2DC9A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca074me complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
total genus 78
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc9A00
1GLOA 2CIOA 3RVVA 1K3BB 1XKGA 2CB5A 4YYSA 3S3QA 3PBHA 1AU4A 2YJ9A 3KKUA 1U9XA 2JQGR 3N3GA 2PBHA 1QOLA 2IBIA 2R9NA 2AIMA 5EGWA 2DCDA 3M99A 1PPDA 3MHHA 2NQDB 2E03A 3KW9A 1THEA 3NHEA 5CHTA 2FTDA 1AU0A 1AYUA 1YALA 4W5BA 1KFXL 3E1ZB 4BQVA 4MZOA 2FQ9A 1PXVA 3KFQA 4QRXA 5CHVA 1KHPA 2FUDA 1SP4B 3BCNA 2HH5A 2OZ2A 1CV8A 2G6DA 1O0EA 2G8JA 2R9CA 1AYWA 3IEJA 1YK7A 2HD5A 3MHSA 1EWPA 1QMYA 1POPA 2GFOA 1PE6A 1IWDA 1CB5A 2B1MA 1PPNA 1TL9A 2R6NA 1AU2A 3V6EA 2YJCA 2DC7A 2DC8A 5JA7A 2WBFX 3P5WA 1AIMA 3C9EA 4N8WA 2F7DA 4W4UA 1MDWA 2FYEA 1CJLA 3BWKA 4YYUA 3BPMA 2R9OA 2JQFR 3CH2X 3IV2A 1NB3A 4CDFB 2B1NA 1F29A 4FJCA 3P5XA 4X6IA 1X9YA 4CZWA 3QJ3A 3H8BA 4WA6A 2AU1A 3K24A 4I07A 2YJ8A 1U9WA 5CVNB 4BS5A 4W5CA 1KXRA 3H6SA 4XUIA 4QBBA 1BGOA 5EF4A 3OISA 1AYVA 4BSQA 7PCKA 1NL6A 1CTEA 9PAPA 5JH3A 1CS8A 2VHFA 3WXGA 1PBHA 4PP1A 2HHNA 2FO5A 1U9VA 4P6GA 1ME3A 2DZZA 1NB5A 2AUZA 1ZIVA 2DC9A 2DCBA 2R9MA 1EWLA 2HXZA 1EF7A 1A6RA 2GHUA 3KX1A 2OULA 1U5IA 3K8UA 3F75A 5A24A 4DMYA 4KLBA 4P6EA 1EWMA 4YYVA 2AYOA 2G8EA 4N4ZA 1YT7A 4ZUXU 4PADA 1ATKA 4BS6A 2Y5BA 1MEGA 5PADA 3V6CA 3QSDA 4CDCB 4MSXA 5J94A 2PNSA 1QDQA 1CPJA 4MZSA 3I06A 1VSNA 1QXPA 1PIPA 1NLJA 2NQGA 3O1GA 3I3TA 3ZUAA 2OP3A 2NQIA 1KFUL 4OELA 2AS8A 2ACTA 2FRAA 1FH0A 2F1GA 2P0RA 3H8CA 3QT4A 1ZCMA 2FT2A 1NPZA 1MIRA 1AU3A 1S4VA 2O6XA 3HHAA 4YVAA 3USVA 3HWNA 4HWYA 3CH3X 5K16A 3P5VA 1BY8A 4I04A 4PP2E 1ICFA 4N79A 2BDLA 4Q8GA 4Q8HA 1MHWA 2VHSA 1HUCB 3H89A 1F2AA 3OF9A 8PCHA 1SNKA 2BDZA 1F2BA 2YJ2A 3HHIA 2DZYA 3LFYA 3RVXA 1KHQA 1BP4A 2PREA 3B79A 4RY2A 5CVMA 1ME4A 3OVZA 3ERVA 2DJFB 1GECE 1MEMA 2AVWA 1U9QX 2ATOA 4CDEB 3CBKA 3IMAA 1Y4HA 4YYWA 1F2CA 2DCAA 4K7CA 3H7DA 4FIPA 4AXMA 4YYRA 4QRGA 1MS6A 1YVBA 3BPFA 5FPWA 1TU6A 4I05A 3D6SA 3TNXA 3IOQA 4AXLA 1Q6KA 4X6HA 4BPVA 1M6DA 4FK5A 2FRQA 3P5UA 3S3RA 6PADA 3HD3A 1PPOA 1STFE 1GMYA 1CQDA 1EWOA 3PDFA 3MTNA 4QRVA 2DJGB 1PADA 3CBJA 4CDDB 2P86A 1ITOA 2P7UA 3N4CA 3N3KA 1CSBB 2YJBA 3KWZA 5F02A 1NQCA 1Y08A 4YV8A 3WXFA 3F5VA 4G54A 3OF8A 2NQAA 3KSEA 4X6JA 3BOWA 3O0UA 4XR7A 2XU5A 2R9FA 3IHPA 3GCBA 3DF0A 3PNRA 3U8EA 2G7YA 2E01A 3PW3A 4QH6A 3KWBX 3AI8A 2ARYA 2AYNA 2E02A 1GCBA 1AECA 3WXEA 1DF0A 4OEMA 4DMXA 2C0YA 3BC3A 3IUTA 1DEUA 2DC6A 1VJVA 1YK8A 1BQIA 3MORA 1JQPA 4YYQA 2DCCA 3OVXA 2Y6EA 1CVZA 1PPPA 3K9MA 2XU1A 2E00A 1PCIA 2AUXA 3RVWA 1TLOA 2XU3A 2IPPB 2H7JA 5CVOB 4PI3A 3LXSA 2XU4A 2PADA
chains in the Genus database with same CATH superfamily
1GLOA 2CIOA 3RVVA 1K3BB 1XKGA 2CB5A 4YYSA 3BB7A 3S3QA 3PBHA 1AU4A 2YJ9A 3KKUA 1U9XA 2JQGR 3N3GA 2PBHA 1QOLA 2IBIA 2R9NA 2AIMA 5EGWA 2DCDA 3M99A 1PPDA 3MHHA 2NQDB 2E03A 3KW9A 1THEA 3NHEA 5CHTA 2FTDA 1AU0A 1AYUA 3PHXA 1YALA 4W5BA 4M0WA 1KFXL 3E1ZB 4BQVA 4MZOA 2FQ9A 1PXVA 3KFQA 4QRXA 5CHVA 1KHPA 2FUDA 1SP4B 3BCNA 2HH5A 2OZ2A 1CV8A 2G6DA 1O0EA 2J7QA 2G8JA 1DKIA 2R9CA 1AYWA 3IEJA 1YK7A 2HD5A 3MHSA 1EWPA 1QMYA 1POPA 2GFOA 4D8IA 1PE6A 3O65A 4OVZB 3BBAA 1IWDA 4R3DA 1CB5A 2B1MA 1PPNA 1TL9A 3MJ5A 2R6NA 1AU2A 3PHWA 3V6EA 2YJCA 5KO3A 2DC7A 2JRIA 2DC8A 5JA7A 2WBFX 3P5WA 1AIMA 2JTCA 3C9EA 2F7DA 4N8WA 4W4UA 1MDWA 2FYEA 1CJLA 3BWKA 4YYUA 3BPMA 2R9OA 2JQFR 3CH2X 3IV2A 1NB3A 4CDFB 2B1NA 1F29A 4FJCA 3P5XA 4X6IA 1X9YA 4CZWA 3QJ3A 3H8BA 4WA6A 2AU1A 3K24A 4D8EA 4I07A 2YJ8A 1U9WA 4PT5A 5CVNB 4BS5A 3C0RA 3IFUA 4BOPA 4W5CA 1KXRA 3H6SA 4XUIA 4QBBA 1BGOA 5EF4A 3OISA 4BOQA 1AYVA 4BSQA 7PCKA 1NL6A 4IUMA 1CTEA 9PAPA 5EZSA 5JH3A 1CS8A 2BU3A 2VHFA 3WXGA 1PBHA 4PP1A 2HHNA 2FO5A 1U9VA 4P6GA 1ME3A 2DZZA 1NB5A 2AUZA 1ZIVA 2DC9A 2DCBA 2R9MA 1EWLA 2HXZA 1EF7A 1A6RA 2GHUA 1UKFA 3KX1A 2OULA 1U5IA 3K8UA 3F75A 5A24A 4IP3A 4MI7A 4DMYA 4KLBA 4P6EA 1EWMA 4OVZA 4HXDB 4YYVA 2AYOA 2BTWB 2G8EA 4N4ZA 1YT7A 4ZUXU 4PADA 1ATKA 4BS6A 2Y5BA 1MEGA 5PADA 3V6CA 3QSDA 4CDCB 5EZQA 4MSXA 5J94A 1YZBA 2PNSA 1QDQA 1CPJA 4MZSA 3I06A 1VSNA 1QXPA 1PIPA 1NLJA 2NQGA 3O1GA 3I3TA 3ZUAA 3B21A 2OP3A 2NQIA 1KFUL 4OELA 2AS8A 2ACTA 4MM3B 2FRAA 1FH0A 2F1GA 3PSEA 4RF1A 2P0RA 3H8CA 3QT4A 1ZCMA 2FT2A 1NPZA 1MIRA 1AU3A 1S4VA 2O6XA 3HHAA 4YVAA 3USVA 3HWNA 4HWYA 3CH3X 5K16A 3ZNHA 3P5VA 1BY8A 4D8BA 4I04A 3PT2A 4PP2E 1ICFA 4N79A 2BDLA 4Q8GA 4Q8HA 1MHWA 2VHSA 3E9SA 2UZJA 1HUCB 3H89A 2HWKA 1F2AA 4WURA 3OF9A 4RKXA 8PCHA 1SNKA 2BDZA 1F2BA 2YJ2A 3HHIA 2DZYA 3LFYA 3RVXA 1KHQA 1BP4A 2PREA 3B79A 4RY2A 5CVMA 1ME4A 3OVZA 3ERVA 2DJFB 1GECE 1MEMA 2AVWA 2BTWA 1U9QX 2AGAA 2FE8A 2ATOA 4CDEB 3CBKA 3IMAA 1Y4HA 4YYWA 1F2CA 2DCAA 4K7CA 3H7DA 4FIPA 4AXMA 4YYRA 4QRGA 1MS6A 1YVBA 2J7QC 3BPFA 4GUAA 5FPWA 3OQCA 1TU6A 3PRPA 4I05A 3D6SA 3MTVA 3TNXA 3IOQA 4AXLA 1Q6KA 4X6HA 4BPVA 1M6DA 4FK5A 4OW0A 2FRQA 3P5UA 3S3RA 6PADA 3HD3A 4XZXA 1PPOA 1STFE 1GMYA 1CQDA 1EWOA 3PDFA 3MTNA 4QRVA 2DOSA 4BOUA 2DJGB 1PADA 3CBJA 5E6JA 4CDDB 2P86A 1ITOA 2P7UA 3N4CA 3N3KA 4REZA 1CSBB 2YJBA 3KWZA 4ZTBA 5F02A 1NQCA 3BY4A 1Y08A 4RNAA 4YV8A 3WXFA 3F5VA 4G54A 2Z84A 3OF8A 2NQAA 3KSEA 4X6JA 3BOWA 3O0UA 4XR7A 3W30A 2XU5A 3W31A 2R9FA 3IHPA 3GCBA 3DF0A 3PRMA 3PNRA 3U8EA 2G7YA 2E01A 3PHUA 3PW3A 4QH6A 3KWBX 3AI8A 2ARYA 2AYNA 2E02A 1GCBA 3RNVA 1AECA 5JZEA 3TMPA 3TRKA 3WXEA 1DF0A 4OEMA 4DMXA 2C0YA 3BC3A 3MP2A 3IUTA 1DEUA 2DC6A 1VJVA 1YK8A 4P16A 1BQIA 3MORA 1JQPA 4YYQA 2DCCA 3OVXA 2Y6EA 1CVZA 1PPPA 3K9MA 2XU1A 2E00A 4BOSA 1PCIA 2AUXA 3RVWA 1TLOA 2XU3A 4BOZA 2IPPB 2H7JA 5CVOB 4PI3A 3LXSA 4RF0A 1PVJA 4A5UA 2XU4A 2PADA
chains in the Genus database with same CATH topology
1GLOA 2CIOA 3RVVA 1K3BB 1XKGA 2CB5A 4YYSA 3S3QA 3PBHA 1AU4A 2YJ9A 3KKUA 1U9XA 2JQGR 3N3GA 2PBHA 1QOLA 2IBIA 2R9NA 2AIMA 5EGWA 2DCDA 3M99A 1PPDA 3MHHA 2NQDB 2E03A 3KW9A 1THEA 3NHEA 5CHTA 2FTDA 1AU0A 1AYUA 1YALA 4W5BA 1KFXL 3E1ZB 4BQVA 4MZOA 2FQ9A 1PXVA 3KFQA 4QRXA 5CHVA 1KHPA 2FUDA 1SP4B 3BCNA 2HH5A 2OZ2A 1CV8A 2G6DA 1O0EA 2G8JA 2R9CA 1AYWA 3IEJA 1YK7A 2HD5A 3MHSA 1EWPA 1QMYA 1POPA 2GFOA 1PE6A 1IWDA 1CB5A 2B1MA 1PPNA 1TL9A 2R6NA 1AU2A 3V6EA 2YJCA 2DC7A 2DC8A 5JA7A 2WBFX 3P5WA 1AIMA 3C9EA 4N8WA 2F7DA 4W4UA 1MDWA 2FYEA 1CJLA 3BWKA 4YYUA 3BPMA 2BSZA 2R9OA 2JQFR 3CH2X 3IV2A 1NB3A 4CDFB 2B1NA 1F29A 4FJCA 3P5XA 4X6IA 1X9YA 4CZWA 3QJ3A 3H8BA 4WA6A 2AU1A 3K24A 4I07A 2YJ8A 1U9WA 5CVNB 4BS5A 4B55A 4W5CA 1KXRA 3H6SA 4XUIA 4QBBA 1BGOA 5EF4A 3OISA 1AYVA 4BSQA 7PCKA 1NL6A 1CTEA 9PAPA 5JH3A 1CS8A 2VHFA 3WXGA 1PBHA 4PP1A 2HHNA 2FO5A 1U9VA 4P6GA 1ME3A 2DZZA 1NB5A 1W6FA 2AUZA 1ZIVA 2DC9A 2DCBA 2R9MA 1EWLA 2HXZA 3LTWA 1EF7A 1A6RA 2GHUA 3KX1A 2OULA 1U5IA 3K8UA 3F75A 5A24A 4DMYA 4KLBA 4P6EA 1EWMA 4YYVA 2AYOA 2G8EA 4N4ZA 1YT7A 4ZUXU 4PADA 1ATKA 4BS6A 2Y5BA 1MEGA 5PADA 3V6CA 3QSDA 4CDCB 4MSXA 5J94A 2PNSA 1QDQA 1CPJA 4MZSA 1W4TA 3I06A 1W5RA 1VSNA 1QXPA 1PIPA 1NLJA 2NQGA 3O1GA 3I3TA 3ZUAA 2OP3A 2NQIA 1KFUL 4OELA 2AS8A 2ACTA 2FRAA 1FH0A 2F1GA 2P0RA 3H8CA 3QT4A 1ZCMA 2FT2A 1NPZA 1MIRA 1AU3A 1S4VA 2O6XA 3HHAA 4YVAA 3USVA 3HWNA 4HWYA 3CH3X 2VFCA 5K16A 3P5VA 1BY8A 4I04A 4PP2E 1ICFA 4N79A 2BDLA 4Q8GA 4Q8HA 1MHWA 2VHSA 1HUCB 3H89A 1F2AA 3OF9A 8PCHA 1SNKA 2BDZA 1F2BA 2YJ2A 3HHIA 2DZYA 3LFYA 3RVXA 1KHQA 1BP4A 2PREA 3B79A 4RY2A 4NV8A 5CVMA 1ME4A 3OVZA 3ERVA 2DJFB 4GUZA 1GECE 1MEMA 2AVWA 1U9QX 2ATOA 4CDEB 3CBKA 3IMAA 1Y4HA 4YYWA 1F2CA 2DCAA 4K7CA 3H7DA 4FIPA 4AXMA 4YYRA 4QRGA 1MS6A 1YVBA 3BPFA 4BGFA 5FPWA 1TU6A 4I05A 3D6SA 3TNXA 3IOQA 4AXLA 1Q6KA 4X6HA 4BPVA 1M6DA 2VFBA 4FK5A 2FRQA 3P5UA 3S3RA 6PADA 3HD3A 1PPOA 1STFE 1GMYA 1CQDA 1EWOA 3PDFA 3MTNA 4QRVA 2DJGB 1PADA 3CBJA 4CDDB 2P86A 1ITOA 2P7UA 3N4CA 3N3KA 1CSBB 2YJBA 3KWZA 5F02A 1E2TA 1NQCA 1Y08A 4NV7A 4YV8A 3WXFA 3F5VA 4G54A 3OF8A 2NQAA 3KSEA 4X6JA 3BOWA 3O0UA 4XR7A 2XU5A 2R9FA 3IHPA 3GCBA 3DF0A 3PNRA 3U8EA 2G7YA 2E01A 3PW3A 4QH6A 3KWBX 3AI8A 2ARYA 2AYNA 2E02A 1GCBA 1AECA 4C5PA 3WXEA 1DF0A 4OEMA 4DMXA 2C0YA 3BC3A 3IUTA 1DEUA 2DC6A 1VJVA 1YK8A 1GX3A 1BQIA 3MORA 1JQPA 4YYQA 2DCCA 3OVXA 2Y6EA 1CVZA 3D9WA 1PPPA 3K9MA 2XU1A 2E00A 1PCIA 2AUXA 3RVWA 1TLOA 2XU3A 2IPPB 2H7JA 5CVOB 4PI3A 3LXSA 2XU4A 2PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GLO A;  2CIO A;  3RVV A;  1K3B B;  1XKG A;  2CB5 A;  4YYS A;  3S3Q A;  3PBH A;  1AU4 A;  2YJ9 A;  3KKU A;  1U9X A;  2JQG R;  3N3G A;  2PBH A;  1QOL A;  2IBI A;  2R9N A;  2AIM A;  5EGW A;  2DCD A;  3M99 A;  1PPD A;  3MHH A;  2NQD B;  2E03 A;  3KW9 A;  1THE A;  3NHE A;  5CHT A;  2FTD A;  1AU0 A;  1AYU A;  1YAL A;  4W5B A;  1KFX L;  3E1Z B;  4BQV A;  4MZO A;  2FQ9 A;  1PXV A;  3KFQ A;  4QRX A;  5CHV A;  1KHP A;  2FUD A;  1SP4 B;  3BCN A;  2HH5 A;  2OZ2 A;  1CV8 A;  2G6D A;  1O0E A;  2G8J A;  2R9C A;  1AYW A;  3IEJ A;  1YK7 A;  2HD5 A;  3MHS A;  1EWP A;  1QMY A;  1POP A;  2GFO A;  1PE6 A;  1IWD A;  1CB5 A;  2B1M A;  1PPN A;  1TL9 A;  2R6N A;  1AU2 A;  3V6E A;  2YJC A;  2DC7 A;  2DC8 A;  5JA7 A;  2WBF X;  3P5W A;  1AIM A;  3C9E A;  4N8W A;  2F7D A;  4W4U A;  1MDW A;  2FYE A;  1CJL A;  3BWK A;  4YYU A;  3BPM A;  2R9O A;  2JQF R;  3CH2 X;  3IV2 A;  1NB3 A;  4CDF B;  2B1N A;  1F29 A;  4FJC A;  3P5X A;  4X6I A;  1X9Y A;  4CZW A;  3QJ3 A;  3H8B A;  4WA6 A;  2AU1 A;  3K24 A;  4I07 A;  2YJ8 A;  1U9W A;  5CVN B;  4BS5 A;  4W5C A;  1KXR A;  3H6S A;  4XUI A;  4QBB A;  1BGO A;  5EF4 A;  3OIS A;  1AYV A;  4BSQ A;  7PCK A;  1NL6 A;  1CTE A;  9PAP A;  5JH3 A;  1CS8 A;  2VHF A;  3WXG A;  1PBH A;  4PP1 A;  2HHN A;  2FO5 A;  1U9V A;  4P6G A;  1ME3 A;  2DZZ A;  1NB5 A;  2AUZ A;  1ZIV A;  2DC9 A;  2DCB A;  2R9M A;  1EWL A;  2HXZ A;  1EF7 A;  1A6R A;  2GHU A;  3KX1 A;  2OUL A;  1U5I A;  3K8U A;  3F75 A;  5A24 A;  4DMY A;  4KLB A;  4P6E A;  1EWM A;  4YYV A;  2AYO A;  2G8E A;  4N4Z A;  1YT7 A;  4ZUX U;  4PAD A;  1ATK A;  4BS6 A;  2Y5B A;  1MEG A;  5PAD A;  3V6C A;  3QSD A;  4CDC B;  4MSX A;  5J94 A;  2PNS A;  1QDQ A;  1CPJ A;  4MZS A;  3I06 A;  1VSN A;  1QXP A;  1PIP A;  1NLJ A;  2NQG A;  3O1G A;  3I3T A;  3ZUA A;  2OP3 A;  2NQI A;  1KFU L;  4OEL A;  2AS8 A;  2ACT A;  2FRA A;  1FH0 A;  2F1G A;  2P0R A;  3H8C A;  3QT4 A;  1ZCM A;  2FT2 A;  1NPZ A;  1MIR A;  1AU3 A;  1S4V A;  2O6X A;  3HHA A;  4YVA A;  3USV A;  3HWN A;  4HWY A;  3CH3 X;  5K16 A;  3P5V A;  1BY8 A;  4I04 A;  4PP2 E;  1ICF A;  4N79 A;  2BDL A;  4Q8G A;  4Q8H A;  1MHW A;  2VHS A;  1HUC B;  3H89 A;  1F2A A;  3OF9 A;  8PCH A;  1SNK A;  2BDZ A;  1F2B A;  2YJ2 A;  3HHI A;  2DZY A;  3LFY A;  3RVX A;  1KHQ A;  1BP4 A;  2PRE A;  3B79 A;  4RY2 A;  5CVM A;  1ME4 A;  3OVZ A;  3ERV A;  2DJF B;  1GEC E;  1MEM A;  2AVW A;  1U9Q X;  2ATO A;  4CDE B;  3CBK A;  3IMA A;  1Y4H A;  4YYW A;  1F2C A;  2DCA A;  4K7C A;  3H7D A;  4FIP A;  4AXM A;  4YYR A;  4QRG A;  1MS6 A;  1YVB A;  3BPF A;  5FPW A;  1TU6 A;  4I05 A;  3D6S A;  3TNX A;  3IOQ A;  4AXL A;  1Q6K A;  4X6H A;  4BPV A;  1M6D A;  4FK5 A;  2FRQ A;  3P5U A;  3S3R A;  6PAD A;  3HD3 A;  1PPO A;  1STF E;  1GMY A;  1CQD A;  1EWO A;  3PDF A;  3MTN A;  4QRV A;  2DJG B;  1PAD A;  3CBJ A;  4CDD B;  2P86 A;  1ITO A;  2P7U A;  3N4C A;  3N3K A;  1CSB B;  2YJB A;  3KWZ A;  5F02 A;  1NQC A;  1Y08 A;  4YV8 A;  3WXF A;  3F5V A;  4G54 A;  3OF8 A;  2NQA A;  3KSE A;  4X6J A;  3BOW A;  3O0U A;  4XR7 A;  2XU5 A;  2R9F A;  3IHP A;  3GCB A;  3DF0 A;  3PNR A;  3U8E A;  2G7Y A;  2E01 A;  3PW3 A;  4QH6 A;  3KWB X;  3AI8 A;  2ARY A;  2AYN A;  2E02 A;  1GCB A;  1AEC A;  3WXE A;  1DF0 A;  4OEM A;  4DMX A;  2C0Y A;  3BC3 A;  3IUT A;  1DEU A;  2DC6 A;  1VJV A;  1YK8 A;  1BQI A;  3MOR A;  1JQP A;  4YYQ A;  2DCC A;  3OVX A;  2Y6E A;  1CVZ A;  1PPP A;  3K9M A;  2XU1 A;  2E00 A;  1PCI A;  2AUX A;  3RVW A;  1TLO A;  2XU3 A;  2IPP B;  2H7J A;  5CVO B;  4PI3 A;  3LXS A;  2XU4 A;  2PAD A; 
#chains in the Genus database with same CATH topology
 1GLO A;  2CIO A;  3RVV A;  1K3B B;  1XKG A;  2CB5 A;  4YYS A;  3BB7 A;  3S3Q A;  3PBH A;  1AU4 A;  2YJ9 A;  3KKU A;  1U9X A;  2JQG R;  3N3G A;  2PBH A;  1QOL A;  2IBI A;  2R9N A;  2AIM A;  5EGW A;  2DCD A;  3M99 A;  1PPD A;  3MHH A;  2NQD B;  2E03 A;  3KW9 A;  1THE A;  3NHE A;  5CHT A;  2FTD A;  1AU0 A;  1AYU A;  3PHX A;  1YAL A;  4W5B A;  4M0W A;  1KFX L;  3E1Z B;  4BQV A;  4MZO A;  2FQ9 A;  1PXV A;  3KFQ A;  4QRX A;  5CHV A;  1KHP A;  2FUD A;  1SP4 B;  3BCN A;  2HH5 A;  2OZ2 A;  1CV8 A;  2G6D A;  1O0E A;  2J7Q A;  2G8J A;  1DKI A;  2R9C A;  1AYW A;  3IEJ A;  1YK7 A;  2HD5 A;  3MHS A;  1EWP A;  1QMY A;  1POP A;  2GFO A;  4D8I A;  1PE6 A;  3O65 A;  4OVZ B;  3BBA A;  1IWD A;  4R3D A;  1CB5 A;  2B1M A;  1PPN A;  1TL9 A;  3MJ5 A;  2R6N A;  1AU2 A;  3PHW A;  3V6E A;  2YJC A;  5KO3 A;  2DC7 A;  2JRI A;  2DC8 A;  5JA7 A;  2WBF X;  3P5W A;  1AIM A;  2JTC A;  3C9E A;  2F7D A;  4N8W A;  4W4U A;  1MDW A;  2FYE A;  1CJL A;  3BWK A;  4YYU A;  3BPM A;  2R9O A;  2JQF R;  3CH2 X;  3IV2 A;  1NB3 A;  4CDF B;  2B1N A;  1F29 A;  4FJC A;  3P5X A;  4X6I A;  1X9Y A;  4CZW A;  3QJ3 A;  3H8B A;  4WA6 A;  2AU1 A;  3K24 A;  4D8E A;  4I07 A;  2YJ8 A;  1U9W A;  4PT5 A;  5CVN B;  4BS5 A;  3C0R A;  3IFU A;  4BOP A;  4W5C A;  1KXR A;  3H6S A;  4XUI A;  4QBB A;  1BGO A;  5EF4 A;  3OIS A;  4BOQ A;  1AYV A;  4BSQ A;  7PCK A;  1NL6 A;  4IUM A;  1CTE A;  9PAP A;  5EZS A;  5JH3 A;  1CS8 A;  2BU3 A;  2VHF A;  3WXG A;  1PBH A;  4PP1 A;  2HHN A;  2FO5 A;  1U9V A;  4P6G A;  1ME3 A;  2DZZ A;  1NB5 A;  2AUZ A;  1ZIV A;  2DC9 A;  2DCB A;  2R9M A;  1EWL A;  2HXZ A;  1EF7 A;  1A6R A;  2GHU A;  1UKF A;  3KX1 A;  2OUL A;  1U5I A;  3K8U A;  3F75 A;  5A24 A;  4IP3 A;  4MI7 A;  4DMY A;  4KLB A;  4P6E A;  1EWM A;  4OVZ A;  4HXD B;  4YYV A;  2AYO A;  2BTW B;  2G8E A;  4N4Z A;  1YT7 A;  4ZUX U;  4PAD A;  1ATK A;  4BS6 A;  2Y5B A;  1MEG A;  5PAD A;  3V6C A;  3QSD A;  4CDC B;  5EZQ A;  4MSX A;  5J94 A;  1YZB A;  2PNS A;  1QDQ A;  1CPJ A;  4MZS A;  3I06 A;  1VSN A;  1QXP A;  1PIP A;  1NLJ A;  2NQG A;  3O1G A;  3I3T A;  3ZUA A;  3B21 A;  2OP3 A;  2NQI A;  1KFU L;  4OEL A;  2AS8 A;  2ACT A;  4MM3 B;  2FRA A;  1FH0 A;  2F1G A;  3PSE A;  4RF1 A;  2P0R A;  3H8C A;  3QT4 A;  1ZCM A;  2FT2 A;  1NPZ A;  1MIR A;  1AU3 A;  1S4V A;  2O6X A;  3HHA A;  4YVA A;  3USV A;  3HWN A;  4HWY A;  3CH3 X;  5K16 A;  3ZNH A;  3P5V A;  1BY8 A;  4D8B A;  4I04 A;  3PT2 A;  4PP2 E;  1ICF A;  4N79 A;  2BDL A;  4Q8G A;  4Q8H A;  1MHW A;  2VHS A;  3E9S A;  2UZJ A;  1HUC B;  3H89 A;  2HWK A;  1F2A A;  4WUR A;  3OF9 A;  4RKX A;  8PCH A;  1SNK A;  2BDZ A;  1F2B A;  2YJ2 A;  3HHI A;  2DZY A;  3LFY A;  3RVX A;  1KHQ A;  1BP4 A;  2PRE A;  3B79 A;  4RY2 A;  5CVM A;  1ME4 A;  3OVZ A;  3ERV A;  2DJF B;  1GEC E;  1MEM A;  2AVW A;  2BTW A;  1U9Q X;  2AGA A;  2FE8 A;  2ATO A;  4CDE B;  3CBK A;  3IMA A;  1Y4H A;  4YYW A;  1F2C A;  2DCA A;  4K7C A;  3H7D A;  4FIP A;  4AXM A;  4YYR A;  4QRG A;  1MS6 A;  1YVB A;  2J7Q C;  3BPF A;  4GUA A;  5FPW A;  3OQC A;  1TU6 A;  3PRP A;  4I05 A;  3D6S A;  3MTV A;  3TNX A;  3IOQ A;  4AXL A;  1Q6K A;  4X6H A;  4BPV A;  1M6D A;  4FK5 A;  4OW0 A;  2FRQ A;  3P5U A;  3S3R A;  6PAD A;  3HD3 A;  4XZX A;  1PPO A;  1STF E;  1GMY A;  1CQD A;  1EWO A;  3PDF A;  3MTN A;  4QRV A;  2DOS A;  4BOU A;  2DJG B;  1PAD A;  3CBJ A;  5E6J A;  4CDD B;  2P86 A;  1ITO A;  2P7U A;  3N4C A;  3N3K A;  4REZ A;  1CSB B;  2YJB A;  3KWZ A;  4ZTB A;  5F02 A;  1NQC A;  3BY4 A;  1Y08 A;  4RNA A;  4YV8 A;  3WXF A;  3F5V A;  4G54 A;  2Z84 A;  3OF8 A;  2NQA A;  3KSE A;  4X6J A;  3BOW A;  3O0U A;  4XR7 A;  3W30 A;  2XU5 A;  3W31 A;  2R9F A;  3IHP A;  3GCB A;  3DF0 A;  3PRM A;  3PNR A;  3U8E A;  2G7Y A;  2E01 A;  3PHU A;  3PW3 A;  4QH6 A;  3KWB X;  3AI8 A;  2ARY A;  2AYN A;  2E02 A;  1GCB A;  3RNV A;  1AEC A;  5JZE A;  3TMP A;  3TRK A;  3WXE A;  1DF0 A;  4OEM A;  4DMX A;  2C0Y A;  3BC3 A;  3MP2 A;  3IUT A;  1DEU A;  2DC6 A;  1VJV A;  1YK8 A;  4P16 A;  1BQI A;  3MOR A;  1JQP A;  4YYQ A;  2DCC A;  3OVX A;  2Y6E A;  1CVZ A;  1PPP A;  3K9M A;  2XU1 A;  2E00 A;  4BOS A;  1PCI A;  2AUX A;  3RVW A;  1TLO A;  2XU3 A;  4BOZ A;  2IPP B;  2H7J A;  5CVO B;  4PI3 A;  3LXS A;  4RF0 A;  1PVJ A;  4A5U A;  2XU4 A;  2PAD A; 
#chains in the Genus database with same CATH homology
 1GLO A;  2CIO A;  3RVV A;  1K3B B;  1XKG A;  2CB5 A;  4YYS A;  3S3Q A;  3PBH A;  1AU4 A;  2YJ9 A;  3KKU A;  1U9X A;  2JQG R;  3N3G A;  2PBH A;  1QOL A;  2IBI A;  2R9N A;  2AIM A;  5EGW A;  2DCD A;  3M99 A;  1PPD A;  3MHH A;  2NQD B;  2E03 A;  3KW9 A;  1THE A;  3NHE A;  5CHT A;  2FTD A;  1AU0 A;  1AYU A;  1YAL A;  4W5B A;  1KFX L;  3E1Z B;  4BQV A;  4MZO A;  2FQ9 A;  1PXV A;  3KFQ A;  4QRX A;  5CHV A;  1KHP A;  2FUD A;  1SP4 B;  3BCN A;  2HH5 A;  2OZ2 A;  1CV8 A;  2G6D A;  1O0E A;  2G8J A;  2R9C A;  1AYW A;  3IEJ A;  1YK7 A;  2HD5 A;  3MHS A;  1EWP A;  1QMY A;  1POP A;  2GFO A;  1PE6 A;  1IWD A;  1CB5 A;  2B1M A;  1PPN A;  1TL9 A;  2R6N A;  1AU2 A;  3V6E A;  2YJC A;  2DC7 A;  2DC8 A;  5JA7 A;  2WBF X;  3P5W A;  1AIM A;  3C9E A;  4N8W A;  2F7D A;  4W4U A;  1MDW A;  2FYE A;  1CJL A;  3BWK A;  4YYU A;  3BPM A;  2BSZ A;  2R9O A;  2JQF R;  3CH2 X;  3IV2 A;  1NB3 A;  4CDF B;  2B1N A;  1F29 A;  4FJC A;  3P5X A;  4X6I A;  1X9Y A;  4CZW A;  3QJ3 A;  3H8B A;  4WA6 A;  2AU1 A;  3K24 A;  4I07 A;  2YJ8 A;  1U9W A;  5CVN B;  4BS5 A;  4B55 A;  4W5C A;  1KXR A;  3H6S A;  4XUI A;  4QBB A;  1BGO A;  5EF4 A;  3OIS A;  1AYV A;  4BSQ A;  7PCK A;  1NL6 A;  1CTE A;  9PAP A;  5JH3 A;  1CS8 A;  2VHF A;  3WXG A;  1PBH A;  4PP1 A;  2HHN A;  2FO5 A;  1U9V A;  4P6G A;  1ME3 A;  2DZZ A;  1NB5 A;  1W6F A;  2AUZ A;  1ZIV A;  2DC9 A;  2DCB A;  2R9M A;  1EWL A;  2HXZ A;  3LTW A;  1EF7 A;  1A6R A;  2GHU A;  3KX1 A;  2OUL A;  1U5I A;  3K8U A;  3F75 A;  5A24 A;  4DMY A;  4KLB A;  4P6E A;  1EWM A;  4YYV A;  2AYO A;  2G8E A;  4N4Z A;  1YT7 A;  4ZUX U;  4PAD A;  1ATK A;  4BS6 A;  2Y5B A;  1MEG A;  5PAD A;  3V6C A;  3QSD A;  4CDC B;  4MSX A;  5J94 A;  2PNS A;  1QDQ A;  1CPJ A;  4MZS A;  1W4T A;  3I06 A;  1W5R A;  1VSN A;  1QXP A;  1PIP A;  1NLJ A;  2NQG A;  3O1G A;  3I3T A;  3ZUA A;  2OP3 A;  2NQI A;  1KFU L;  4OEL A;  2AS8 A;  2ACT A;  2FRA A;  1FH0 A;  2F1G A;  2P0R A;  3H8C A;  3QT4 A;  1ZCM A;  2FT2 A;  1NPZ A;  1MIR A;  1AU3 A;  1S4V A;  2O6X A;  3HHA A;  4YVA A;  3USV A;  3HWN A;  4HWY A;  3CH3 X;  2VFC A;  5K16 A;  3P5V A;  1BY8 A;  4I04 A;  4PP2 E;  1ICF A;  4N79 A;  2BDL A;  4Q8G A;  4Q8H A;  1MHW A;  2VHS A;  1HUC B;  3H89 A;  1F2A A;  3OF9 A;  8PCH A;  1SNK A;  2BDZ A;  1F2B A;  2YJ2 A;  3HHI A;  2DZY A;  3LFY A;  3RVX A;  1KHQ A;  1BP4 A;  2PRE A;  3B79 A;  4RY2 A;  4NV8 A;  5CVM A;  1ME4 A;  3OVZ A;  3ERV A;  2DJF B;  4GUZ A;  1GEC E;  1MEM A;  2AVW A;  1U9Q X;  2ATO A;  4CDE B;  3CBK A;  3IMA A;  1Y4H A;  4YYW A;  1F2C A;  2DCA A;  4K7C A;  3H7D A;  4FIP A;  4AXM A;  4YYR A;  4QRG A;  1MS6 A;  1YVB A;  3BPF A;  4BGF A;  5FPW A;  1TU6 A;  4I05 A;  3D6S A;  3TNX A;  3IOQ A;  4AXL A;  1Q6K A;  4X6H A;  4BPV A;  1M6D A;  2VFB A;  4FK5 A;  2FRQ A;  3P5U A;  3S3R A;  6PAD A;  3HD3 A;  1PPO A;  1STF E;  1GMY A;  1CQD A;  1EWO A;  3PDF A;  3MTN A;  4QRV A;  2DJG B;  1PAD A;  3CBJ A;  4CDD B;  2P86 A;  1ITO A;  2P7U A;  3N4C A;  3N3K A;  1CSB B;  2YJB A;  3KWZ A;  5F02 A;  1E2T A;  1NQC A;  1Y08 A;  4NV7 A;  4YV8 A;  3WXF A;  3F5V A;  4G54 A;  3OF8 A;  2NQA A;  3KSE A;  4X6J A;  3BOW A;  3O0U A;  4XR7 A;  2XU5 A;  2R9F A;  3IHP A;  3GCB A;  3DF0 A;  3PNR A;  3U8E A;  2G7Y A;  2E01 A;  3PW3 A;  4QH6 A;  3KWB X;  3AI8 A;  2ARY A;  2AYN A;  2E02 A;  1GCB A;  1AEC A;  4C5P A;  3WXE A;  1DF0 A;  4OEM A;  4DMX A;  2C0Y A;  3BC3 A;  3IUT A;  1DEU A;  2DC6 A;  1VJV A;  1YK8 A;  1GX3 A;  1BQI A;  3MOR A;  1JQP A;  4YYQ A;  2DCC A;  3OVX A;  2Y6E A;  1CVZ A;  3D9W A;  1PPP A;  3K9M A;  2XU1 A;  2E00 A;  1PCI A;  2AUX A;  3RVW A;  1TLO A;  2XU3 A;  2IPP B;  2H7J A;  5CVO B;  4PI3 A;  3LXS A;  2XU4 A;  2PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...