2DC9A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca074me complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
253
structure length
251
Chain Sequence
b'LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
total genus 78
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc9A00
1U9QX 1GMYA 2IBIA 3WXGA 1BQIA 3N4CA 3MORA 4KLBA 1KXRA 1AYVA 3KWZA 3MTNA 1EWOA 4CDEB 3M99A 2Y5BA 3K9MA 1U9XA 2E01A 4BQVA 1QMYA 2E02A 1POPA 2YJCA 1ZCMA 2FYEA 2DZYA 4P6GA 2G8EA 1MEMA 1AIMA 2IPPB 1SP4B 1Y4HA 3KX1A 3S3RA 3DF0A 2GHUA 3H8CA 4N79A 4XR7A 9PAPA 4YYRA 3E1ZB 1CVZA 3IOQA 1CB5A 3H7DA 4DMXA 4K7CA 2WBFX 1Y08A 1PPOA 2G7YA 1EWLA 2ACTA 5JH3A 2DCDA 7PCKA 3PNRA 5JA7A 2FUDA 2ATOA 3MHSA 1MS6A 1CPJA 1ME3A 2C0YA 1A6RA 2E03A 5PADA 4AXLA 6PADA 3PBHA 4Q8HA 2DCBA 3I3TA 4OEMA 1MIRA 1GECE 3N3KA 1CTEA 4BS5A 3KFQA 2P0RA 1YK8A 2AYOA 1THEA 4X6IA 2PREA 3RVWA 4CZWA 2DC7A 5EF4A 3IV2A 2JQGR 4BSQA 1K3BB 1KHQA 2OP3A 1PBHA 1ICFA 1PPPA 3BPMA 2JQFR 1U5IA 1PXVA 1EWMA 1BP4A 3IHPA 2O6XA 3HHIA 1NB3A 2FQ9A 3BWKA 5EGWA 4W5BA 2PBHA 4PADA 2GFOA 2FRAA 3OF9A 4FK5A 2R9NA 3WXEA 1CV8A 4FIPA 4I04A 1DEUA 3LFYA 1VJVA 3S3QA 3P5UA 3KKUA 3OVZA 2DC8A 3BC3A 3RVVA 2AIMA 3O0UA 1ZIVA 2CIOA 3D6SA 2OZ2A 2VHSA 2B1MA 1PE6A 2F7DA 2AYNA 1PADA 1PPNA 5CHVA 2BDLA 3I06A 3PDFA 2Y6EA 2PADA 3IUTA 2BDZA 2XU1A 1AYUA 3QSDA 1O0EA 3K8UA 3LXSA 2PNSA 1KFXL 4I07A 1AECA 1AU3A 2FRQA 4N4ZA 5CVMA 3QT4A 1CS8A 1NL6A 3RVXA 3V6CA 3PW3A 2R9CA 2XU3A 3CBKA 1IWDA 1YALA 3CH2X 3WXFA 2FT2A 1BY8A 3ZUAA 1KHPA 1AU2A 3BOWA 3F5VA 4YYWA 1S4VA 1CSBB 2YJ9A 3ERVA 3BPFA 3TNXA 4W4UA 1MDWA 4QRVA 3U8EA 1QOLA 2DZZA 4Q8GA 5J94A 4X6HA 2R9OA 4CDFB 4X6JA 3BCNA 1AU4A 3KSEA 2DC6A 1GCBA 1PIPA 3OVXA 2DJFB 1STFE 2R9FA 2AS8A 3CBJA 1NQCA 1TL9A 5CHTA 1CJLA 1YT7A 2R9MA 1EWPA 4YYVA 4P6EA 3KWBX 1U9WA 1FH0A 2HHNA 1ME4A 1NLJA 1XKGA 3H8BA 1ITOA 2XU5A 2ARYA 3MHHA 3HWNA 4MSXA 5F02A 2AUXA 3O1GA 3P5XA 1AYWA 1VSNA 2YJBA 4QRGA 4CDCB 1PPDA 2P86A 2YJ8A 1KFUL 1JQPA 2CB5A 3N3GA 1Q6KA 5K16A 2AUZA 4PI3A 1QDQA 3OF8A 2DJGB 2HD5A 2XU4A 2DC9A 1CQDA 8PCHA 3USVA 4RY2A 1F2BA 4BS6A 4MZOA 5CVOB 1NB5A 1DF0A 1MHWA 5CVNB 2FTDA 4N8WA 2OULA 2G8JA 1YK7A 2NQGA 1NPZA 2G6DA 5FPWA 1QXPA 1GLOA 3CH3X 2F1GA 3B79A 3H89A 4MZSA 2NQDB 1F2CA 3HHAA 4XUIA 3KW9A 4HWYA 3P5WA 4WA6A 4YVAA 2HH5A 2NQIA 4YYQA 1BGOA 2AU1A 4QBBA 1M6DA 3AI8A 1TLOA 1F29A 4AXMA 3K24A 2NQAA 4FJCA 4QRXA 4PP2E 1TU6A 3OISA 3H6SA 3P5VA 4W5CA 2AVWA 4YYUA 1YVBA 3GCBA 2R6NA 1SNKA 5A24A 2VHFA 4OELA 1MEGA 4ZUXU 2YJ2A 2P7UA 1EF7A 2H7JA 1HUCB 2DCCA 1X9YA 4BPVA 4I05A 3NHEA 4QH6A 1PCIA 1U9VA 3IMAA 3C9EA 1ATKA 3V6EA 1AU0A 3F75A 4YV8A 2E00A 4CDDB 3HD3A 3QJ3A 4G54A 3IEJA 1F2AA 2B1NA 4DMYA 2FO5A 4YYSA 2DCAA 2HXZA 4PP1A
chains in the Genus database with same CATH superfamily
1U9QX 1GMYA 2DOSA 2IBIA 3WXGA 4D8BA 1BQIA 3N4CA 3MORA 4KLBA 1KXRA 1AYVA 3B21A 3KWZA 3MTNA 5EZSA 1EWOA 4CDEB 3M99A 2Y5BA 3K9MA 1U9XA 2E01A 4BQVA 1QMYA 2E02A 1POPA 2YJCA 1ZCMA 2FYEA 2DZYA 4P6GA 2G8EA 1MEMA 3IFUA 1AIMA 2IPPB 1SP4B 1Y4HA 3KX1A 3S3RA 3DF0A 2GHUA 3H8CA 4N79A 4XR7A 4M0WA 9PAPA 3TMPA 3PRPA 4YYRA 3E1ZB 1CVZA 3IOQA 1CB5A 3H7DA 3O65A 4DMXA 4K7CA 2WBFX 4IP3A 1Y08A 1PPOA 2G7YA 1EWLA 2ACTA 5JH3A 2DCDA 5E6JA 7PCKA 3PNRA 5JA7A 2FUDA 3PHUA 3W31A 2ATOA 3MHSA 1MS6A 1CPJA 2AGAA 1ME3A 2C0YA 1A6RA 2E03A 5PADA 4REZA 3PSEA 4AXLA 6PADA 3PBHA 4Q8HA 2DCBA 3I3TA 4OEMA 1MIRA 1GECE 3N3KA 1CTEA 4RF1A 2BTWB 4BS5A 3KFQA 2P0RA 1YK8A 2AYOA 1THEA 4X6IA 2PREA 2JRIA 3RVWA 4CZWA 2DC7A 4BOPA 5EF4A 3IV2A 2JQGR 4D8IA 2BTWA 4BSQA 1K3BB 1KHQA 3PHWA 2OP3A 1PBHA 3PT2A 4BOQA 1ICFA 1PPPA 3BPMA 2JQFR 4RNAA 1U5IA 1PXVA 1EWMA 1BP4A 3IHPA 2O6XA 4PT5A 3HHIA 1NB3A 2FQ9A 3BWKA 5EGWA 4BOSA 4W5BA 2PBHA 2Z84A 4PADA 2GFOA 4P16A 2FRAA 3BBAA 3OF9A 3BB7A 4FK5A 2J7QA 2R9NA 3WXEA 1CV8A 3E9SA 4FIPA 4I04A 1DEUA 3LFYA 1VJVA 3S3QA 5JZEA 5EZQA 1PVJA 3P5UA 3KKUA 3OVZA 2DC8A 3BC3A 4WURA 3RVVA 2AIMA 3O0UA 1ZIVA 1UKFA 2CIOA 3D6SA 2OZ2A 2VHSA 2B1MA 1PE6A 2F7DA 2AYNA 1PADA 1PPNA 5CHVA 2BDLA 3I06A 3PDFA 2Y6EA 2PADA 3IUTA 2BDZA 2XU1A 5KO3A 1AYUA 3MTVA 3QSDA 1O0EA 3K8UA 3LXSA 2PNSA 1KFXL 4I07A 1AECA 1AU3A 2FRQA 4N4ZA 4OVZB 5CVMA 3QT4A 1CS8A 1NL6A 3RVXA 3V6CA 3PW3A 2R9CA 2XU3A 3C0RA 3CBKA 1IWDA 1YALA 2FE8A 3CH2X 4OVZA 3WXFA 2FT2A 1BY8A 3ZUAA 1KHPA 1AU2A 3BOWA 3F5VA 4YYWA 1S4VA 1CSBB 2YJ9A 3ERVA 3BY4A 3BPFA 3TNXA 4W4UA 4IUMA 1MDWA 4QRVA 4MI7A 3U8EA 1QOLA 2DZZA 4Q8GA 5J94A 4X6HA 2J7QC 2R9OA 4CDFB 4X6JA 3BCNA 1AU4A 3KSEA 2DC6A 1GCBA 1PIPA 3OVXA 2DJFB 1STFE 2R9FA 2AS8A 4A5UA 3CBJA 1NQCA 4HXDB 1TL9A 5CHTA 1CJLA 4GUAA 1YT7A 2R9MA 1EWPA 4YYVA 4ZTBA 4P6EA 1YZBA 3KWBX 1U9WA 1FH0A 2HHNA 1ME4A 1NLJA 1XKGA 3H8BA 1ITOA 2XU5A 3MJ5A 2ARYA 3MHHA 3HWNA 4MSXA 4R3DA 5F02A 2AUXA 3O1GA 3P5XA 1AYWA 1VSNA 2YJBA 4QRGA 2BU3A 4CDCB 1PPDA 2P86A 2YJ8A 1KFUL 1JQPA 2CB5A 3N3GA 4BOUA 1DKIA 4XZXA 1Q6KA 4BOZA 5K16A 4MM3B 4D8EA 2AUZA 4PI3A 1QDQA 3OF8A 2DJGB 2HD5A 2XU4A 2DC9A 1CQDA 8PCHA 3USVA 4RY2A 1F2BA 4BS6A 4MZOA 5CVOB 1NB5A 1DF0A 1MHWA 5CVNB 2FTDA 4N8WA 2OULA 2G8JA 3W30A 1YK7A 2NQGA 1NPZA 2G6DA 5FPWA 1QXPA 1GLOA 3CH3X 3PHXA 2F1GA 3B79A 3H89A 4MZSA 2NQDB 1F2CA 3OQCA 3ZNHA 3HHAA 4XUIA 4RF0A 3KW9A 2HWKA 4HWYA 3P5WA 4WA6A 4YVAA 2HH5A 2NQIA 4YYQA 1BGOA 2UZJA 2AU1A 4QBBA 1M6DA 3AI8A 1TLOA 1F29A 4AXMA 3K24A 2NQAA 4FJCA 4QRXA 4PP2E 1TU6A 3OISA 3H6SA 3P5VA 4W5CA 2AVWA 3TRKA 4YYUA 1YVBA 3GCBA 2R6NA 1SNKA 5A24A 2VHFA 4OELA 1MEGA 4ZUXU 2YJ2A 2P7UA 1EF7A 2H7JA 1HUCB 2DCCA 1X9YA 4BPVA 4I05A 3NHEA 2JTCA 4QH6A 1PCIA 1U9VA 3IMAA 3C9EA 1ATKA 3V6EA 1AU0A 3F75A 4YV8A 2E00A 4CDDB 3HD3A 3PRMA 3QJ3A 4G54A 4RKXA 3IEJA 1F2AA 3MP2A 3RNVA 2B1NA 4DMYA 4OW0A 2FO5A 4YYSA 2DCAA 2HXZA 4PP1A
chains in the Genus database with same CATH topology
1U9QX 1GMYA 2IBIA 3WXGA 1BQIA 3N4CA 3MORA 4KLBA 1KXRA 1AYVA 3KWZA 3MTNA 1EWOA 4CDEB 3M99A 2Y5BA 3K9MA 1U9XA 2E01A 4BQVA 1QMYA 2E02A 1POPA 2YJCA 1ZCMA 2VFBA 2FYEA 2DZYA 4P6GA 2G8EA 1MEMA 1AIMA 2IPPB 1SP4B 1Y4HA 3KX1A 4NV8A 3DF0A 2GHUA 3S3RA 3H8CA 4N79A 4XR7A 9PAPA 4YYRA 3E1ZB 1GX3A 1CVZA 3IOQA 1CB5A 3H7DA 4DMXA 4K7CA 2WBFX 1Y08A 1PPOA 2G7YA 1EWLA 2ACTA 5JH3A 2DCDA 7PCKA 3PNRA 5JA7A 2FUDA 2ATOA 3MHSA 1MS6A 1CPJA 1ME3A 2C0YA 1A6RA 2E03A 5PADA 4AXLA 6PADA 3PBHA 4Q8HA 2DCBA 3I3TA 4OEMA 1MIRA 1GECE 3N3KA 1CTEA 4NV7A 4BS5A 3KFQA 2P0RA 1YK8A 2AYOA 1THEA 4X6IA 2PREA 3RVWA 4CZWA 2DC7A 5EF4A 3IV2A 2JQGR 4BSQA 1K3BB 1KHQA 2OP3A 1PBHA 1ICFA 1PPPA 3BPMA 2JQFR 1U5IA 1PXVA 1EWMA 1BP4A 3IHPA 2O6XA 3HHIA 1NB3A 2FQ9A 3BWKA 5EGWA 4W5BA 2PBHA 4PADA 2GFOA 2FRAA 3OF9A 4FK5A 2R9NA 3WXEA 1CV8A 4FIPA 4I04A 1DEUA 3LFYA 1VJVA 3S3QA 3P5UA 3KKUA 3OVZA 2DC8A 3BC3A 3RVVA 2AIMA 3O0UA 1ZIVA 2CIOA 3D6SA 2OZ2A 2VHSA 2B1MA 1PE6A 2F7DA 2AYNA 1PADA 1PPNA 5CHVA 2BDLA 3I06A 3PDFA 2Y6EA 2PADA 3IUTA 2BDZA 2XU1A 1AYUA 3QSDA 1O0EA 3K8UA 3LXSA 2PNSA 1KFXL 4I07A 1AECA 1AU3A 2FRQA 4N4ZA 5CVMA 3QT4A 1CS8A 1NL6A 3RVXA 3LTWA 3V6CA 3PW3A 2R9CA 2XU3A 3CBKA 1IWDA 1YALA 3CH2X 1W5RA 3WXFA 2FT2A 1BY8A 3ZUAA 1KHPA 1AU2A 3BOWA 3F5VA 4YYWA 1S4VA 1CSBB 2YJ9A 3ERVA 3BPFA 3TNXA 4W4UA 1MDWA 4QRVA 3U8EA 1QOLA 2DZZA 4Q8GA 1E2TA 5J94A 4X6HA 2R9OA 4CDFB 4X6JA 3BCNA 1AU4A 3D9WA 3KSEA 2DC6A 1GCBA 1PIPA 3OVXA 2DJFB 1STFE 2R9FA 2AS8A 3CBJA 1NQCA 1TL9A 5CHTA 1CJLA 1YT7A 2R9MA 1EWPA 4YYVA 4P6EA 3KWBX 1U9WA 1FH0A 2HHNA 1ME4A 1NLJA 1XKGA 3H8BA 1ITOA 2XU5A 2ARYA 3MHHA 3HWNA 4MSXA 5F02A 2AUXA 3O1GA 3P5XA 1AYWA 1VSNA 2YJBA 4QRGA 4CDCB 1PPDA 2P86A 2YJ8A 1KFUL 1JQPA 2CB5A 3N3GA 1W4TA 1Q6KA 5K16A 2AUZA 4PI3A 1QDQA 3OF8A 2DJGB 2HD5A 2XU4A 2DC9A 1CQDA 8PCHA 3USVA 4RY2A 1F2BA 4BS6A 4MZOA 4C5PA 5CVOB 1NB5A 1DF0A 1MHWA 4B55A 5CVNB 2FTDA 4N8WA 2OULA 2G8JA 1YK7A 2NQGA 1W6FA 1NPZA 2G6DA 5FPWA 1QXPA 1GLOA 3CH3X 2F1GA 3B79A 3H89A 4MZSA 2NQDB 1F2CA 3HHAA 4XUIA 3KW9A 4HWYA 3P5WA 4WA6A 4YVAA 2HH5A 2NQIA 4YYQA 1BGOA 2AU1A 4QBBA 1M6DA 3AI8A 1TLOA 1F29A 4AXMA 3K24A 2NQAA 4FJCA 4QRXA 4PP2E 1TU6A 3OISA 3H6SA 3P5VA 4W5CA 2AVWA 4YYUA 1YVBA 3GCBA 2R6NA 1SNKA 5A24A 2VHFA 4OELA 1MEGA 4ZUXU 2BSZA 2YJ2A 2P7UA 1EF7A 2H7JA 1HUCB 2DCCA 1X9YA 4BPVA 4I05A 3NHEA 4QH6A 1PCIA 1U9VA 3IMAA 3C9EA 1ATKA 3V6EA 1AU0A 3F75A 4YV8A 2E00A 4CDDB 3HD3A 3QJ3A 4BGFA 4G54A 3IEJA 1F2AA 2B1NA 4DMYA 2FO5A 2VFCA 4YYSA 2DCAA 2HXZA 4PP1A 4GUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9Q X;  1GMY A;  2IBI A;  3WXG A;  1BQI A;  3N4C A;  3MOR A;  4KLB A;  1KXR A;  1AYV A;  3KWZ A;  3MTN A;  1EWO A;  4CDE B;  3M99 A;  2Y5B A;  3K9M A;  1U9X A;  2E01 A;  4BQV A;  1QMY A;  2E02 A;  1POP A;  2YJC A;  1ZCM A;  2FYE A;  2DZY A;  4P6G A;  2G8E A;  1MEM A;  1AIM A;  2IPP B;  1SP4 B;  1Y4H A;  3KX1 A;  3S3R A;  3DF0 A;  2GHU A;  3H8C A;  4N79 A;  4XR7 A;  9PAP A;  4YYR A;  3E1Z B;  1CVZ A;  3IOQ A;  1CB5 A;  3H7D A;  4DMX A;  4K7C A;  2WBF X;  1Y08 A;  1PPO A;  2G7Y A;  1EWL A;  2ACT A;  5JH3 A;  2DCD A;  7PCK A;  3PNR A;  5JA7 A;  2FUD A;  2ATO A;  3MHS A;  1MS6 A;  1CPJ A;  1ME3 A;  2C0Y A;  1A6R A;  2E03 A;  5PAD A;  4AXL A;  6PAD A;  3PBH A;  4Q8H A;  2DCB A;  3I3T A;  4OEM A;  1MIR A;  1GEC E;  3N3K A;  1CTE A;  4BS5 A;  3KFQ A;  2P0R A;  1YK8 A;  2AYO A;  1THE A;  4X6I A;  2PRE A;  3RVW A;  4CZW A;  2DC7 A;  5EF4 A;  3IV2 A;  2JQG R;  4BSQ A;  1K3B B;  1KHQ A;  2OP3 A;  1PBH A;  1ICF A;  1PPP A;  3BPM A;  2JQF R;  1U5I A;  1PXV A;  1EWM A;  1BP4 A;  3IHP A;  2O6X A;  3HHI A;  1NB3 A;  2FQ9 A;  3BWK A;  5EGW A;  4W5B A;  2PBH A;  4PAD A;  2GFO A;  2FRA A;  3OF9 A;  4FK5 A;  2R9N A;  3WXE A;  1CV8 A;  4FIP A;  4I04 A;  1DEU A;  3LFY A;  1VJV A;  3S3Q A;  3P5U A;  3KKU A;  3OVZ A;  2DC8 A;  3BC3 A;  3RVV A;  2AIM A;  3O0U A;  1ZIV A;  2CIO A;  3D6S A;  2OZ2 A;  2VHS A;  2B1M A;  1PE6 A;  2F7D A;  2AYN A;  1PAD A;  1PPN A;  5CHV A;  2BDL A;  3I06 A;  3PDF A;  2Y6E A;  2PAD A;  3IUT A;  2BDZ A;  2XU1 A;  1AYU A;  3QSD A;  1O0E A;  3K8U A;  3LXS A;  2PNS A;  1KFX L;  4I07 A;  1AEC A;  1AU3 A;  2FRQ A;  4N4Z A;  5CVM A;  3QT4 A;  1CS8 A;  1NL6 A;  3RVX A;  3V6C A;  3PW3 A;  2R9C A;  2XU3 A;  3CBK A;  1IWD A;  1YAL A;  3CH2 X;  3WXF A;  2FT2 A;  1BY8 A;  3ZUA A;  1KHP A;  1AU2 A;  3BOW A;  3F5V A;  4YYW A;  1S4V A;  1CSB B;  2YJ9 A;  3ERV A;  3BPF A;  3TNX A;  4W4U A;  1MDW A;  4QRV A;  3U8E A;  1QOL A;  2DZZ A;  4Q8G A;  5J94 A;  4X6H A;  2R9O A;  4CDF B;  4X6J A;  3BCN A;  1AU4 A;  3KSE A;  2DC6 A;  1GCB A;  1PIP A;  3OVX A;  2DJF B;  1STF E;  2R9F A;  2AS8 A;  3CBJ A;  1NQC A;  1TL9 A;  5CHT A;  1CJL A;  1YT7 A;  2R9M A;  1EWP A;  4YYV A;  4P6E A;  3KWB X;  1U9W A;  1FH0 A;  2HHN A;  1ME4 A;  1NLJ A;  1XKG A;  3H8B A;  1ITO A;  2XU5 A;  2ARY A;  3MHH A;  3HWN A;  4MSX A;  5F02 A;  2AUX A;  3O1G A;  3P5X A;  1AYW A;  1VSN A;  2YJB A;  4QRG A;  4CDC B;  1PPD A;  2P86 A;  2YJ8 A;  1KFU L;  1JQP A;  2CB5 A;  3N3G A;  1Q6K A;  5K16 A;  2AUZ A;  4PI3 A;  1QDQ A;  3OF8 A;  2DJG B;  2HD5 A;  2XU4 A;  2DC9 A;  1CQD A;  8PCH A;  3USV A;  4RY2 A;  1F2B A;  4BS6 A;  4MZO A;  5CVO B;  1NB5 A;  1DF0 A;  1MHW A;  5CVN B;  2FTD A;  4N8W A;  2OUL A;  2G8J A;  1YK7 A;  2NQG A;  1NPZ A;  2G6D A;  5FPW A;  1QXP A;  1GLO A;  3CH3 X;  2F1G A;  3B79 A;  3H89 A;  4MZS A;  2NQD B;  1F2C A;  3HHA A;  4XUI A;  3KW9 A;  4HWY A;  3P5W A;  4WA6 A;  4YVA A;  2HH5 A;  2NQI A;  4YYQ A;  1BGO A;  2AU1 A;  4QBB A;  1M6D A;  3AI8 A;  1TLO A;  1F29 A;  4AXM A;  3K24 A;  2NQA A;  4FJC A;  4QRX A;  4PP2 E;  1TU6 A;  3OIS A;  3H6S A;  3P5V A;  4W5C A;  2AVW A;  4YYU A;  1YVB A;  3GCB A;  2R6N A;  1SNK A;  5A24 A;  2VHF A;  4OEL A;  1MEG A;  4ZUX U;  2YJ2 A;  2P7U A;  1EF7 A;  2H7J A;  1HUC B;  2DCC A;  1X9Y A;  4BPV A;  4I05 A;  3NHE A;  4QH6 A;  1PCI A;  1U9V A;  3IMA A;  3C9E A;  1ATK A;  3V6E A;  1AU0 A;  3F75 A;  4YV8 A;  2E00 A;  4CDD B;  3HD3 A;  3QJ3 A;  4G54 A;  3IEJ A;  1F2A A;  2B1N A;  4DMY A;  2FO5 A;  4YYS A;  2DCA A;  2HXZ A;  4PP1 A; 
#chains in the Genus database with same CATH topology
 1U9Q X;  1GMY A;  2DOS A;  2IBI A;  3WXG A;  4D8B A;  1BQI A;  3N4C A;  3MOR A;  4KLB A;  1KXR A;  1AYV A;  3B21 A;  3KWZ A;  3MTN A;  5EZS A;  1EWO A;  4CDE B;  3M99 A;  2Y5B A;  3K9M A;  1U9X A;  2E01 A;  4BQV A;  1QMY A;  2E02 A;  1POP A;  2YJC A;  1ZCM A;  2FYE A;  2DZY A;  4P6G A;  2G8E A;  1MEM A;  3IFU A;  1AIM A;  2IPP B;  1SP4 B;  1Y4H A;  3KX1 A;  3S3R A;  3DF0 A;  2GHU A;  3H8C A;  4N79 A;  4XR7 A;  4M0W A;  9PAP A;  3TMP A;  3PRP A;  4YYR A;  3E1Z B;  1CVZ A;  3IOQ A;  1CB5 A;  3H7D A;  3O65 A;  4DMX A;  4K7C A;  2WBF X;  4IP3 A;  1Y08 A;  1PPO A;  2G7Y A;  1EWL A;  2ACT A;  5JH3 A;  2DCD A;  5E6J A;  7PCK A;  3PNR A;  5JA7 A;  2FUD A;  3PHU A;  3W31 A;  2ATO A;  3MHS A;  1MS6 A;  1CPJ A;  2AGA A;  1ME3 A;  2C0Y A;  1A6R A;  2E03 A;  5PAD A;  4REZ A;  3PSE A;  4AXL A;  6PAD A;  3PBH A;  4Q8H A;  2DCB A;  3I3T A;  4OEM A;  1MIR A;  1GEC E;  3N3K A;  1CTE A;  4RF1 A;  2BTW B;  4BS5 A;  3KFQ A;  2P0R A;  1YK8 A;  2AYO A;  1THE A;  4X6I A;  2PRE A;  2JRI A;  3RVW A;  4CZW A;  2DC7 A;  4BOP A;  5EF4 A;  3IV2 A;  2JQG R;  4D8I A;  2BTW A;  4BSQ A;  1K3B B;  1KHQ A;  3PHW A;  2OP3 A;  1PBH A;  3PT2 A;  4BOQ A;  1ICF A;  1PPP A;  3BPM A;  2JQF R;  4RNA A;  1U5I A;  1PXV A;  1EWM A;  1BP4 A;  3IHP A;  2O6X A;  4PT5 A;  3HHI A;  1NB3 A;  2FQ9 A;  3BWK A;  5EGW A;  4BOS A;  4W5B A;  2PBH A;  2Z84 A;  4PAD A;  2GFO A;  4P16 A;  2FRA A;  3BBA A;  3OF9 A;  3BB7 A;  4FK5 A;  2J7Q A;  2R9N A;  3WXE A;  1CV8 A;  3E9S A;  4FIP A;  4I04 A;  1DEU A;  3LFY A;  1VJV A;  3S3Q A;  5JZE A;  5EZQ A;  1PVJ A;  3P5U A;  3KKU A;  3OVZ A;  2DC8 A;  3BC3 A;  4WUR A;  3RVV A;  2AIM A;  3O0U A;  1ZIV A;  1UKF A;  2CIO A;  3D6S A;  2OZ2 A;  2VHS A;  2B1M A;  1PE6 A;  2F7D A;  2AYN A;  1PAD A;  1PPN A;  5CHV A;  2BDL A;  3I06 A;  3PDF A;  2Y6E A;  2PAD A;  3IUT A;  2BDZ A;  2XU1 A;  5KO3 A;  1AYU A;  3MTV A;  3QSD A;  1O0E A;  3K8U A;  3LXS A;  2PNS A;  1KFX L;  4I07 A;  1AEC A;  1AU3 A;  2FRQ A;  4N4Z A;  4OVZ B;  5CVM A;  3QT4 A;  1CS8 A;  1NL6 A;  3RVX A;  3V6C A;  3PW3 A;  2R9C A;  2XU3 A;  3C0R A;  3CBK A;  1IWD A;  1YAL A;  2FE8 A;  3CH2 X;  4OVZ A;  3WXF A;  2FT2 A;  1BY8 A;  3ZUA A;  1KHP A;  1AU2 A;  3BOW A;  3F5V A;  4YYW A;  1S4V A;  1CSB B;  2YJ9 A;  3ERV A;  3BY4 A;  3BPF A;  3TNX A;  4W4U A;  4IUM A;  1MDW A;  4QRV A;  4MI7 A;  3U8E A;  1QOL A;  2DZZ A;  4Q8G A;  5J94 A;  4X6H A;  2J7Q C;  2R9O A;  4CDF B;  4X6J A;  3BCN A;  1AU4 A;  3KSE A;  2DC6 A;  1GCB A;  1PIP A;  3OVX A;  2DJF B;  1STF E;  2R9F A;  2AS8 A;  4A5U A;  3CBJ A;  1NQC A;  4HXD B;  1TL9 A;  5CHT A;  1CJL A;  4GUA A;  1YT7 A;  2R9M A;  1EWP A;  4YYV A;  4ZTB A;  4P6E A;  1YZB A;  3KWB X;  1U9W A;  1FH0 A;  2HHN A;  1ME4 A;  1NLJ A;  1XKG A;  3H8B A;  1ITO A;  2XU5 A;  3MJ5 A;  2ARY A;  3MHH A;  3HWN A;  4MSX A;  4R3D A;  5F02 A;  2AUX A;  3O1G A;  3P5X A;  1AYW A;  1VSN A;  2YJB A;  4QRG A;  2BU3 A;  4CDC B;  1PPD A;  2P86 A;  2YJ8 A;  1KFU L;  1JQP A;  2CB5 A;  3N3G A;  4BOU A;  1DKI A;  4XZX A;  1Q6K A;  4BOZ A;  5K16 A;  4MM3 B;  4D8E A;  2AUZ A;  4PI3 A;  1QDQ A;  3OF8 A;  2DJG B;  2HD5 A;  2XU4 A;  2DC9 A;  1CQD A;  8PCH A;  3USV A;  4RY2 A;  1F2B A;  4BS6 A;  4MZO A;  5CVO B;  1NB5 A;  1DF0 A;  1MHW A;  5CVN B;  2FTD A;  4N8W A;  2OUL A;  2G8J A;  3W30 A;  1YK7 A;  2NQG A;  1NPZ A;  2G6D A;  5FPW A;  1QXP A;  1GLO A;  3CH3 X;  3PHX A;  2F1G A;  3B79 A;  3H89 A;  4MZS A;  2NQD B;  1F2C A;  3OQC A;  3ZNH A;  3HHA A;  4XUI A;  4RF0 A;  3KW9 A;  2HWK A;  4HWY A;  3P5W A;  4WA6 A;  4YVA A;  2HH5 A;  2NQI A;  4YYQ A;  1BGO A;  2UZJ A;  2AU1 A;  4QBB A;  1M6D A;  3AI8 A;  1TLO A;  1F29 A;  4AXM A;  3K24 A;  2NQA A;  4FJC A;  4QRX A;  4PP2 E;  1TU6 A;  3OIS A;  3H6S A;  3P5V A;  4W5C A;  2AVW A;  3TRK A;  4YYU A;  1YVB A;  3GCB A;  2R6N A;  1SNK A;  5A24 A;  2VHF A;  4OEL A;  1MEG A;  4ZUX U;  2YJ2 A;  2P7U A;  1EF7 A;  2H7J A;  1HUC B;  2DCC A;  1X9Y A;  4BPV A;  4I05 A;  3NHE A;  2JTC A;  4QH6 A;  1PCI A;  1U9V A;  3IMA A;  3C9E A;  1ATK A;  3V6E A;  1AU0 A;  3F75 A;  4YV8 A;  2E00 A;  4CDD B;  3HD3 A;  3PRM A;  3QJ3 A;  4G54 A;  4RKX A;  3IEJ A;  1F2A A;  3MP2 A;  3RNV A;  2B1N A;  4DMY A;  4OW0 A;  2FO5 A;  4YYS A;  2DCA A;  2HXZ A;  4PP1 A; 
#chains in the Genus database with same CATH homology
 1U9Q X;  1GMY A;  2IBI A;  3WXG A;  1BQI A;  3N4C A;  3MOR A;  4KLB A;  1KXR A;  1AYV A;  3KWZ A;  3MTN A;  1EWO A;  4CDE B;  3M99 A;  2Y5B A;  3K9M A;  1U9X A;  2E01 A;  4BQV A;  1QMY A;  2E02 A;  1POP A;  2YJC A;  1ZCM A;  2VFB A;  2FYE A;  2DZY A;  4P6G A;  2G8E A;  1MEM A;  1AIM A;  2IPP B;  1SP4 B;  1Y4H A;  3KX1 A;  4NV8 A;  3DF0 A;  2GHU A;  3S3R A;  3H8C A;  4N79 A;  4XR7 A;  9PAP A;  4YYR A;  3E1Z B;  1GX3 A;  1CVZ A;  3IOQ A;  1CB5 A;  3H7D A;  4DMX A;  4K7C A;  2WBF X;  1Y08 A;  1PPO A;  2G7Y A;  1EWL A;  2ACT A;  5JH3 A;  2DCD A;  7PCK A;  3PNR A;  5JA7 A;  2FUD A;  2ATO A;  3MHS A;  1MS6 A;  1CPJ A;  1ME3 A;  2C0Y A;  1A6R A;  2E03 A;  5PAD A;  4AXL A;  6PAD A;  3PBH A;  4Q8H A;  2DCB A;  3I3T A;  4OEM A;  1MIR A;  1GEC E;  3N3K A;  1CTE A;  4NV7 A;  4BS5 A;  3KFQ A;  2P0R A;  1YK8 A;  2AYO A;  1THE A;  4X6I A;  2PRE A;  3RVW A;  4CZW A;  2DC7 A;  5EF4 A;  3IV2 A;  2JQG R;  4BSQ A;  1K3B B;  1KHQ A;  2OP3 A;  1PBH A;  1ICF A;  1PPP A;  3BPM A;  2JQF R;  1U5I A;  1PXV A;  1EWM A;  1BP4 A;  3IHP A;  2O6X A;  3HHI A;  1NB3 A;  2FQ9 A;  3BWK A;  5EGW A;  4W5B A;  2PBH A;  4PAD A;  2GFO A;  2FRA A;  3OF9 A;  4FK5 A;  2R9N A;  3WXE A;  1CV8 A;  4FIP A;  4I04 A;  1DEU A;  3LFY A;  1VJV A;  3S3Q A;  3P5U A;  3KKU A;  3OVZ A;  2DC8 A;  3BC3 A;  3RVV A;  2AIM A;  3O0U A;  1ZIV A;  2CIO A;  3D6S A;  2OZ2 A;  2VHS A;  2B1M A;  1PE6 A;  2F7D A;  2AYN A;  1PAD A;  1PPN A;  5CHV A;  2BDL A;  3I06 A;  3PDF A;  2Y6E A;  2PAD A;  3IUT A;  2BDZ A;  2XU1 A;  1AYU A;  3QSD A;  1O0E A;  3K8U A;  3LXS A;  2PNS A;  1KFX L;  4I07 A;  1AEC A;  1AU3 A;  2FRQ A;  4N4Z A;  5CVM A;  3QT4 A;  1CS8 A;  1NL6 A;  3RVX A;  3LTW A;  3V6C A;  3PW3 A;  2R9C A;  2XU3 A;  3CBK A;  1IWD A;  1YAL A;  3CH2 X;  1W5R A;  3WXF A;  2FT2 A;  1BY8 A;  3ZUA A;  1KHP A;  1AU2 A;  3BOW A;  3F5V A;  4YYW A;  1S4V A;  1CSB B;  2YJ9 A;  3ERV A;  3BPF A;  3TNX A;  4W4U A;  1MDW A;  4QRV A;  3U8E A;  1QOL A;  2DZZ A;  4Q8G A;  1E2T A;  5J94 A;  4X6H A;  2R9O A;  4CDF B;  4X6J A;  3BCN A;  1AU4 A;  3D9W A;  3KSE A;  2DC6 A;  1GCB A;  1PIP A;  3OVX A;  2DJF B;  1STF E;  2R9F A;  2AS8 A;  3CBJ A;  1NQC A;  1TL9 A;  5CHT A;  1CJL A;  1YT7 A;  2R9M A;  1EWP A;  4YYV A;  4P6E A;  3KWB X;  1U9W A;  1FH0 A;  2HHN A;  1ME4 A;  1NLJ A;  1XKG A;  3H8B A;  1ITO A;  2XU5 A;  2ARY A;  3MHH A;  3HWN A;  4MSX A;  5F02 A;  2AUX A;  3O1G A;  3P5X A;  1AYW A;  1VSN A;  2YJB A;  4QRG A;  4CDC B;  1PPD A;  2P86 A;  2YJ8 A;  1KFU L;  1JQP A;  2CB5 A;  3N3G A;  1W4T A;  1Q6K A;  5K16 A;  2AUZ A;  4PI3 A;  1QDQ A;  3OF8 A;  2DJG B;  2HD5 A;  2XU4 A;  2DC9 A;  1CQD A;  8PCH A;  3USV A;  4RY2 A;  1F2B A;  4BS6 A;  4MZO A;  4C5P A;  5CVO B;  1NB5 A;  1DF0 A;  1MHW A;  4B55 A;  5CVN B;  2FTD A;  4N8W A;  2OUL A;  2G8J A;  1YK7 A;  2NQG A;  1W6F A;  1NPZ A;  2G6D A;  5FPW A;  1QXP A;  1GLO A;  3CH3 X;  2F1G A;  3B79 A;  3H89 A;  4MZS A;  2NQD B;  1F2C A;  3HHA A;  4XUI A;  3KW9 A;  4HWY A;  3P5W A;  4WA6 A;  4YVA A;  2HH5 A;  2NQI A;  4YYQ A;  1BGO A;  2AU1 A;  4QBB A;  1M6D A;  3AI8 A;  1TLO A;  1F29 A;  4AXM A;  3K24 A;  2NQA A;  4FJC A;  4QRX A;  4PP2 E;  1TU6 A;  3OIS A;  3H6S A;  3P5V A;  4W5C A;  2AVW A;  4YYU A;  1YVB A;  3GCB A;  2R6N A;  1SNK A;  5A24 A;  2VHF A;  4OEL A;  1MEG A;  4ZUX U;  2BSZ A;  2YJ2 A;  2P7U A;  1EF7 A;  2H7J A;  1HUC B;  2DCC A;  1X9Y A;  4BPV A;  4I05 A;  3NHE A;  4QH6 A;  1PCI A;  1U9V A;  3IMA A;  3C9E A;  1ATK A;  3V6E A;  1AU0 A;  3F75 A;  4YV8 A;  2E00 A;  4CDD B;  3HD3 A;  3QJ3 A;  4BGF A;  4G54 A;  3IEJ A;  1F2A A;  2B1N A;  4DMY A;  2FO5 A;  2VFC A;  4YYS A;  2DCA A;  2HXZ A;  4PP1 A;  4GUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...