6 A;  2B1N A;  4YV8 A;  3ERV A;  1U5I A;  3BC3 A;  1GMY A;  1PPO A;  1NQC A;  2OZ2 A;  4I07 A;  1Y08 A;  3D6S A;  2R6N A;  3BPF A;  3CH3 X;  2PNS A;  1AIM A;  3PW3 A;  2F7D A;  3S3R A;  1HUC B;  1F2A A;  2AVW A;  1PCI A;  4MZS A;  1BQI A;  2AYN A;  2DZY A;  3AI8 A;  2YJB A;  1KHP A;  1MHW A;  3V6E A;  5A24 A;  4CDD B;  4P6G A;  4BS6 A;  4BSQ A;  4W5B A;  2XU3 A;  3PDF A;  3KSE A;  1AU2 A;  1PPD A;  1GCB A;  2G8J A;  2WBF X;  3LFY A;  3CH2 X;  1YVB A;  3QJ3 A;  1AU0 A;  4CDE B;  2AYO A;  4BPV A;  4YYQ A;  1VJV A;  3H7D A;  4AXL A;  2DC9 A;  4X6J A;  2NQA A;  1YK7 A;  3RVX A;  4YYS A;  1QOL A;  2R9F A;  2R9C A;  1SNK A;  2XU1 A;  3MOR A;  1ME3 A;  4QRX A;  3H6S A;  2PAD A;  1PPP A;  4X6H A;  3O0U A;  2FUD A;  3IHP A;  1CTE A;  2DC7 A;  2XU4 A;  2DJG B;  2C0Y A;  2G8E A;  1CB5 A;  3IEJ A;  1KFU L;  3P5V A;  2FRA A;  3QSD A;  2NQI A;  3PNR A;  1BP4 A;  3CBJ A;  1X9Y A;  2VHS A;  2E00 A;  1IWD A;  4QBB A;  5PAD A;  1MEM A;  3IV2 A;  4YYW A;  1DEU A;  4HWY A;  1NLJ A;  2DCA A;  2FQ9 A;  1AEC A;  3H8C A;  1EF7 A;  4G54 A;  1AU3 A;  3MHS A;  1F2C A;  1O0E A;  2DCB A;  3H89 A;  2AU1 A;  7PCK A;  4OEM A;  2R9M A;  2JQF R;  2DC6 A;  3U8E A;  2FTD A;  1Q6K A;  3PBH A;  3S3Q A;  8PCH A;  1TLO A;  4AXM A;  4W5C A;  3V6C A;  4YYU A;  5JA7 A;  1CSB B;  3P5X A;  1MDW A;  4XR7 A;  3CBK A;  4YVA A;  1U9W A;  1PE6 A;  1AYW A;  2DCC A;  1F29 A;  1EWM A;  3KWZ A;  4Q8G A;  2B1M A;  3K24 A;  1PPN A;  3KW9 A;  4K7C A;  2PRE A;  2R9O A;  3KFQ A;  2YJ2 A;  3BOW A;  2IBI A;  2AUZ A;  2HHN A;  2G6D A;  3RVW A;  5F02 A;  1THE A;  2E03 A;  3I3T A;  3F5V A;  3MTN A;  3HHA A;  1EWL A;  5K16 A;  1BGO A;  1NPZ A;  3E1Z B;  4BS5 A;  3OF9 A;  3OF8 A;  3NHE A;  1JQP A;  2BDL A;  2HXZ A;  4YYV A;  1F2B A;  2R9N A;  4FK5 A;  3OVZ A;  3WXG A;  3BPM A; 
#chains in the Genus database with same CATH topology
 4QH6 A;  3RVV A;  5JZE A;  3E9S A;  1ICF A;  3TNX A;  1CQD A;  3H8B A;  2DJF B;  2AUX A;  3N4C A;  4MSX A;  2Y6E A;  3M99 A;  2DCD A;  1NB3 A;  4DMX A;  5CVM A;  2ARY A;  1DF0 A;  4OEL A;  1QDQ A;  1TL9 A;  1CS8 A;  4N4Z A;  4MZO A;  3USV A;  9PAP A;  4PP2 E;  4WA6 A;  2F1G A;  3IMA A;  3PHX A;  4QRG A;  4ZUX U;  1GEC E;  4DMY A;  3O1G A;  1POP A;  2ATO A;  4BQV A;  2XU5 A;  4MI7 A;  3C9E A;  2NQD B;  2P0R A;  5CVO B;  4D8B A;  3GCB A;  3KWB X;  5FPW A;  4MM3 B;  1CVZ A;  2JQG R;  3IFU A;  4FJC A;  1MS6 A;  1YAL A;  4Q8H A;  4N79 A;  3HD3 A;  3MHH A;  4XUI A;  2AIM A;  3LXS A;  3N3K A;  4WUR A;  3ZUA A;  6PAD A;  3RNV A;  4HXD B;  2CB5 A;  3N3G A;  2OUL A;  1ATK A;  2NQG A;  3W31 A;  5JH3 A;  1ZCM A;  1CV8 A;  4N8W A;  4I05 A;  2AS8 A;  2H7J A;  1GLO A;  1KHQ A;  1KFX L;  2BU3 A;  2FYE A;  2E01 A;  4ZTB A;  5CHT A;  4PT5 A;  2HWK A;  5J94 A;  3P5U A;  1YK8 A;  4R3D A;  2G7Y A;  3HHI A;  1QMY A;  3PHW A;  4D8I A;  1FH0 A;  3DF0 A;  3WXF A;  1K3B B;  1PIP A;  2FRQ A;  4QRV A;  3I06 A;  1Y4H A;  4X6I A;  1BY8 A;  2HH5 A;  2O6X A;  5CVN B;  2YJ8 A;  1MIR A;  1AYV A;  3K9M A;  1VSN A;  2DC8 A;  4I04 A;  2FO5 A;  3QT4 A;  3HWN A;  1U9Q X;  4P6E A;  3K8U A;  1A6R A;  2HD5 A;  2PBH A;  3BWK A;  4W4U A;  5EZS A;  3KKU A;  1KXR A;  2BTW B;  4BOZ A;  3F75 A;  4PP1 A;  1PAD A;  1XKG A;  3IUT A;  1YT7 A;  1MEG A;  4BOS A;  4PAD A;  2DOS A;  2YJC A;  1M6D A;  1AU4 A;  4GUA A;  1NB5 A;  2P7U A;  4M0W A;  1S4V A;  2GHU A;  3BCN A;  5EGW A;  2IPP B;  2OP3 A;  2BDZ A;  2FT2 A;  1ITO A;  1EWP A;  1CJL A;  1QXP A;  2AGA A;  1PXV A;  1U9V A;  1AYU A;  2Y5B A;  4XZX A;  3PT2 A;  1U9X A;  1ME4 A;  1PBH A;  4RNA A;  3OIS A;  2VHF A;  1ZIV A;  4RY2 A;  2GFO A;  3BY4 A;  3KX1 A;  2E02 A;  1DKI A;  1UKF A;  2YJ9 A;  3IOQ A;  2ACT A;  1SP4 B;  2P86 A;  5CHV A;  4CZW A;  4PI3 A;  4YYR A;  4FIP A;  3PHU A;  1CPJ A;  2DZZ A;  5EF4 A;  1TU6 A;  1EWO A;  3B79 A;  1STF E;  2BTW A;  3MP2 A;  4D8E A;  3OVX A;  3TMP A;  3B21 A;  3P5W A;  2CIO A;  4KLB A;  3WXE A;  4RF0 A;  2UZJ A;  4CDF B;  4CDC B;  1NL6 A;  2B1N A;  4YV8 A;  3ERV A;  1U5I A;  3BC3 A;  1GMY A;  1PPO A;  1NQC A;  2OZ2 A;  3MJ5 A;  1Y08 A;  4I07 A;  3D6S A;  2R6N A;  3BPF A;  3CH3 X;  2PNS A;  1AIM A;  3PW3 A;  2F7D A;  3S3R A;  1HUC B;  1F2A A;  2AVW A;  1PCI A;  4MZS A;  1BQI A;  2AYN A;  4OVZ B;  2DZY A;  3AI8 A;  2YJB A;  1KHP A;  2J7Q C;  1MHW A;  3V6E A;  5A24 A;  4CDD B;  1PVJ A;  4P6G A;  4BS6 A;  3BBA A;  4BSQ A;  4W5B A;  2XU3 A;  3PDF A;  4OW0 A;  3KSE A;  1AU2 A;  1PPD A;  1GCB A;  2G8J A;  2WBF X;  3LFY A;  3CH2 X;  1YVB A;  3TRK A;  3QJ3 A;  1AU0 A;  2FE8 A;  4CDE B;  2AYO A;  4BPV A;  4YYQ A;  1VJV A;  5E6J A;  3H7D A;  4AXL A;  2DC9 A;  4X6J A;  2NQA A;  1YK7 A;  3RVX A;  3PRP A;  4YYS A;  1QOL A;  2JRI A;  2R9F A;  5EZQ A;  2R9C A;  1SNK A;  2XU1 A;  3MOR A;  1ME3 A;  4A5U A;  4QRX A;  3H6S A;  2PAD A;  1PPP A;  4X6H A;  3O0U A;  4RKX A;  2FUD A;  3IHP A;  1CTE A;  4BOQ A;  2DC7 A;  2XU4 A;  2DJG B;  2C0Y A;  2G8E A;  1CB5 A;  1YZB A;  3IEJ A;  1KFU L;  3P5V A;  2FRA A;  3QSD A;  2NQI A;  3PNR A;  1BP4 A;  3CBJ A;  1X9Y A;  2VHS A;  2E00 A;  1IWD A;  4QBB A;  4RF1 A;  1MEM A;  5PAD A;  3IV2 A;  4YYW A;  1DEU A;  4HWY A;  1NLJ A;  2DCA A;  2FQ9 A;  1AEC A;  3H8C A;  1EF7 A;  4G54 A;  1AU3 A;  3MTV A;  3O65 A;  3MHS A;  1F2C A;  1O0E A;  2DCB A;  3H89 A;  2AU1 A;  7PCK A;  4OEM A;  2R9M A;  2JQF R;  2DC6 A;  4REZ A;  3U8E A;  2FTD A;  1Q6K A;  2JTC A;  3PBH A;  3PRM A;  4BOP A;  3S3Q A;  8PCH A;  1TLO A;  4AXM A;  4W5C A;  3V6C A;  4YYU A;  5JA7 A;  1CSB B;  3P5X A;  1MDW A;  4XR7 A;  3C0R A;  3CBK A;  4YVA A;  3BB7 A;  4P16 A;  1U9W A;  1PE6 A;  3PSE A;  1AYW A;  2DCC A;  5KO3 A;  1F29 A;  1EWM A;  3KWZ A;  4Q8G A;  2B1M A;  3K24 A;  1PPN A;  3KW9 A;  4K7C A;  2PRE A;  2R9O A;  3KFQ A;  2YJ2 A;  3BOW A;  3W30 A;  2IBI A;  2AUZ A;  2HHN A;  2Z84 A;  2G6D A;  3RVW A;  5F02 A;  1THE A;  2E03 A;  3I3T A;  3F5V A;  3MTN A;  3OQC A;  3HHA A;  1EWL A;  4BOU A;  5K16 A;  1BGO A;  1NPZ A;  3E1Z B;  4BS5 A;  3OF9 A;  3OF8 A;  4OVZ A;  2J7Q A;  3NHE A;  1JQP A;  2BDL A;  4IP3 A;  2HXZ A;  3ZNH A;  4YYV A;  4IUM A;  1F2B A;  2R9N A;  4FK5 A;  3OVZ A;  3WXG A;  3BPM A; 
#chains in the Genus database with same CATH homology
 4QH6 A;  3RVV A;  1ICF A;  3TNX A;  1CQD A;  3H8B A;  2DJF B;  2AUX A;  3N4C A;  4MSX A;  1E2T A;  2Y6E A;  3M99 A;  2DCD A;  1NB3 A;  4DMX A;  5CVM A;  2ARY A;  1DF0 A;  4OEL A;  1QDQ A;  1TL9 A;  1CS8 A;  4N4Z A;  4MZO A;  3USV A;  9PAP A;  4PP2 E;  4WA6 A;  2F1G A;  3IMA A;  4QRG A;  4ZUX U;  1GEC E;  4DMY A;  3O1G A;  1POP A;  2ATO A;  4BQV A;  2XU5 A;  3C9E A;  2NQD B;  2P0R A;  5CVO B;  3GCB A;  3KWB X;  5FPW A;  1CVZ A;  2JQG R;  4FJC A;  1MS6 A;  1YAL A;  4Q8H A;  4N79 A;  3HD3 A;  3MHH A;  4XUI A;  2AIM A;  3LXS A;  3N3K A;  3ZUA A;  6PAD A;  2CB5 A;  3N3G A;  2OUL A;  1ATK A;  4BGF A;  2NQG A;  5JH3 A;  1ZCM A;  1CV8 A;  4N8W A;  4I05 A;  2AS8 A;  2BSZ A;  2H7J A;  1GLO A;  1W5R A;  1KHQ A;  1KFX L;  2FYE A;  2E01 A;  5CHT A;  5J94 A;  3P5U A;  1YK8 A;  2G7Y A;  3HHI A;  1QMY A;  1FH0 A;  3DF0 A;  3WXF A;  1K3B B;  1PIP A;  2FRQ A;  1W4T A;  4QRV A;  3I06 A;  1Y4H A;  4X6I A;  1BY8 A;  2HH5 A;  2O6X A;  5CVN B;  2YJ8 A;  1MIR A;  1AYV A;  3K9M A;  1VSN A;  2DC8 A;  4I04 A;  2FO5 A;  3QT4 A;  3HWN A;  1U9Q X;  4P6E A;  3K8U A;  1A6R A;  2HD5 A;  2PBH A;  3BWK A;  4W4U A;  3KKU A;  1KXR A;  3F75 A;  4PP1 A;  1PAD A;  1XKG A;  3IUT A;  1YT7 A;  1MEG A;  4PAD A;  2YJC A;  1M6D A;  1AU4 A;  1NB5 A;  2P7U A;  1S4V A;  2GHU A;  3BCN A;  5EGW A;  2IPP B;  2OP3 A;  2BDZ A;  2FT2 A;  1ITO A;  1EWP A;  1CJL A;  1QXP A;  1PXV A;  1U9V A;  1AYU A;  2Y5B A;  1U9X A;  1ME4 A;  1PBH A;  3OIS A;  2VHF A;  1ZIV A;  4RY2 A;  2GFO A;  3KX1 A;  2E02 A;  2YJ9 A;  3IOQ A;  2ACT A;  1SP4 B;  2P86 A;  5CHV A;  4B55 A;  4CZW A;  4PI3 A;  4YYR A;  4FIP A;  1CPJ A;  2DZZ A;  5EF4 A;  1TU6 A;  1EWO A;  3B79 A;  1STF E;  3OVX A;  3P5W A;  2CIO A;  4KLB A;  3WXE A;  4CDF B;  4CDC B;  3LTW A;  1NL6 A;  2B1N A;  4YV8 A;  3ERV A;  1U5I A;  3BC3 A;  1GMY A;  1PPO A;  1NQC A;  2OZ2 A;  4I07 A;  1Y08 A;  3D6S A;  2R6N A;  3BPF A;  3CH3 X;  2PNS A;  1AIM A;  3PW3 A;  2F7D A;  3S3R A;  1HUC B;  1F2A A;  2AVW A;  1PCI A;  4MZS A;  1BQI A;  2AYN A;  2DZY A;  3AI8 A;  2YJB A;  1KHP A;  1MHW A;  3V6E A;  5A24 A;  4C5P A;  4CDD B;  4P6G A;  4BS6 A;  4BSQ A;  4W5B A;  2XU3 A;  3PDF A;  3KSE A;  1AU2 A;  1PPD A;  1GCB A;  2G8J A;  2WBF X;  3LFY A;  3CH2 X;  1YVB A;  3QJ3 A;  1AU0 A;  4CDE B;  2AYO A;  4BPV A;  4YYQ A;  1VJV A;  3H7D A;  4AXL A;  2DC9 A;  2VFC A;  4X6J A;  2NQA A;  1YK7 A;  3RVX A;  4YYS A;  1QOL A;  2R9F A;  2R9C A;  1SNK A;  2XU1 A;  3MOR A;  1ME3 A;  4QRX A;  3H6S A;  2PAD A;  1PPP A;  4X6H A;  3O0U A;  2FUD A;  3IHP A;  1CTE A;  2DC7 A;  2XU4 A;  2DJG B;  2C0Y A;  2G8E A;  1CB5 A;  3IEJ A;  1KFU L;  3P5V A;  2FRA A;  3QSD A;  2NQI A;  3PNR A;  1BP4 A;  3CBJ A;  1X9Y A;  2VHS A;  2E00 A;  1IWD A;  4QBB A;  5PAD A;  1MEM A;  3IV2 A;  4YYW A;  1DEU A;  4HWY A;  1NLJ A;  2DCA A;  2FQ9 A;  1AEC A;  3H8C A;  1EF7 A;  4G54 A;  1AU3 A;  3MHS A;  4GUZ A;  1F2C A;  1O0E A;  2DCB A;  3H89 A;  1W6F A;  2AU1 A;  7PCK A;  4OEM A;  2R9M A;  2JQF R;  2DC6 A;  3U8E A;  2FTD A;  1Q6K A;  3PBH A;  3S3Q A;  8PCH A;  1TLO A;  4AXM A;  4W5C A;  3V6C A;  4YYU A;  5JA7 A;  1CSB B;  3P5X A;  1MDW A;  4XR7 A;  3CBK A;  4YVA A;  4NV7 A;  4NV8 A;  3D9W A;  1U9W A;  1PE6 A;  1AYW A;  2DCC A;  1F29 A;  1EWM A;  3KWZ A;  4Q8G A;  2B1M A;  3K24 A;  1PPN A;  3KW9 A;  4K7C A;  2PRE A;  2R9O A;  3KFQ A;  2YJ2 A;  3BOW A;  2IBI A;  2AUZ A;  2HHN A;  2G6D A;  3RVW A;  5F02 A;  1THE A;  2E03 A;  3I3T A;  3F5V A;  3MTN A;  3HHA A;  1GX3 A;  1EWL A;  5K16 A;  1BGO A;  1NPZ A;  3E1Z B;  4BS5 A;  3OF9 A;  3OF8 A;  3NHE A;  1JQP A;  2BDL A;  2HXZ A;  4YYV A;  1F2B A;  2R9N A;  4FK5 A;  3OVZ A;  3WXG A;  3BPM A;  2VFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...