3IMAA

Complex strcuture of tarocystatin and papain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Papain
publication title Complex strcuture of tarocystatin and papain
rcsb
source organism Colocasia esculenta
total genus 68
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3imaA00
2GFOA 1PIPA 3QSDA 3OF9A 3ERVA 5CVNB 2G8JA 2AUXA 1Y4HA 1CS8A 1BGOA 1O0EA 1AYUA 2HXZA 2DC6A 1QDQA 2G7YA 2F1GA 2R9OA 3MTNA 4W5BA 1AECA 4XR7A 1CV8A 3U8EA 1K3BB 2G8EA 3S3RA 2DC7A 3PDFA 1EWOA 2XU1A 6PADA 2BDZA 3BC3A 1DF0A 2XU5A 3LXSA 3ZUAA 1THEA 1YT7A 5CVMA 3K9MA 2CIOA 1F29A 3QT4A 3WXFA 3CBKA 2R9FA 4I04A 2DCDA 4PADA 1FH0A 3RVVA 2DC9A 2DCCA 3IOQA 1X9YA 3MORA 4ZUXU 1Y08A 4QBBA 3F5VA 2R9NA 3H7DA 3OISA 2AVWA 4KLBA 5F02A 5FPWA 3KW9A 3MHSA 4N8WA 4WA6A 1YK7A 2OP3A 3S3QA 1A6RA 2DCBA 1CVZA 2AIMA 2E02A 2ARYA 1KXRA 1VJVA 4MZOA 4MSXA 1AU3A 1YVBA 2NQGA 1AU4A 1F2AA 4FK5A 2HD5A 1GCBA 1CB5A 1HUCB 2Y5BA 5PADA 5CHVA 1TLOA 3MHHA 4QH6A 4K7CA 3V6CA 1YK8A 2OZ2A 4FIPA 3V6EA 2HH5A 3P5XA 5EGWA 2CB5A 4PP1A 2R9MA 2VHFA 3TNXA 2B1NA 4N4ZA 1PBHA 2PREA 1NPZA 3PNRA 2FT2A 1Q6KA 8PCHA 2E00A 4AXMA 3I3TA 1TL9A 3O1GA 1U9VA 2FO5A 3CH2X 4CDCB 1U9QX 2P7UA 1QOLA 3BPMA 1MEGA 3P5VA 1GLOA 2YJ9A 1DEUA 4Q8GA 2AUZA 1MDWA 4BS6A 1PPDA 2FTDA 3CBJA 7PCKA 1IWDA 9PAPA 5CVOB 4BPVA 1PPNA 4YYQA 4XUIA 4PI3A 3BCNA 1KFXL 5J94A 1PCIA 1U9XA 4YYWA 1QXPA 4DMXA 4YV8A 3P5UA 3D6SA 1NB5A 2GHUA 1GMYA 1NLJA 2FQ9A 3K8UA 1AYVA 1S4VA 1ZCMA 3HHIA 2DZYA 3IMAA 2NQAA 4YYRA 3OVZA 2DJGB 1PADA 3KKUA 3PW3A 4BSQA 1EWLA 3N3GA 1VSNA 3IHPA 1STFE 3HHAA 3QJ3A 1SP4B 2HHNA 2C0YA 3P5WA 1CQDA 3BPFA 1POPA 4P6EA 1MS6A 1BP4A 4W4UA 3IV2A 3N4CA 4CDDB 1U9WA 1JQPA 2O6XA 2BDLA 2DZZA 2NQDB 3WXGA 3GCBA 2Y6EA 2P86A 1YALA 2YJ8A 1SNKA 1KHPA 2AYNA 3OF8A 3IUTA 1U5IA 1MEMA 2OULA 1BY8A 2ATOA 4OELA 4RY2A 3AI8A 3LFYA 4QRGA 2NQIA 3KWZA 1F2CA 4YYVA 1PPOA 1CPJA 2R9CA 3M99A 3KSEA 4YYUA 3F75A 1XKGA 2FUDA 3K24A 1ME3A 1MHWA 1AYWA 2G6DA 2PADA 2YJBA 4FJCA 3RVXA 4DMYA 1PXVA 4Q8HA 3B79A 4QRXA 2IBIA 4HWYA 2ACTA 1ME4A 3HD3A 3I06A 2AYOA 2XU3A 4W5CA 1NQCA 2JQGR 1GECE 2F7DA 2FYEA 3OVXA 1F2BA 3BOWA 1CTEA 1PPPA 2PNSA 2H7JA 4I07A 3O0UA 4G54A 3H6SA 3CH3X 3N3KA 5EF4A 2FRAA 2AU1A 1EWPA 3NHEA 3WXEA 4CDFB 1KHQA 2B1MA 4CZWA 2DCAA 4BQVA 3KX1A 3RVWA 5CHTA 1EF7A 1AU2A 3H8CA 4X6JA 1PE6A 1NB3A 2WBFX 3KWBX 3BWKA 4BS5A 2AS8A 4X6HA 3H89A 5K16A 5JA7A 3IEJA 1EWMA 2PBHA 1TU6A 1MIRA 2DC8A 2YJ2A 1ATKA 5JH3A 1M6DA 1ZIVA 1CSBB 4X6IA 4QRVA 1NL6A 1AU0A 4CDEB 2FRQA 4AXLA 3USVA 3E1ZB 2IPPB 4PP2E 2VHSA 1CJLA 2DJFB 4YVAA 4OEMA 3DF0A 3KFQA 1QMYA 4YYSA 2E01A 5A24A 4I05A 2XU4A 3H8BA 1ITOA 1BQIA 1ICFA 1KFUL 2R6NA 4P6GA 2E03A 1AIMA 3PBHA 3C9EA 2YJCA 4MZSA 3HWNA 4N79A 2JQFR 2P0RA
chains in the Genus database with same CATH superfamily
2GFOA 1PIPA 3OF9A 3QSDA 3ERVA 5CVNB 2G8JA 2AUXA 1Y4HA 1CS8A 1BGOA 1O0EA 1AYUA 3MJ5A 2HXZA 2DC6A 3IFUA 4IUMA 1QDQA 4OVZA 2G7YA 2F1GA 2BTWB 2R9OA 3MTNA 3PRPA 4W5BA 1AECA 4XR7A 1CV8A 3U8EA 1K3BB 2G8EA 4D8EA 3S3RA 4BOSA 2DC7A 3PDFA 1EWOA 2XU1A 6PADA 3O65A 2BDZA 3BC3A 1DF0A 2XU5A 3LXSA 4BOQA 3ZUAA 4OVZB 1THEA 1YT7A 5CVMA 3K9MA 2CIOA 1F29A 3QT4A 3WXFA 3CBKA 2R9FA 4I04A 2DCDA 4PADA 1FH0A 3RVVA 2DC9A 4M0WA 2DCCA 4MI7A 3IOQA 1X9YA 3MORA 4ZUXU 1Y08A 4QBBA 3F5VA 2R9NA 3H7DA 3OISA 2AVWA 4KLBA 5F02A 5FPWA 3KW9A 3W31A 3BB7A 3MHSA 4N8WA 4WA6A 1YK7A 2OP3A 3S3QA 1A6RA 2DCBA 3C0RA 4A5UA 4ZTBA 1CVZA 2AIMA 5E6JA 2E02A 2ARYA 1KXRA 1VJVA 4MZOA 4MSXA 1AU3A 1YVBA 2NQGA 1AU4A 1F2AA 4FK5A 2HD5A 3PT2A 1GCBA 1CB5A 3PHWA 1HUCB 2Y5BA 5PADA 5CHVA 1TLOA 3MHHA 4QH6A 4K7CA 3V6CA 3PRMA 4XZXA 3BBAA 1YK8A 2OZ2A 4FIPA 3V6EA 2HH5A 4BOUA 3P5XA 2HWKA 5EGWA 2CB5A 4PP1A 2R9MA 2VHFA 3TNXA 2B1NA 4N4ZA 1PBHA 2JRIA 2PREA 3RNVA 1NPZA 3PNRA 2FT2A 1Q6KA 8PCHA 3BY4A 2E00A 4AXMA 3I3TA 1TL9A 3O1GA 1U9VA 2FO5A 2JTCA 3CH2X 4CDCB 4WURA 1U9QX 2J7QA 2P7UA 1QOLA 3BPMA 1MEGA 3P5VA 1GLOA 2YJ9A 1DEUA 4GUAA 4D8BA 4REZA 4Q8GA 2AUZA 1MDWA 4BS6A 1PPDA 2FTDA 4RNAA 3CBJA 7PCKA 1IWDA 9PAPA 5CVOB 4BPVA 1PPNA 4YYQA 4XUIA 4PI3A 3BCNA 1KFXL 2J7QC 3W30A 5J94A 1PCIA 1U9XA 3PSEA 4YYWA 1QXPA 4DMXA 4YV8A 3P5UA 4HXDB 3D6SA 1NB5A 2GHUA 1GMYA 1NLJA 2FQ9A 3K8UA 1AYVA 1S4VA 1ZCMA 4R3DA 3HHIA 2DZYA 3IMAA 2NQAA 4YYRA 3OVZA 1YZBA 2DJGB 1DKIA 1PADA 3KKUA 3PHUA 4RKXA 3PW3A 4BSQA 1EWLA 3E9SA 3N3GA 1VSNA 3IHPA 1STFE 3HHAA 3QJ3A 1SP4B 2HHNA 2C0YA 3P5WA 1CQDA 3BPFA 1POPA 3MP2A 4P6EA 1MS6A 1BP4A 4W4UA 3IV2A 3N4CA 4CDDB 1U9WA 1JQPA 2O6XA 2BDLA 2DZZA 2NQDB 3WXGA 3GCBA 2Y6EA 2P86A 1YALA 2YJ8A 4MM3B 1SNKA 1KHPA 2AYNA 3OF8A 3IUTA 1U5IA 1MEMA 2OULA 1BY8A 2ATOA 4OELA 4RY2A 2Z84A 3AI8A 3LFYA 4QRGA 2NQIA 3KWZA 1F2CA 4YYVA 4PT5A 5JZEA 1PPOA 1CPJA 2R9CA 3M99A 3KSEA 4YYUA 3F75A 1XKGA 2FE8A 2FUDA 3K24A 1ME3A 1MHWA 1AYWA 2G6DA 2PADA 2YJBA 4FJCA 3RVXA 4DMYA 1PXVA 4Q8HA 3B79A 4QRXA 2IBIA 4BOZA 4HWYA 2ACTA 1ME4A 3HD3A 3I06A 4P16A 2AYOA 5EZSA 2XU3A 4W5CA 1NQCA 2JQGR 1GECE 2F7DA 2FYEA 3OVXA 1F2BA 3BOWA 1CTEA 1PPPA 2PNSA 2H7JA 3PHXA 4I07A 3O0UA 3TMPA 4G54A 3H6SA 3CH3X 3N3KA 1UKFA 5EF4A 2FRAA 2AU1A 3B21A 1EWPA 4IP3A 3NHEA 3WXEA 4CDFB 1KHQA 2B1MA 4RF0A 4CZWA 4D8IA 2DCAA 4BQVA 3KX1A 3RVWA 5CHTA 1EF7A 1AU2A 3H8CA 4X6JA 1PE6A 1NB3A 2DOSA 2WBFX 3KWBX 3BWKA 4BS5A 2AS8A 4X6HA 3H89A 5K16A 2UZJA 5JA7A 3IEJA 1EWMA 5EZQA 2PBHA 1TU6A 1MIRA 2DC8A 2YJ2A 1ATKA 5JH3A 5KO3A 2BU3A 1M6DA 1ZIVA 1CSBB 3OQCA 4X6IA 4QRVA 1NL6A 2AGAA 1AU0A 4CDEB 2FRQA 4AXLA 3USVA 3E1ZB 2IPPB 4RF1A 4OW0A 4PP2E 2VHSA 3ZNHA 1CJLA 2DJFB 4YVAA 4OEMA 3DF0A 3KFQA 1QMYA 4YYSA 2E01A 5A24A 4I05A 2XU4A 3H8BA 1ITOA 3MTVA 1BQIA 1ICFA 1KFUL 2R6NA 4P6GA 2E03A 2BTWA 4BOPA 1AIMA 3PBHA 3TRKA 3C9EA 2YJCA 1PVJA 4MZSA 3HWNA 4N79A 2JQFR 2P0RA
chains in the Genus database with same CATH topology
2GFOA 1PIPA 3QSDA 3OF9A 3ERVA 5CVNB 2G8JA 2AUXA 1Y4HA 1CS8A 1BGOA 1O0EA 1AYUA 2HXZA 2DC6A 1QDQA 2G7YA 2F1GA 2R9OA 3MTNA 4NV7A 4W5BA 1AECA 4B55A 4XR7A 1CV8A 3U8EA 1K3BB 2G8EA 3S3RA 2DC7A 3PDFA 1EWOA 2XU1A 6PADA 2BDZA 3BC3A 1DF0A 2XU5A 3LXSA 3ZUAA 1THEA 1YT7A 5CVMA 3K9MA 4C5PA 2CIOA 1F29A 3QT4A 3WXFA 3CBKA 2R9FA 4I04A 2DCDA 4PADA 1FH0A 3RVVA 2DC9A 2DCCA 3IOQA 1X9YA 3MORA 4ZUXU 1Y08A 4QBBA 3F5VA 2R9NA 3H7DA 3OISA 2AVWA 4KLBA 5F02A 5FPWA 3KW9A 3MHSA 4N8WA 4WA6A 1YK7A 2OP3A 3S3QA 1A6RA 2DCBA 1CVZA 2AIMA 2E02A 2ARYA 1KXRA 1VJVA 4MZOA 4MSXA 1AU3A 1YVBA 2NQGA 1AU4A 1F2AA 4FK5A 2HD5A 1GCBA 1CB5A 1HUCB 2Y5BA 5PADA 5CHVA 1TLOA 3MHHA 4QH6A 4K7CA 3V6CA 1YK8A 2OZ2A 4FIPA 3V6EA 2HH5A 3P5XA 5EGWA 2CB5A 4PP1A 2R9MA 2VHFA 3TNXA 2B1NA 4N4ZA 1PBHA 2PREA 1NPZA 3PNRA 2FT2A 1Q6KA 8PCHA 2E00A 4AXMA 3I3TA 1TL9A 3O1GA 1U9VA 2FO5A 3CH2X 4CDCB 1E2TA 1U9QX 2P7UA 1QOLA 3BPMA 1MEGA 3P5VA 4BGFA 1GLOA 2YJ9A 1DEUA 4GUZA 4Q8GA 2AUZA 1MDWA 4BS6A 1PPDA 2FTDA 3CBJA 7PCKA 1IWDA 9PAPA 5CVOB 4BPVA 1PPNA 4YYQA 4XUIA 4PI3A 3BCNA 1KFXL 5J94A 1PCIA 1U9XA 4YYWA 1QXPA 4DMXA 4YV8A 3P5UA 3D6SA 1W4TA 1NB5A 2GHUA 1GMYA 1NLJA 2FQ9A 3K8UA 1AYVA 1S4VA 1ZCMA 3HHIA 2DZYA 3IMAA 2NQAA 4YYRA 3OVZA 2BSZA 2DJGB 1PADA 3KKUA 3PW3A 4BSQA 1EWLA 3N3GA 1VSNA 3IHPA 1STFE 3HHAA 3QJ3A 1SP4B 2HHNA 2C0YA 3P5WA 1CQDA 3BPFA 1POPA 4P6EA 1MS6A 1BP4A 4W4UA 2VFCA 3IV2A 3N4CA 4CDDB 1U9WA 1JQPA 2O6XA 2BDLA 2DZZA 2NQDB 3WXGA 3GCBA 2Y6EA 1GX3A 2P86A 1YALA 2YJ8A 1SNKA 1KHPA 2AYNA 3OF8A 3IUTA 1U5IA 1MEMA 2OULA 1BY8A 2ATOA 4OELA 4RY2A 3AI8A 3LFYA 4QRGA 2NQIA 3KWZA 1F2CA 4YYVA 1PPOA 1CPJA 2R9CA 3M99A 3KSEA 4YYUA 3F75A 1XKGA 2FUDA 3K24A 1ME3A 1MHWA 1AYWA 2G6DA 2PADA 2YJBA 4FJCA 3RVXA 4DMYA 1PXVA 4Q8HA 3B79A 4QRXA 2IBIA 4HWYA 2ACTA 1ME4A 3HD3A 3I06A 2AYOA 2XU3A 4W5CA 1NQCA 2JQGR 1GECE 2F7DA 2FYEA 3OVXA 1F2BA 3BOWA 1CTEA 1PPPA 2PNSA 2H7JA 4I07A 3O0UA 4G54A 3H6SA 3CH3X 3N3KA 3LTWA 5EF4A 2FRAA 2AU1A 1EWPA 3NHEA 3WXEA 4CDFB 1KHQA 2B1MA 4CZWA 2DCAA 4BQVA 3KX1A 3RVWA 5CHTA 1EF7A 1AU2A 4NV8A 3H8CA 4X6JA 1PE6A 1NB3A 1W5RA 2WBFX 3KWBX 3BWKA 4BS5A 2AS8A 4X6HA 3H89A 2VFBA 1W6FA 5K16A 5JA7A 3IEJA 1EWMA 2PBHA 1TU6A 1MIRA 2DC8A 2YJ2A 1ATKA 5JH3A 1M6DA 1ZIVA 1CSBB 3D9WA 4X6IA 4QRVA 1NL6A 1AU0A 4CDEB 2FRQA 4AXLA 3USVA 3E1ZB 2IPPB 4PP2E 2VHSA 1CJLA 2DJFB 4YVAA 4OEMA 3DF0A 3KFQA 1QMYA 4YYSA 2E01A 5A24A 4I05A 2XU4A 3H8BA 1ITOA 1BQIA 1ICFA 1KFUL 2R6NA 4P6GA 2E03A 1AIMA 3PBHA 3C9EA 2YJCA 4MZSA 3HWNA 4N79A 2JQFR 2P0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFO A;  1PIP A;  3QSD A;  3OF9 A;  3ERV A;  5CVN B;  2G8J A;  2AUX A;  1Y4H A;  1CS8 A;  1BGO A;  1O0E A;  1AYU A;  2HXZ A;  2DC6 A;  1QDQ A;  2G7Y A;  2F1G A;  2R9O A;  3MTN A;  4W5B A;  1AEC A;  4XR7 A;  1CV8 A;  3U8E A;  1K3B B;  2G8E A;  3S3R A;  2DC7 A;  3PDF A;  1EWO A;  2XU1 A;  6PAD A;  2BDZ A;  3BC3 A;  1DF0 A;  2XU5 A;  3LXS A;  3ZUA A;  1THE A;  1YT7 A;  5CVM A;  3K9M A;  2CIO A;  1F29 A;  3QT4 A;  3WXF A;  3CBK A;  2R9F A;  4I04 A;  2DCD A;  4PAD A;  1FH0 A;  3RVV A;  2DC9 A;  2DCC A;  3IOQ A;  1X9Y A;  3MOR A;  4ZUX U;  1Y08 A;  4QBB A;  3F5V A;  2R9N A;  3H7D A;  3OIS A;  2AVW A;  4KLB A;  5F02 A;  5FPW A;  3KW9 A;  3MHS A;  4N8W A;  4WA6 A;  1YK7 A;  2OP3 A;  3S3Q A;  1A6R A;  2DCB A;  1CVZ A;  2AIM A;  2E02 A;  2ARY A;  1KXR A;  1VJV A;  4MZO A;  4MSX A;  1AU3 A;  1YVB A;  2NQG A;  1AU4 A;  1F2A A;  4FK5 A;  2HD5 A;  1GCB A;  1CB5 A;  1HUC B;  2Y5B A;  5PAD A;  5CHV A;  1TLO A;  3MHH A;  4QH6 A;  4K7C A;  3V6C A;  1YK8 A;  2OZ2 A;  4FIP A;  3V6E A;  2HH5 A;  3P5X A;  5EGW A;  2CB5 A;  4PP1 A;  2R9M A;  2VHF A;  3TNX A;  2B1N A;  4N4Z A;  1PBH A;  2PRE A;  1NPZ A;  3PNR A;  2FT2 A;  1Q6K A;  8PCH A;  2E00 A;  4AXM A;  3I3T A;  1TL9 A;  3O1G A;  1U9V A;  2FO5 A;  3CH2 X;  4CDC B;  1U9Q X;  2P7U A;  1QOL A;  3BPM A;  1MEG A;  3P5V A;  1GLO A;  2YJ9 A;  1DEU A;  4Q8G A;  2AUZ A;  1MDW A;  4BS6 A;  1PPD A;  2FTD A;  3CBJ A;  7PCK A;  1IWD A;  9PAP A;  5CVO B;  4BPV A;  1PPN A;  4YYQ A;  4XUI A;  4PI3 A;  3BCN A;  1KFX L;  5J94 A;  1PCI A;  1U9X A;  4YYW A;  1QXP A;  4DMX A;  4YV8 A;  3P5U A;  3D6S A;  1NB5 A;  2GHU A;  1GMY A;  1NLJ A;  2FQ9 A;  3K8U A;  1AYV A;  1S4V A;  1ZCM A;  3HHI A;  2DZY A;  3IMA A;  2NQA A;  4YYR A;  3OVZ A;  2DJG B;  1PAD A;  3KKU A;  3PW3 A;  4BSQ A;  1EWL A;  3N3G A;  1VSN A;  3IHP A;  1STF E;  3HHA A;  3QJ3 A;  1SP4 B;  2HHN A;  2C0Y A;  3P5W A;  1CQD A;  3BPF A;  1POP A;  4P6E A;  1MS6 A;  1BP4 A;  4W4U A;  3IV2 A;  3N4C A;  4CDD B;  1U9W A;  1JQP A;  2O6X A;  2BDL A;  2DZZ A;  2NQD B;  3WXG A;  3GCB A;  2Y6E A;  2P86 A;  1YAL A;  2YJ8 A;  1SNK A;  1KHP A;  2AYN A;  3OF8 A;  3IUT A;  1U5I A;  1MEM A;  2OUL A;  1BY8 A;  2ATO A;  4OEL A;  4RY2 A;  3AI8 A;  3LFY A;  4QRG A;  2NQI A;  3KWZ A;  1F2C A;  4YYV A;  1PPO A;  1CPJ A;  2R9C A;  3M99 A;  3KSE A;  4YYU A;  3F75 A;  1XKG A;  2FUD A;  3K24 A;  1ME3 A;  1MHW A;  1AYW A;  2G6D A;  2PAD A;  2YJB A;  4FJC A;  3RVX A;  4DMY A;  1PXV A;  4Q8H A;  3B79 A;  4QRX A;  2IBI A;  4HWY A;  2ACT A;  1ME4 A;  3HD3 A;  3I06 A;  2AYO A;  2XU3 A;  4W5C A;  1NQC A;  2JQG R;  1GEC E;  2F7D A;  2FYE A;  3OVX A;  1F2B A;  3BOW A;  1CTE A;  1PPP A;  2PNS A;  2H7J A;  4I07 A;  3O0U A;  4G54 A;  3H6S A;  3CH3 X;  3N3K A;  5EF4 A;  2FRA A;  2AU1 A;  1EWP A;  3NHE A;  3WXE A;  4CDF B;  1KHQ A;  2B1M A;  4CZW A;  2DCA A;  4BQV A;  3KX1 A;  3RVW A;  5CHT A;  1EF7 A;  1AU2 A;  3H8C A;  4X6J A;  1PE6 A;  1NB3 A;  2WBF X;  3KWB X;  3BWK A;  4BS5 A;  2AS8 A;  4X6H A;  3H89 A;  5K16 A;  5JA7 A;  3IEJ A;  1EWM A;  2PBH A;  1TU6 A;  1MIR A;  2DC8 A;  2YJ2 A;  1ATK A;  5JH3 A;  1M6D A;  1ZIV A;  1CSB B;  4X6I A;  4QRV A;  1NL6 A;  1AU0 A;  4CDE B;  2FRQ A;  4AXL A;  3USV A;  3E1Z B;  2IPP B;  4PP2 E;  2VHS A;  1CJL A;  2DJF B;  4YVA A;  4OEM A;  3DF0 A;  3KFQ A;  1QMY A;  4YYS A;  2E01 A;  5A24 A;  4I05 A;  2XU4 A;  3H8B A;  1ITO A;  1BQI A;  1ICF A;  1KFU L;  2R6N A;  4P6G A;  2E03 A;  1AIM A;  3PBH A;  3C9E A;  2YJC A;  4MZS A;  3HWN A;  4N79 A;  2JQF R;  2P0R A; 
#chains in the Genus database with same CATH topology
 2GFO A;  1PIP A;  3OF9 A;  3QSD A;  3ERV A;  5CVN B;  2G8J A;  2AUX A;  1Y4H A;  1CS8 A;  1BGO A;  1O0E A;  1AYU A;  3MJ5 A;  2HXZ A;  2DC6 A;  3IFU A;  4IUM A;  1QDQ A;  4OVZ A;  2G7Y A;  2F1G A;  2BTW B;  2R9O A;  3MTN A;  3PRP A;  4W5B A;  1AEC A;  4XR7 A;  1CV8 A;  3U8E A;  1K3B B;  2G8E A;  4D8E A;  3S3R A;  4BOS A;  2DC7 A;  3PDF A;  1EWO A;  2XU1 A;  6PAD A;  3O65 A;  2BDZ A;  3BC3 A;  1DF0 A;  2XU5 A;  3LXS A;  4BOQ A;  3ZUA A;  4OVZ B;  1THE A;  1YT7 A;  5CVM A;  3K9M A;  2CIO A;  1F29 A;  3QT4 A;  3WXF A;  3CBK A;  2R9F A;  4I04 A;  2DCD A;  4PAD A;  1FH0 A;  3RVV A;  2DC9 A;  4M0W A;  2DCC A;  4MI7 A;  3IOQ A;  1X9Y A;  3MOR A;  4ZUX U;  1Y08 A;  4QBB A;  3F5V A;  2R9N A;  3H7D A;  3OIS A;  2AVW A;  4KLB A;  5F02 A;  5FPW A;  3KW9 A;  3W31 A;  3BB7 A;  3MHS A;  4N8W A;  4WA6 A;  1YK7 A;  2OP3 A;  3S3Q A;  1A6R A;  2DCB A;  3C0R A;  4A5U A;  4ZTB A;  1CVZ A;  2AIM A;  5E6J A;  2E02 A;  2ARY A;  1KXR A;  1VJV A;  4MZO A;  4MSX A;  1AU3 A;  1YVB A;  2NQG A;  1AU4 A;  1F2A A;  4FK5 A;  2HD5 A;  3PT2 A;  1GCB A;  1CB5 A;  3PHW A;  1HUC B;  2Y5B A;  5PAD A;  5CHV A;  1TLO A;  3MHH A;  4QH6 A;  4K7C A;  3V6C A;  3PRM A;  4XZX A;  3BBA A;  1YK8 A;  2OZ2 A;  4FIP A;  3V6E A;  2HH5 A;  4BOU A;  3P5X A;  2HWK A;  5EGW A;  2CB5 A;  4PP1 A;  2R9M A;  2VHF A;  3TNX A;  2B1N A;  4N4Z A;  1PBH A;  2JRI A;  2PRE A;  3RNV A;  1NPZ A;  3PNR A;  2FT2 A;  1Q6K A;  8PCH A;  3BY4 A;  2E00 A;  4AXM A;  3I3T A;  1TL9 A;  3O1G A;  1U9V A;  2FO5 A;  2JTC A;  3CH2 X;  4CDC B;  4WUR A;  1U9Q X;  2J7Q A;  2P7U A;  1QOL A;  3BPM A;  1MEG A;  3P5V A;  1GLO A;  2YJ9 A;  1DEU A;  4GUA A;  4D8B A;  4REZ A;  4Q8G A;  2AUZ A;  1MDW A;  4BS6 A;  1PPD A;  2FTD A;  4RNA A;  3CBJ A;  7PCK A;  1IWD A;  9PAP A;  5CVO B;  4BPV A;  1PPN A;  4YYQ A;  4XUI A;  4PI3 A;  3BCN A;  1KFX L;  2J7Q C;  3W30 A;  5J94 A;  1PCI A;  1U9X A;  3PSE A;  4YYW A;  1QXP A;  4DMX A;  4YV8 A;  3P5U A;  4HXD B;  3D6S A;  1NB5 A;  2GHU A;  1GMY A;  1NLJ A;  2FQ9 A;  3K8U A;  1AYV A;  1S4V A;  1ZCM A;  4R3D A;  3HHI A;  2DZY A;  3IMA A;  2NQA A;  4YYR A;  3OVZ A;  1YZB A;  2DJG B;  1DKI A;  1PAD A;  3KKU A;  3PHU A;  4RKX A;  3PW3 A;  4BSQ A;  1EWL A;  3E9S A;  3N3G A;  1VSN A;  3IHP A;  1STF E;  3HHA A;  3QJ3 A;  1SP4 B;  2HHN A;  2C0Y A;  3P5W A;  1CQD A;  3BPF A;  1POP A;  3MP2 A;  4P6E A;  1MS6 A;  1BP4 A;  4W4U A;  3IV2 A;  3N4C A;  4CDD B;  1U9W A;  1JQP A;  2O6X A;  2BDL A;  2DZZ A;  2NQD B;  3WXG A;  3GCB A;  2Y6E A;  2P86 A;  1YAL A;  2YJ8 A;  4MM3 B;  1SNK A;  1KHP A;  2AYN A;  3OF8 A;  3IUT A;  1U5I A;  1MEM A;  2OUL A;  1BY8 A;  2ATO A;  4OEL A;  4RY2 A;  2Z84 A;  3AI8 A;  3LFY A;  4QRG A;  2NQI A;  3KWZ A;  1F2C A;  4YYV A;  4PT5 A;  5JZE A;  1PPO A;  1CPJ A;  2R9C A;  3M99 A;  3KSE A;  4YYU A;  3F75 A;  1XKG A;  2FE8 A;  2FUD A;  3K24 A;  1ME3 A;  1MHW A;  1AYW A;  2G6D A;  2PAD A;  2YJB A;  4FJC A;  3RVX A;  4DMY A;  1PXV A;  4Q8H A;  3B79 A;  4QRX A;  2IBI A;  4BOZ A;  4HWY A;  2ACT A;  1ME4 A;  3HD3 A;  3I06 A;  4P16 A;  2AYO A;  5EZS A;  2XU3 A;  4W5C A;  1NQC A;  2JQG R;  1GEC E;  2F7D A;  2FYE A;  3OVX A;  1F2B A;  3BOW A;  1CTE A;  1PPP A;  2PNS A;  2H7J A;  3PHX A;  4I07 A;  3O0U A;  3TMP A;  4G54 A;  3H6S A;  3CH3 X;  3N3K A;  1UKF A;  5EF4 A;  2FRA A;  2AU1 A;  3B21 A;  1EWP A;  4IP3 A;  3NHE A;  3WXE A;  4CDF B;  1KHQ A;  2B1M A;  4RF0 A;  4CZW A;  4D8I A;  2DCA A;  4BQV A;  3KX1 A;  3RVW A;  5CHT A;  1EF7 A;  1AU2 A;  3H8C A;  4X6J A;  1PE6 A;  1NB3 A;  2DOS A;  2WBF X;  3KWB X;  3BWK A;  4BS5 A;  2AS8 A;  4X6H A;  3H89 A;  5K16 A;  2UZJ A;  5JA7 A;  3IEJ A;  1EWM A;  5EZQ A;  2PBH A;  1TU6 A;  1MIR A;  2DC8 A;  2YJ2 A;  1ATK A;  5JH3 A;  5KO3 A;  2BU3 A;  1M6D A;  1ZIV A;  1CSB B;  3OQC A;  4X6I A;  4QRV A;  1NL6 A;  2AGA A;  1AU0 A;  4CDE B;  2FRQ A;  4AXL A;  3USV A;  3E1Z B;  2IPP B;  4RF1 A;  4OW0 A;  4PP2 E;  2VHS A;  3ZNH A;  1CJL A;  2DJF B;  4YVA A;  4OEM A;  3DF0 A;  3KFQ A;  1QMY A;  4YYS A;  2E01 A;  5A24 A;  4I05 A;  2XU4 A;  3H8B A;  1ITO A;  3MTV A;  1BQI A;  1ICF A;  1KFU L;  2R6N A;  4P6G A;  2E03 A;  2BTW A;  4BOP A;  1AIM A;  3PBH A;  3TRK A;  3C9E A;  2YJC A;  1PVJ A;  4MZS A;  3HWN A;  4N79 A;  2JQF R;  2P0R A; 
#chains in the Genus database with same CATH homology
 2GFO A;  1PIP A;  3QSD A;  3OF9 A;  3ERV A;  5CVN B;  2G8J A;  2AUX A;  1Y4H A;  1CS8 A;  1BGO A;  1O0E A;  1AYU A;  2HXZ A;  2DC6 A;  1QDQ A;  2G7Y A;  2F1G A;  2R9O A;  3MTN A;  4NV7 A;  4W5B A;  1AEC A;  4B55 A;  4XR7 A;  1CV8 A;  3U8E A;  1K3B B;  2G8E A;  3S3R A;  2DC7 A;  3PDF A;  1EWO A;  2XU1 A;  6PAD A;  2BDZ A;  3BC3 A;  1DF0 A;  2XU5 A;  3LXS A;  3ZUA A;  1THE A;  1YT7 A;  5CVM A;  3K9M A;  4C5P A;  2CIO A;  1F29 A;  3QT4 A;  3WXF A;  3CBK A;  2R9F A;  4I04 A;  2DCD A;  4PAD A;  1FH0 A;  3RVV A;  2DC9 A;  2DCC A;  3IOQ A;  1X9Y A;  3MOR A;  4ZUX U;  1Y08 A;  4QBB A;  3F5V A;  2R9N A;  3H7D A;  3OIS A;  2AVW A;  4KLB A;  5F02 A;  5FPW A;  3KW9 A;  3MHS A;  4N8W A;  4WA6 A;  1YK7 A;  2OP3 A;  3S3Q A;  1A6R A;  2DCB A;  1CVZ A;  2AIM A;  2E02 A;  2ARY A;  1KXR A;  1VJV A;  4MZO A;  4MSX A;  1AU3 A;  1YVB A;  2NQG A;  1AU4 A;  1F2A A;  4FK5 A;  2HD5 A;  1GCB A;  1CB5 A;  1HUC B;  2Y5B A;  5PAD A;  5CHV A;  1TLO A;  3MHH A;  4QH6 A;  4K7C A;  3V6C A;  1YK8 A;  2OZ2 A;  4FIP A;  3V6E A;  2HH5 A;  3P5X A;  5EGW A;  2CB5 A;  4PP1 A;  2R9M A;  2VHF A;  3TNX A;  2B1N A;  4N4Z A;  1PBH A;  2PRE A;  1NPZ A;  3PNR A;  2FT2 A;  1Q6K A;  8PCH A;  2E00 A;  4AXM A;  3I3T A;  1TL9 A;  3O1G A;  1U9V A;  2FO5 A;  3CH2 X;  4CDC B;  1E2T A;  1U9Q X;  2P7U A;  1QOL A;  3BPM A;  1MEG A;  3P5V A;  4BGF A;  1GLO A;  2YJ9 A;  1DEU A;  4GUZ A;  4Q8G A;  2AUZ A;  1MDW A;  4BS6 A;  1PPD A;  2FTD A;  3CBJ A;  7PCK A;  1IWD A;  9PAP A;  5CVO B;  4BPV A;  1PPN A;  4YYQ A;  4XUI A;  4PI3 A;  3BCN A;  1KFX L;  5J94 A;  1PCI A;  1U9X A;  4YYW A;  1QXP A;  4DMX A;  4YV8 A;  3P5U A;  3D6S A;  1W4T A;  1NB5 A;  2GHU A;  1GMY A;  1NLJ A;  2FQ9 A;  3K8U A;  1AYV A;  1S4V A;  1ZCM A;  3HHI A;  2DZY A;  3IMA A;  2NQA A;  4YYR A;  3OVZ A;  2BSZ A;  2DJG B;  1PAD A;  3KKU A;  3PW3 A;  4BSQ A;  1EWL A;  3N3G A;  1VSN A;  3IHP A;  1STF E;  3HHA A;  3QJ3 A;  1SP4 B;  2HHN A;  2C0Y A;  3P5W A;  1CQD A;  3BPF A;  1POP A;  4P6E A;  1MS6 A;  1BP4 A;  4W4U A;  2VFC A;  3IV2 A;  3N4C A;  4CDD B;  1U9W A;  1JQP A;  2O6X A;  2BDL A;  2DZZ A;  2NQD B;  3WXG A;  3GCB A;  2Y6E A;  1GX3 A;  2P86 A;  1YAL A;  2YJ8 A;  1SNK A;  1KHP A;  2AYN A;  3OF8 A;  3IUT A;  1U5I A;  1MEM A;  2OUL A;  1BY8 A;  2ATO A;  4OEL A;  4RY2 A;  3AI8 A;  3LFY A;  4QRG A;  2NQI A;  3KWZ A;  1F2C A;  4YYV A;  1PPO A;  1CPJ A;  2R9C A;  3M99 A;  3KSE A;  4YYU A;  3F75 A;  1XKG A;  2FUD A;  3K24 A;  1ME3 A;  1MHW A;  1AYW A;  2G6D A;  2PAD A;  2YJB A;  4FJC A;  3RVX A;  4DMY A;  1PXV A;  4Q8H A;  3B79 A;  4QRX A;  2IBI A;  4HWY A;  2ACT A;  1ME4 A;  3HD3 A;  3I06 A;  2AYO A;  2XU3 A;  4W5C A;  1NQC A;  2JQG R;  1GEC E;  2F7D A;  2FYE A;  3OVX A;  1F2B A;  3BOW A;  1CTE A;  1PPP A;  2PNS A;  2H7J A;  4I07 A;  3O0U A;  4G54 A;  3H6S A;  3CH3 X;  3N3K A;  3LTW A;  5EF4 A;  2FRA A;  2AU1 A;  1EWP A;  3NHE A;  3WXE A;  4CDF B;  1KHQ A;  2B1M A;  4CZW A;  2DCA A;  4BQV A;  3KX1 A;  3RVW A;  5CHT A;  1EF7 A;  1AU2 A;  4NV8 A;  3H8C A;  4X6J A;  1PE6 A;  1NB3 A;  1W5R A;  2WBF X;  3KWB X;  3BWK A;  4BS5 A;  2AS8 A;  4X6H A;  3H89 A;  2VFB A;  1W6F A;  5K16 A;  5JA7 A;  3IEJ A;  1EWM A;  2PBH A;  1TU6 A;  1MIR A;  2DC8 A;  2YJ2 A;  1ATK A;  5JH3 A;  1M6D A;  1ZIV A;  1CSB B;  3D9W A;  4X6I A;  4QRV A;  1NL6 A;  1AU0 A;  4CDE B;  2FRQ A;  4AXL A;  3USV A;  3E1Z B;  2IPP B;  4PP2 E;  2VHS A;  1CJL A;  2DJF B;  4YVA A;  4OEM A;  3DF0 A;  3KFQ A;  1QMY A;  4YYS A;  2E01 A;  5A24 A;  4I05 A;  2XU4 A;  3H8B A;  1ITO A;  1BQI A;  1ICF A;  1KFU L;  2R6N A;  4P6G A;  2E03 A;  1AIM A;  3PBH A;  3C9E A;  2YJC A;  4MZS A;  3HWN A;  4N79 A;  2JQF R;  2P0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...