3IMAA

Complex strcuture of tarocystatin and papain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain
publication title Complex strcuture of tarocystatin and papain
rcsb
source organism Colocasia esculenta
molecule tags Hydrolase/hydrolase inhibitor
total genus 68
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3imaA00
1VJVA 2XU5A 2JQGR 1BP4A 5CHVA 1JQPA 3H7DA 4PI3A 1NL6A 2E02A 2BDLA 4HWYA 2O6XA 4PADA 3TNXA 4CDCB 3DF0A 3H89A 4YV8A 3MORA 2P86A 3NHEA 4I07A 1IWDA 4WA6A 1PPPA 4PP1A 2AUXA 2FYEA 7PCKA 1U5IA 2YJ8A 9PAPA 2R9MA 2IBIA 4N4ZA 3AI8A 2DCAA 2OP3A 3S3RA 3KW9A 4MZOA 5A24A 1STFE 2AVWA 1PPNA 1YK8A 1KXRA 1MEGA 2YJ9A 4CZWA 3I06A 1VSNA 3O0UA 1ZCMA 3M99A 2YJBA 1DF0A 1F29A 2FUDA 1ZIVA 2NQAA 1POPA 1BQIA 4YYRA 1CB5A 1MHWA 2XU3A 1PXVA 3BOWA 1AU0A 1YT7A 4YYVA 2DJFB 3RVXA 1MIRA 1THEA 1EWOA 2NQDB 2CB5A 4CDEB 4FJCA 3F75A 3KX1A 4QRGA 1MEMA 3KWZA 5FPWA 1PBHA 4CDFB 2BDZA 2DZYA 1MDWA 2Y6EA 4DMYA 4N79A 4PP2E 1CQDA 2B1NA 2PREA 3OVXA 1AU3A 2G8JA 1EWMA 2E03A 2AU1A 2NQGA 4MZSA 1KHQA 1NLJA 5JH3A 2YJ2A 1S4VA 3P5XA 4Q8HA 3F5VA 1CTEA 1PCIA 1EWPA 2AS8A 2R6NA 3S3QA 1AU4A 1CPJA 1NQCA 1PPOA 2DCDA 4W4UA 1EWLA 4Q8GA 3MTNA 3KFQA 3IEJA 2FTDA 3USVA 8PCHA 4OELA 1U9QX 2ATOA 2G8EA 1U9VA 2FQ9A 4XUIA 2DC9A 4CDDB 2AYOA 3BWKA 2FO5A 3IHPA 2F7DA 3E1ZB 3ERVA 1NB3A 3RVWA 2ACTA 4OEMA 4AXLA 5PADA 4QH6A 2DZZA 3HHIA 3IOQA 5K16A 1YALA 1ME4A 2DJGB 1AIMA 5EF4A 1TLOA 2GFOA 4XR7A 5CHTA 1BY8A 3P5VA 3N3KA 2R9NA 4X6IA 1KFXL 1PIPA 2WBFX 1KFUL 3WXGA 1BGOA 2R9CA 3K9MA 2VHSA 4AXMA 2PBHA 2VHFA 2OZ2A 1GMYA 4KLBA 3OF8A 3KKUA 3H6SA 2R9OA 6PADA 1HUCB 4FK5A 2PADA 2E00A 3WXEA 3CH3X 1A6RA 1O0EA 3C9EA 3MHHA 3LXSA 4FIPA 3OVZA 3PDFA 2GHUA 4W5CA 4I05A 3GCBA 4YYUA 2YJCA 5CVOB 1F2BA 4DMXA 3BC3A 4BSQA 2AIMA 2E01A 3HWNA 1QXPA 3P5UA 2DCBA 2G7YA 1K3BB 3B79A 1CJLA 1QDQA 2H7JA 1QMYA 3QT4A 4I04A 4QRXA 5JA7A 2HD5A 4BQVA 4P6EA 2P7UA 2DC6A 3QJ3A 3KWBX 4BS6A 1U9XA 1PADA 1XKGA 2P0RA 1AECA 1KHPA 2G6DA 3IUTA 2IPPB 3V6CA 4YYSA 1EF7A 1SNKA 1SP4B 1ATKA 1M6DA 3P5WA 1ICFA 5EGWA 2B1MA 1ME3A 4K7CA 1Y4HA 2AUZA 1TU6A 4ZUXU 1CVZA 2PNSA 4N8WA 3BPMA 3HD3A 5J94A 3BPFA 1AU2A 2JQFR 3H8BA 2XU1A 4W5BA 3PNRA 2DC8A 3CBJA 2F1GA 2AYNA 1GLOA 3I3TA 1F2CA 1Q6KA 3BCNA 2C0YA 2DC7A 4QBBA 3CBKA 1PE6A 1YVBA 4BS5A 4X6HA 3N4CA 1NPZA 3N3GA 5F02A 1CS8A 1CV8A 3MHSA 1U9WA 4P6GA 3IV2A 3LFYA 3CH2X 2CIOA 3PBHA 1DEUA 3O1GA 4YYWA 5CVNB 3RVVA 4YYQA 3ZUAA 2HXZA 2DCCA 1ITOA 1X9YA 4RY2A 1Y08A 2ARYA 2FRAA 2OULA 1GCBA 1FH0A 3K24A 3KSEA 2HHNA 3U8EA 1F2AA 1YK7A 2R9FA 1GECE 3PW3A 2Y5BA 4X6JA 1NB5A 4MSXA 3IMAA 1PPDA 3D6SA 1QOLA 2FRQA 1AYUA 2NQIA 4YVAA 5CVMA 1MS6A 3K8UA 1AYVA 3OISA 4BPVA 2XU4A 1CSBB 2FT2A 3V6EA 3H8CA 1TL9A 3HHAA 2HH5A 1AYWA 4G54A 4QRVA 3WXFA 3QSDA 3OF9A
chains in the Genus database with same CATH superfamily
1VJVA 2XU5A 2JQGR 4MI7A 1BP4A 5CHVA 1JQPA 3H7DA 4PI3A 1NL6A 2E02A 2BDLA 4HWYA 2O6XA 2FE8A 3PHUA 4PADA 3TNXA 4CDCB 3DF0A 3H89A 4YV8A 3MORA 2P86A 3NHEA 4I07A 1IWDA 4WA6A 1PPPA 4PP1A 2AUXA 2FYEA 7PCKA 1U5IA 2YJ8A 9PAPA 2R9MA 2IBIA 4N4ZA 3AI8A 3O65A 2DCAA 1YZBA 2OP3A 3S3RA 3KW9A 4REZA 4MZOA 5A24A 1STFE 2AVWA 1PPNA 1YK8A 1KXRA 1MEGA 2YJ9A 4RF0A 4CZWA 3BB7A 3I06A 1VSNA 3O0UA 5EZSA 1ZCMA 3M99A 2YJBA 1DF0A 1F29A 2FUDA 1ZIVA 2NQAA 1POPA 1BQIA 4YYRA 1CB5A 1MHWA 2XU3A 1PXVA 3BBAA 3BOWA 1AU0A 1YT7A 4YYVA 2DJFB 3RVXA 2BTWA 1MIRA 1THEA 1EWOA 2NQDB 2CB5A 4CDEB 3PSEA 4FJCA 3F75A 2BU3A 3KX1A 4QRGA 1MEMA 3KWZA 5FPWA 1PBHA 4CDFB 2BDZA 2DZYA 4BOSA 1MDWA 2Y6EA 3PRPA 4DMYA 4N79A 4PP2E 1CQDA 4OVZA 2B1NA 2PREA 3OVXA 5E6JA 1AU3A 4R3DA 2G8JA 3MJ5A 1EWMA 2E03A 2AU1A 2NQGA 4MZSA 1KHQA 1NLJA 5JH3A 2YJ2A 1S4VA 3P5XA 3RNVA 4Q8HA 3F5VA 1CTEA 1PCIA 2Z84A 2J7QC 1EWPA 5KO3A 2AS8A 3C0RA 2R6NA 3S3QA 4MM3B 1DKIA 2AGAA 1AU4A 4D8EA 1CPJA 1NQCA 1PPOA 2DCDA 4W4UA 1UKFA 1EWLA 4Q8GA 3MTNA 3B21A 3KFQA 3IEJA 2FTDA 3USVA 8PCHA 4OELA 1U9QX 2ATOA 2G8EA 1U9VA 2FQ9A 4XUIA 2DC9A 4CDDB 2AYOA 2BTWB 3BWKA 2JTCA 2FO5A 3IHPA 2F7DA 3E1ZB 3ERVA 5EZQA 1NB3A 3RVWA 2ACTA 4OEMA 3PHWA 4AXLA 5PADA 5JZEA 3TRKA 4QH6A 4OVZB 2DZZA 3HHIA 3IOQA 5K16A 3PHXA 1YALA 1ME4A 2DJGB 1AIMA 5EF4A 1TLOA 2GFOA 4XR7A 5CHTA 1BY8A 3P5VA 3N3KA 2HWKA 2R9NA 4X6IA 1KFXL 1PIPA 3E9SA 3MTVA 2WBFX 1KFUL 2JRIA 3WXGA 1BGOA 2R9CA 3K9MA 2VHSA 4AXMA 2PBHA 4WURA 2VHFA 2OZ2A 1GMYA 4KLBA 3OF8A 4BOUA 3KKUA 3H6SA 2R9OA 6PADA 1HUCB 4FK5A 2PADA 2E00A 3WXEA 3CH3X 1A6RA 1O0EA 3C9EA 3MHHA 3PT2A 3LXSA 4FIPA 4BOPA 3TMPA 3OVZA 3PDFA 4IP3A 2GHUA 4W5CA 4I05A 4P16A 3GCBA 4YYUA 2YJCA 5CVOB 1F2BA 4DMXA 3BC3A 4BSQA 2AIMA 2E01A 3HWNA 4A5UA 1QXPA 3P5UA 2DCBA 2G7YA 1K3BB 3B79A 4D8BA 1CJLA 1QDQA 2H7JA 1QMYA 3QT4A 4I04A 4QRXA 5JA7A 2HD5A 4BQVA 3BY4A 4P6EA 2P7UA 2DC6A 3QJ3A 3KWBX 4BS6A 4RKXA 1U9XA 1PADA 1XKGA 2P0RA 1AECA 4IUMA 1KHPA 2G6DA 3IUTA 4XZXA 2IPPB 3V6CA 4YYSA 1EF7A 1SNKA 1SP4B 1ATKA 1M6DA 3P5WA 1ICFA 4GUAA 5EGWA 2B1MA 1ME3A 4K7CA 1Y4HA 2AUZA 1TU6A 3ZNHA 4ZUXU 1CVZA 2PNSA 4N8WA 3BPMA 3HD3A 5J94A 3BPFA 3MP2A 1AU2A 3OQCA 2JQFR 4OW0A 3H8BA 2XU1A 4W5BA 3PNRA 2DC8A 3CBJA 2F1GA 2AYNA 4M0WA 1GLOA 3I3TA 1F2CA 1Q6KA 3BCNA 2C0YA 2DC7A 4QBBA 3CBKA 1PE6A 4PT5A 4RNAA 1YVBA 4BS5A 4X6HA 3N4CA 3IFUA 1NPZA 3N3GA 5F02A 3W31A 1CS8A 1CV8A 3MHSA 1U9WA 4P6GA 3IV2A 4ZTBA 3LFYA 3CH2X 2CIOA 3PBHA 1DEUA 3O1GA 4D8IA 4BOQA 4YYWA 4BOZA 5CVNB 3RVVA 4YYQA 3ZUAA 2HXZA 2DCCA 1ITOA 1X9YA 4RY2A 1Y08A 2ARYA 2FRAA 2OULA 1GCBA 1FH0A 3K24A 3KSEA 4RF1A 2J7QA 2HHNA 3U8EA 1F2AA 1YK7A 3PRMA 2R9FA 1GECE 3PW3A 2Y5BA 4X6JA 1NB5A 4MSXA 3IMAA 1PPDA 3D6SA 1QOLA 2FRQA 1AYUA 2NQIA 4YVAA 5CVMA 1MS6A 3K8UA 1AYVA 3OISA 4HXDB 4BPVA 2XU4A 1CSBB 2FT2A 3V6EA 3H8CA 2DOSA 1TL9A 2UZJA 3W30A 3HHAA 1PVJA 2HH5A 1AYWA 4G54A 4QRVA 3WXFA 3QSDA 3OF9A
chains in the Genus database with same CATH topology
1VJVA 2XU5A 4C5PA 2JQGR 1BP4A 5CHVA 1JQPA 3H7DA 4PI3A 1NL6A 2E02A 2BDLA 3LTWA 4HWYA 2O6XA 4PADA 3TNXA 4CDCB 3DF0A 3H89A 4YV8A 3MORA 2P86A 3NHEA 4I07A 1IWDA 4WA6A 1PPPA 4PP1A 2AUXA 2FYEA 2VFCA 7PCKA 1U5IA 2YJ8A 9PAPA 2R9MA 2IBIA 4N4ZA 3AI8A 2DCAA 2OP3A 3S3RA 3KW9A 1W5RA 4MZOA 5A24A 1STFE 2AVWA 1PPNA 1YK8A 1KXRA 1MEGA 2YJ9A 4CZWA 3I06A 1VSNA 3O0UA 1ZCMA 3M99A 2YJBA 1DF0A 1F29A 2FUDA 1ZIVA 2NQAA 1POPA 1BQIA 4YYRA 1CB5A 1MHWA 2XU3A 1PXVA 3BOWA 1AU0A 1YT7A 4YYVA 2DJFB 3RVXA 1MIRA 1THEA 1EWOA 2NQDB 2CB5A 4CDEB 4FJCA 3F75A 3KX1A 4QRGA 1MEMA 3KWZA 5FPWA 1PBHA 4CDFB 2BDZA 2DZYA 1MDWA 2Y6EA 4DMYA 4N79A 4PP2E 1CQDA 2B1NA 2PREA 3OVXA 1AU3A 2G8JA 1EWMA 2E03A 2AU1A 2NQGA 4MZSA 1KHQA 1NLJA 5JH3A 2YJ2A 1S4VA 3P5XA 2VFBA 4Q8HA 3F5VA 1CTEA 1PCIA 1EWPA 2AS8A 2R6NA 3S3QA 4GUZA 1AU4A 1CPJA 1NQCA 1PPOA 2DCDA 4W4UA 1EWLA 4Q8GA 3MTNA 3KFQA 3IEJA 2FTDA 3USVA 8PCHA 4OELA 1U9QX 2ATOA 2G8EA 1U9VA 2FQ9A 4XUIA 2DC9A 4CDDB 2AYOA 3BWKA 2FO5A 3IHPA 2F7DA 3E1ZB 3ERVA 1NB3A 3RVWA 2ACTA 4OEMA 4AXLA 5PADA 4QH6A 2DZZA 3HHIA 4B55A 3IOQA 5K16A 1YALA 1ME4A 2DJGB 1AIMA 5EF4A 1TLOA 2GFOA 4XR7A 5CHTA 1BY8A 3P5VA 3N3KA 2R9NA 4X6IA 1KFXL 1PIPA 2WBFX 1KFUL 3WXGA 1BGOA 2R9CA 3K9MA 2VHSA 4AXMA 2PBHA 4BGFA 2VHFA 2OZ2A 1GMYA 4KLBA 3OF8A 3KKUA 3H6SA 2R9OA 6PADA 1HUCB 4FK5A 2PADA 2E00A 3WXEA 3CH3X 1A6RA 1O0EA 3C9EA 3MHHA 3LXSA 4FIPA 3OVZA 3PDFA 2GHUA 4W5CA 4I05A 3GCBA 4YYUA 2YJCA 5CVOB 1F2BA 4DMXA 3BC3A 4BSQA 2AIMA 2E01A 3HWNA 1QXPA 3P5UA 2DCBA 2G7YA 1K3BB 3B79A 1CJLA 1QDQA 2H7JA 1QMYA 3QT4A 4I04A 4QRXA 5JA7A 4NV7A 2HD5A 4BQVA 4P6EA 2P7UA 2DC6A 3QJ3A 3KWBX 4BS6A 3D9WA 1U9XA 1PADA 1XKGA 2P0RA 1AECA 1KHPA 2G6DA 3IUTA 2IPPB 3V6CA 4YYSA 1EF7A 1SNKA 1SP4B 1ATKA 1M6DA 3P5WA 1ICFA 5EGWA 2B1MA 1ME3A 4K7CA 1Y4HA 2AUZA 1TU6A 4ZUXU 1CVZA 2PNSA 4N8WA 3BPMA 3HD3A 5J94A 3BPFA 1W6FA 1AU2A 2JQFR 3H8BA 2XU1A 4W5BA 3PNRA 2DC8A 3CBJA 2F1GA 2AYNA 1GLOA 3I3TA 1F2CA 1Q6KA 3BCNA 2C0YA 2DC7A 4QBBA 3CBKA 1PE6A 1YVBA 4BS5A 4X6HA 3N4CA 1NPZA 3N3GA 5F02A 1CS8A 1CV8A 3MHSA 1U9WA 4P6GA 3IV2A 3LFYA 3CH2X 2CIOA 3PBHA 1DEUA 3O1GA 4YYWA 5CVNB 3RVVA 4YYQA 3ZUAA 2HXZA 2DCCA 1ITOA 1X9YA 1GX3A 4RY2A 1Y08A 2ARYA 2FRAA 2OULA 1GCBA 1FH0A 3K24A 3KSEA 1W4TA 2HHNA 3U8EA 1F2AA 1YK7A 2R9FA 1GECE 3PW3A 2Y5BA 4X6JA 1NB5A 4MSXA 3IMAA 4NV8A 1PPDA 3D6SA 1QOLA 2BSZA 2FRQA 1AYUA 2NQIA 4YVAA 5CVMA 1MS6A 3K8UA 1AYVA 3OISA 4BPVA 2XU4A 1CSBB 2FT2A 3V6EA 3H8CA 1E2TA 1TL9A 3HHAA 2HH5A 1AYWA 4G54A 4QRVA 3WXFA 3QSDA 3OF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJV A;  2XU5 A;  2JQG R;  1BP4 A;  5CHV A;  1JQP A;  3H7D A;  4PI3 A;  1NL6 A;  2E02 A;  2BDL A;  4HWY A;  2O6X A;  4PAD A;  3TNX A;  4CDC B;  3DF0 A;  3H89 A;  4YV8 A;  3MOR A;  2P86 A;  3NHE A;  4I07 A;  1IWD A;  4WA6 A;  1PPP A;  4PP1 A;  2AUX A;  2FYE A;  7PCK A;  1U5I A;  2YJ8 A;  9PAP A;  2R9M A;  2IBI A;  4N4Z A;  3AI8 A;  2DCA A;  2OP3 A;  3S3R A;  3KW9 A;  4MZO A;  5A24 A;  1STF E;  2AVW A;  1PPN A;  1YK8 A;  1KXR A;  1MEG A;  2YJ9 A;  4CZW A;  3I06 A;  1VSN A;  3O0U A;  1ZCM A;  3M99 A;  2YJB A;  1DF0 A;  1F29 A;  2FUD A;  1ZIV A;  2NQA A;  1POP A;  1BQI A;  4YYR A;  1CB5 A;  1MHW A;  2XU3 A;  1PXV A;  3BOW A;  1AU0 A;  1YT7 A;  4YYV A;  2DJF B;  3RVX A;  1MIR A;  1THE A;  1EWO A;  2NQD B;  2CB5 A;  4CDE B;  4FJC A;  3F75 A;  3KX1 A;  4QRG A;  1MEM A;  3KWZ A;  5FPW A;  1PBH A;  4CDF B;  2BDZ A;  2DZY A;  1MDW A;  2Y6E A;  4DMY A;  4N79 A;  4PP2 E;  1CQD A;  2B1N A;  2PRE A;  3OVX A;  1AU3 A;  2G8J A;  1EWM A;  2E03 A;  2AU1 A;  2NQG A;  4MZS A;  1KHQ A;  1NLJ A;  5JH3 A;  2YJ2 A;  1S4V A;  3P5X A;  4Q8H A;  3F5V A;  1CTE A;  1PCI A;  1EWP A;  2AS8 A;  2R6N A;  3S3Q A;  1AU4 A;  1CPJ A;  1NQC A;  1PPO A;  2DCD A;  4W4U A;  1EWL A;  4Q8G A;  3MTN A;  3KFQ A;  3IEJ A;  2FTD A;  3USV A;  8PCH A;  4OEL A;  1U9Q X;  2ATO A;  2G8E A;  1U9V A;  2FQ9 A;  4XUI A;  2DC9 A;  4CDD B;  2AYO A;  3BWK A;  2FO5 A;  3IHP A;  2F7D A;  3E1Z B;  3ERV A;  1NB3 A;  3RVW A;  2ACT A;  4OEM A;  4AXL A;  5PAD A;  4QH6 A;  2DZZ A;  3HHI A;  3IOQ A;  5K16 A;  1YAL A;  1ME4 A;  2DJG B;  1AIM A;  5EF4 A;  1TLO A;  2GFO A;  4XR7 A;  5CHT A;  1BY8 A;  3P5V A;  3N3K A;  2R9N A;  4X6I A;  1KFX L;  1PIP A;  2WBF X;  1KFU L;  3WXG A;  1BGO A;  2R9C A;  3K9M A;  2VHS A;  4AXM A;  2PBH A;  2VHF A;  2OZ2 A;  1GMY A;  4KLB A;  3OF8 A;  3KKU A;  3H6S A;  2R9O A;  6PAD A;  1HUC B;  4FK5 A;  2PAD A;  2E00 A;  3WXE A;  3CH3 X;  1A6R A;  1O0E A;  3C9E A;  3MHH A;  3LXS A;  4FIP A;  3OVZ A;  3PDF A;  2GHU A;  4W5C A;  4I05 A;  3GCB A;  4YYU A;  2YJC A;  5CVO B;  1F2B A;  4DMX A;  3BC3 A;  4BSQ A;  2AIM A;  2E01 A;  3HWN A;  1QXP A;  3P5U A;  2DCB A;  2G7Y A;  1K3B B;  3B79 A;  1CJL A;  1QDQ A;  2H7J A;  1QMY A;  3QT4 A;  4I04 A;  4QRX A;  5JA7 A;  2HD5 A;  4BQV A;  4P6E A;  2P7U A;  2DC6 A;  3QJ3 A;  3KWB X;  4BS6 A;  1U9X A;  1PAD A;  1XKG A;  2P0R A;  1AEC A;  1KHP A;  2G6D A;  3IUT A;  2IPP B;  3V6C A;  4YYS A;  1EF7 A;  1SNK A;  1SP4 B;  1ATK A;  1M6D A;  3P5W A;  1ICF A;  5EGW A;  2B1M A;  1ME3 A;  4K7C A;  1Y4H A;  2AUZ A;  1TU6 A;  4ZUX U;  1CVZ A;  2PNS A;  4N8W A;  3BPM A;  3HD3 A;  5J94 A;  3BPF A;  1AU2 A;  2JQF R;  3H8B A;  2XU1 A;  4W5B A;  3PNR A;  2DC8 A;  3CBJ A;  2F1G A;  2AYN A;  1GLO A;  3I3T A;  1F2C A;  1Q6K A;  3BCN A;  2C0Y A;  2DC7 A;  4QBB A;  3CBK A;  1PE6 A;  1YVB A;  4BS5 A;  4X6H A;  3N4C A;  1NPZ A;  3N3G A;  5F02 A;  1CS8 A;  1CV8 A;  3MHS A;  1U9W A;  4P6G A;  3IV2 A;  3LFY A;  3CH2 X;  2CIO A;  3PBH A;  1DEU A;  3O1G A;  4YYW A;  5CVN B;  3RVV A;  4YYQ A;  3ZUA A;  2HXZ A;  2DCC A;  1ITO A;  1X9Y A;  4RY2 A;  1Y08 A;  2ARY A;  2FRA A;  2OUL A;  1GCB A;  1FH0 A;  3K24 A;  3KSE A;  2HHN A;  3U8E A;  1F2A A;  1YK7 A;  2R9F A;  1GEC E;  3PW3 A;  2Y5B A;  4X6J A;  1NB5 A;  4MSX A;  3IMA A;  1PPD A;  3D6S A;  1QOL A;  2FRQ A;  1AYU A;  2NQI A;  4YVA A;  5CVM A;  1MS6 A;  3K8U A;  1AYV A;  3OIS A;  4BPV A;  2XU4 A;  1CSB B;  2FT2 A;  3V6E A;  3H8C A;  1TL9 A;  3HHA A;  2HH5 A;  1AYW A;  4G54 A;  4QRV A;  3WXF A;  3QSD A;  3OF9 A; 
#chains in the Genus database with same CATH topology
 1VJV A;  2XU5 A;  2JQG R;  4MI7 A;  1BP4 A;  5CHV A;  1JQP A;  3H7D A;  4PI3 A;  1NL6 A;  2E02 A;  2BDL A;  4HWY A;  2O6X A;  2FE8 A;  3PHU A;  4PAD A;  3TNX A;  4CDC B;  3DF0 A;  3H89 A;  4YV8 A;  3MOR A;  2P86 A;  3NHE A;  4I07 A;  1IWD A;  4WA6 A;  1PPP A;  4PP1 A;  2AUX A;  2FYE A;  7PCK A;  1U5I A;  2YJ8 A;  9PAP A;  2R9M A;  2IBI A;  4N4Z A;  3AI8 A;  3O65 A;  2DCA A;  1YZB A;  2OP3 A;  3S3R A;  3KW9 A;  4REZ A;  4MZO A;  5A24 A;  1STF E;  2AVW A;  1PPN A;  1YK8 A;  1KXR A;  1MEG A;  2YJ9 A;  4RF0 A;  4CZW A;  3BB7 A;  3I06 A;  1VSN A;  3O0U A;  5EZS A;  1ZCM A;  3M99 A;  2YJB A;  1DF0 A;  1F29 A;  2FUD A;  1ZIV A;  2NQA A;  1POP A;  1BQI A;  4YYR A;  1CB5 A;  1MHW A;  2XU3 A;  1PXV A;  3BBA A;  3BOW A;  1AU0 A;  1YT7 A;  4YYV A;  2DJF B;  3RVX A;  2BTW A;  1MIR A;  1THE A;  1EWO A;  2NQD B;  2CB5 A;  4CDE B;  3PSE A;  4FJC A;  3F75 A;  2BU3 A;  3KX1 A;  4QRG A;  1MEM A;  3KWZ A;  5FPW A;  1PBH A;  4CDF B;  2BDZ A;  2DZY A;  4BOS A;  1MDW A;  2Y6E A;  3PRP A;  4DMY A;  4N79 A;  4PP2 E;  1CQD A;  4OVZ A;  2B1N A;  2PRE A;  3OVX A;  5E6J A;  1AU3 A;  4R3D A;  2G8J A;  3MJ5 A;  1EWM A;  2E03 A;  2AU1 A;  2NQG A;  4MZS A;  1KHQ A;  1NLJ A;  5JH3 A;  2YJ2 A;  1S4V A;  3P5X A;  3RNV A;  4Q8H A;  3F5V A;  1CTE A;  1PCI A;  2Z84 A;  2J7Q C;  1EWP A;  5KO3 A;  2AS8 A;  3C0R A;  2R6N A;  3S3Q A;  4MM3 B;  1DKI A;  2AGA A;  1AU4 A;  4D8E A;  1CPJ A;  1NQC A;  1PPO A;  2DCD A;  4W4U A;  1UKF A;  1EWL A;  4Q8G A;  3MTN A;  3B21 A;  3KFQ A;  3IEJ A;  2FTD A;  3USV A;  8PCH A;  4OEL A;  1U9Q X;  2ATO A;  2G8E A;  1U9V A;  2FQ9 A;  4XUI A;  2DC9 A;  4CDD B;  2AYO A;  2BTW B;  3BWK A;  2JTC A;  2FO5 A;  3IHP A;  2F7D A;  3E1Z B;  3ERV A;  5EZQ A;  1NB3 A;  3RVW A;  2ACT A;  4OEM A;  3PHW A;  4AXL A;  5PAD A;  5JZE A;  3TRK A;  4QH6 A;  4OVZ B;  2DZZ A;  3HHI A;  3IOQ A;  5K16 A;  3PHX A;  1YAL A;  1ME4 A;  2DJG B;  1AIM A;  5EF4 A;  1TLO A;  2GFO A;  4XR7 A;  5CHT A;  1BY8 A;  3P5V A;  3N3K A;  2HWK A;  2R9N A;  4X6I A;  1KFX L;  1PIP A;  3E9S A;  3MTV A;  2WBF X;  1KFU L;  2JRI A;  3WXG A;  1BGO A;  2R9C A;  3K9M A;  2VHS A;  4AXM A;  2PBH A;  4WUR A;  2VHF A;  2OZ2 A;  1GMY A;  4KLB A;  3OF8 A;  4BOU A;  3KKU A;  3H6S A;  2R9O A;  6PAD A;  1HUC B;  4FK5 A;  2PAD A;  2E00 A;  3WXE A;  3CH3 X;  1A6R A;  1O0E A;  3C9E A;  3MHH A;  3PT2 A;  3LXS A;  4FIP A;  4BOP A;  3TMP A;  3OVZ A;  3PDF A;  4IP3 A;  2GHU A;  4W5C A;  4I05 A;  4P16 A;  3GCB A;  4YYU A;  2YJC A;  5CVO B;  1F2B A;  4DMX A;  3BC3 A;  4BSQ A;  2AIM A;  2E01 A;  3HWN A;  4A5U A;  1QXP A;  3P5U A;  2DCB A;  2G7Y A;  1K3B B;  3B79 A;  4D8B A;  1CJL A;  1QDQ A;  2H7J A;  1QMY A;  3QT4 A;  4I04 A;  4QRX A;  5JA7 A;  2HD5 A;  4BQV A;  3BY4 A;  4P6E A;  2P7U A;  2DC6 A;  3QJ3 A;  3KWB X;  4BS6 A;  4RKX A;  1U9X A;  1PAD A;  1XKG A;  2P0R A;  1AEC A;  4IUM A;  1KHP A;  2G6D A;  3IUT A;  4XZX A;  2IPP B;  3V6C A;  4YYS A;  1EF7 A;  1SNK A;  1SP4 B;  1ATK A;  1M6D A;  3P5W A;  1ICF A;  4GUA A;  5EGW A;  2B1M A;  1ME3 A;  4K7C A;  1Y4H A;  2AUZ A;  1TU6 A;  3ZNH A;  4ZUX U;  1CVZ A;  2PNS A;  4N8W A;  3BPM A;  3HD3 A;  5J94 A;  3BPF A;  3MP2 A;  1AU2 A;  3OQC A;  2JQF R;  4OW0 A;  3H8B A;  2XU1 A;  4W5B A;  3PNR A;  2DC8 A;  3CBJ A;  2F1G A;  2AYN A;  4M0W A;  1GLO A;  3I3T A;  1F2C A;  1Q6K A;  3BCN A;  2C0Y A;  2DC7 A;  4QBB A;  3CBK A;  1PE6 A;  4PT5 A;  4RNA A;  1YVB A;  4BS5 A;  4X6H A;  3N4C A;  3IFU A;  1NPZ A;  3N3G A;  5F02 A;  3W31 A;  1CS8 A;  1CV8 A;  3MHS A;  1U9W A;  4P6G A;  3IV2 A;  4ZTB A;  3LFY A;  3CH2 X;  2CIO A;  3PBH A;  1DEU A;  3O1G A;  4D8I A;  4BOQ A;  4YYW A;  4BOZ A;  5CVN B;  3RVV A;  4YYQ A;  3ZUA A;  2HXZ A;  2DCC A;  1ITO A;  1X9Y A;  4RY2 A;  1Y08 A;  2ARY A;  2FRA A;  2OUL A;  1GCB A;  1FH0 A;  3K24 A;  3KSE A;  4RF1 A;  2J7Q A;  2HHN A;  3U8E A;  1F2A A;  1YK7 A;  3PRM A;  2R9F A;  1GEC E;  3PW3 A;  2Y5B A;  4X6J A;  1NB5 A;  4MSX A;  3IMA A;  1PPD A;  3D6S A;  1QOL A;  2FRQ A;  1AYU A;  2NQI A;  4YVA A;  5CVM A;  1MS6 A;  3K8U A;  1AYV A;  3OIS A;  4HXD B;  4BPV A;  2XU4 A;  1CSB B;  2FT2 A;  3V6E A;  3H8C A;  2DOS A;  1TL9 A;  2UZJ A;  3W30 A;  3HHA A;  1PVJ A;  2HH5 A;  1AYW A;  4G54 A;  4QRV A;  3WXF A;  3QSD A;  3OF9 A; 
#chains in the Genus database with same CATH homology
 1VJV A;  2XU5 A;  4C5P A;  2JQG R;  1BP4 A;  5CHV A;  1JQP A;  3H7D A;  4PI3 A;  1NL6 A;  2E02 A;  2BDL A;  3LTW A;  4HWY A;  2O6X A;  4PAD A;  3TNX A;  4CDC B;  3DF0 A;  3H89 A;  4YV8 A;  3MOR A;  2P86 A;  3NHE A;  4I07 A;  1IWD A;  4WA6 A;  1PPP A;  4PP1 A;  2AUX A;  2FYE A;  2VFC A;  7PCK A;  1U5I A;  2YJ8 A;  9PAP A;  2R9M A;  2IBI A;  4N4Z A;  3AI8 A;  2DCA A;  2OP3 A;  3S3R A;  3KW9 A;  1W5R A;  4MZO A;  5A24 A;  1STF E;  2AVW A;  1PPN A;  1YK8 A;  1KXR A;  1MEG A;  2YJ9 A;  4CZW A;  3I06 A;  1VSN A;  3O0U A;  1ZCM A;  3M99 A;  2YJB A;  1DF0 A;  1F29 A;  2FUD A;  1ZIV A;  2NQA A;  1POP A;  1BQI A;  4YYR A;  1CB5 A;  1MHW A;  2XU3 A;  1PXV A;  3BOW A;  1AU0 A;  1YT7 A;  4YYV A;  2DJF B;  3RVX A;  1MIR A;  1THE A;  1EWO A;  2NQD B;  2CB5 A;  4CDE B;  4FJC A;  3F75 A;  3KX1 A;  4QRG A;  1MEM A;  3KWZ A;  5FPW A;  1PBH A;  4CDF B;  2BDZ A;  2DZY A;  1MDW A;  2Y6E A;  4DMY A;  4N79 A;  4PP2 E;  1CQD A;  2B1N A;  2PRE A;  3OVX A;  1AU3 A;  2G8J A;  1EWM A;  2E03 A;  2AU1 A;  2NQG A;  4MZS A;  1KHQ A;  1NLJ A;  5JH3 A;  2YJ2 A;  1S4V A;  3P5X A;  2VFB A;  4Q8H A;  3F5V A;  1CTE A;  1PCI A;  1EWP A;  2AS8 A;  2R6N A;  3S3Q A;  4GUZ A;  1AU4 A;  1CPJ A;  1NQC A;  1PPO A;  2DCD A;  4W4U A;  1EWL A;  4Q8G A;  3MTN A;  3KFQ A;  3IEJ A;  2FTD A;  3USV A;  8PCH A;  4OEL A;  1U9Q X;  2ATO A;  2G8E A;  1U9V A;  2FQ9 A;  4XUI A;  2DC9 A;  4CDD B;  2AYO A;  3BWK A;  2FO5 A;  3IHP A;  2F7D A;  3E1Z B;  3ERV A;  1NB3 A;  3RVW A;  2ACT A;  4OEM A;  4AXL A;  5PAD A;  4QH6 A;  2DZZ A;  3HHI A;  4B55 A;  3IOQ A;  5K16 A;  1YAL A;  1ME4 A;  2DJG B;  1AIM A;  5EF4 A;  1TLO A;  2GFO A;  4XR7 A;  5CHT A;  1BY8 A;  3P5V A;  3N3K A;  2R9N A;  4X6I A;  1KFX L;  1PIP A;  2WBF X;  1KFU L;  3WXG A;  1BGO A;  2R9C A;  3K9M A;  2VHS A;  4AXM A;  2PBH A;  4BGF A;  2VHF A;  2OZ2 A;  1GMY A;  4KLB A;  3OF8 A;  3KKU A;  3H6S A;  2R9O A;  6PAD A;  1HUC B;  4FK5 A;  2PAD A;  2E00 A;  3WXE A;  3CH3 X;  1A6R A;  1O0E A;  3C9E A;  3MHH A;  3LXS A;  4FIP A;  3OVZ A;  3PDF A;  2GHU A;  4W5C A;  4I05 A;  3GCB A;  4YYU A;  2YJC A;  5CVO B;  1F2B A;  4DMX A;  3BC3 A;  4BSQ A;  2AIM A;  2E01 A;  3HWN A;  1QXP A;  3P5U A;  2DCB A;  2G7Y A;  1K3B B;  3B79 A;  1CJL A;  1QDQ A;  2H7J A;  1QMY A;  3QT4 A;  4I04 A;  4QRX A;  5JA7 A;  4NV7 A;  2HD5 A;  4BQV A;  4P6E A;  2P7U A;  2DC6 A;  3QJ3 A;  3KWB X;  4BS6 A;  3D9W A;  1U9X A;  1PAD A;  1XKG A;  2P0R A;  1AEC A;  1KHP A;  2G6D A;  3IUT A;  2IPP B;  3V6C A;  4YYS A;  1EF7 A;  1SNK A;  1SP4 B;  1ATK A;  1M6D A;  3P5W A;  1ICF A;  5EGW A;  2B1M A;  1ME3 A;  4K7C A;  1Y4H A;  2AUZ A;  1TU6 A;  4ZUX U;  1CVZ A;  2PNS A;  4N8W A;  3BPM A;  3HD3 A;  5J94 A;  3BPF A;  1W6F A;  1AU2 A;  2JQF R;  3H8B A;  2XU1 A;  4W5B A;  3PNR A;  2DC8 A;  3CBJ A;  2F1G A;  2AYN A;  1GLO A;  3I3T A;  1F2C A;  1Q6K A;  3BCN A;  2C0Y A;  2DC7 A;  4QBB A;  3CBK A;  1PE6 A;  1YVB A;  4BS5 A;  4X6H A;  3N4C A;  1NPZ A;  3N3G A;  5F02 A;  1CS8 A;  1CV8 A;  3MHS A;  1U9W A;  4P6G A;  3IV2 A;  3LFY A;  3CH2 X;  2CIO A;  3PBH A;  1DEU A;  3O1G A;  4YYW A;  5CVN B;  3RVV A;  4YYQ A;  3ZUA A;  2HXZ A;  2DCC A;  1ITO A;  1X9Y A;  1GX3 A;  4RY2 A;  1Y08 A;  2ARY A;  2FRA A;  2OUL A;  1GCB A;  1FH0 A;  3K24 A;  3KSE A;  1W4T A;  2HHN A;  3U8E A;  1F2A A;  1YK7 A;  2R9F A;  1GEC E;  3PW3 A;  2Y5B A;  4X6J A;  1NB5 A;  4MSX A;  3IMA A;  4NV8 A;  1PPD A;  3D6S A;  1QOL A;  2BSZ A;  2FRQ A;  1AYU A;  2NQI A;  4YVA A;  5CVM A;  1MS6 A;  3K8U A;  1AYV A;  3OIS A;  4BPV A;  2XU4 A;  1CSB B;  2FT2 A;  3V6E A;  3H8C A;  1E2T A;  1TL9 A;  3HHA A;  2HH5 A;  1AYW A;  4G54 A;  4QRV A;  3WXF A;  3QSD A;  3OF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...