2DC9A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca074me complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
total genus 78
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc9A00
4BPVA 3H89A 4YV8A 1CV8A 4CDEB 2BDZA 1MDWA 2JQFR 2JQGR 4FIPA 1FH0A 2VHSA 5CHTA 4FJCA 7PCKA 1KHPA 8PCHA 3MHHA 1CTEA 3C9EA 2F7DA 3LFYA 3TNXA 3K24A 2AUXA 4P6GA 4I04A 5K16A 1KFUL 3USVA 4QBBA 4MZOA 1KXRA 2AYNA 2YJ2A 4AXLA 4P6EA 4YYQA 1PPDA 1PPNA 3O0UA 2XU1A 2DC8A 1BGOA 1MIRA 3N4CA 3HWNA 4N4ZA 2E00A 1SNKA 2YJBA 3CBJA 1TU6A 3WXGA 1THEA 3K8UA 2OZ2A 2P0RA 4QRXA 3DF0A 3H8CA 1AYVA 1U9VA 2HH5A 2FRAA 1U9QX 3PBHA 1ME4A 4MSXA 4CZWA 2DZYA 1ZIVA 3WXFA 1U9XA 2FO5A 1GMYA 9PAPA 3HHAA 2GHUA 2XU3A 2BDLA 4N79A 4QRVA 4OEMA 5F02A 3LXSA 3H7DA 4YYRA 3IMAA 3OF9A 3H8BA 1EWOA 3D6SA 1TL9A 2FT2A 3IHPA 3I3TA 1KFXL 2G6DA 4I07A 4PI3A 4QRGA 1F29A 4KLBA 4BS6A 3N3GA 3P5XA 3PDFA 1PADA 2ARYA 1CVZA 5FPWA 4HWYA 2HXZA 3IOQA 2AU1A 4XR7A 1YK8A 2AS8A 2ACTA 3BPMA 4X6HA 1VSNA 5EF4A 1SP4B 3HHIA 2CIOA 1BQIA 2AVWA 3QSDA 2P86A 4BS5A 4YVAA 2R9OA 3RVXA 1ICFA 3KFQA 2AUZA 1GECE 1QOLA 1QDQA 2C0YA 4DMYA 3H6SA 3GCBA 1GLOA 1S4VA 3HD3A 2E03A 4MZSA 4PP2E 1VJVA 2Y5BA 1YT7A 2DCBA 1CSBB 2G8EA 2OULA 3PNRA 1PBHA 1PXVA 3IEJA 2B1NA 5JA7A 3OVXA 3K9MA 1K3BB 3P5WA 2DJGB 4BSQA 4CDFB 1DF0A 4PADA 1STFE 5CVMA 3AI8A 1AYUA 1NQCA 1ZCMA 1NPZA 3O1GA 1EWMA 2XU5A 1MS6A 5CVNB 1JQPA 1EWLA 2YJ9A 2PNSA 1QXPA 1O0EA 2E02A 3CH3X 2DC7A 2DCDA 3IV2A 1Y08A 2B1MA 3MTNA 2E01A 1F2CA 3QT4A 3S3QA 4FK5A 3E1ZB 1NL6A 1U5IA 3RVVA 1EWPA 1AECA 3F75A 4YYVA 1CS8A 2R6NA 1AU4A 4BQVA 3BWKA 3F5VA 3KX1A 3RVWA 3BPFA 2NQDB 1PCIA 4W5BA 3S3RA 2AYOA 3OVZA 3ZUAA 1NLJA 1EF7A 3V6EA 4CDCB 2OP3A 3KWZA 1X9YA 2NQIA 2R9FA 3BCNA 4WA6A 3M99A 1TLOA 3QJ3A 4G54A 2FUDA 4Q8HA 3U8EA 1HUCB 4YYWA 3V6CA 1QMYA 2PREA 5PADA 4K7CA 4N8WA 2VHFA 1BP4A 4AXMA 1Q6KA 2YJCA 1KHQA 2P7UA 2NQGA 3IUTA 2DC9A 3OISA 2Y6EA 1AU0A 2O6XA 2R9CA 2DZZA 4DMXA 2F1GA 2FQ9A 2PADA 4X6JA 1Y4HA 3WXEA 4I05A 1DEUA 4PP1A 3KWBX 1YALA 3CH2X 1BY8A 1PE6A 1NB3A 1AYWA 4QH6A 4RY2A 2FRQA 1YK7A 2R9NA 2PBHA 1MHWA 2G8JA 1NB5A 3B79A 1PIPA 2AIMA 1CJLA 1AIMA 1CPJA 2FTDA 4W4UA 3CBKA 3PW3A 2IPPB 3N3KA 4XUIA 2WBFX 4YYUA 1AU3A 2HHNA 5EGWA 1YVBA 2NQAA 2DJFB 2ATOA 2H7JA 3MORA 5CHVA 3KW9A 2DCAA 4OELA 3MHSA 5J94A 4YYSA 1U9WA 3BC3A 6PADA 1PPOA 2FYEA 1POPA 1GCBA 5A24A 1PPPA 3P5UA 4X6IA 3KSEA 1F2AA 1XKGA 4CDDB 1M6DA 2HD5A 2CB5A 2XU4A 4Q8GA 2GFOA 1CB5A 1A6RA 5CVOB 4W5CA 4ZUXU 3P5VA 2DCCA 1AU2A 2G7YA 1MEGA 1MEMA 2YJ8A 1ITOA 2DC6A 3I06A 2IBIA 3OF8A 1CQDA 5JH3A 1ME3A 3NHEA 1F2BA 3KKUA 2R9MA 1ATKA 3ERVA 3BOWA 1IWDA
chains in the Genus database with same CATH superfamily
4BPVA 3H89A 3BY4A 4YV8A 1CV8A 4CDEB 2BDZA 1MDWA 2JQFR 2JQGR 4FIPA 1FH0A 2VHSA 5CHTA 4FJCA 7PCKA 4MM3B 1KHPA 8PCHA 2BTWA 3MHHA 1CTEA 3C9EA 2F7DA 3LFYA 4IP3A 3TNXA 3K24A 2AUXA 3PRPA 4P6GA 3PRMA 4I04A 4ZTBA 5K16A 1KFUL 3USVA 4QBBA 2FE8A 3PT2A 4MZOA 1KXRA 2AYNA 4GUAA 2YJ2A 4AXLA 4P6EA 4YYQA 3PHUA 1PPDA 1PPNA 3O0UA 5EZQA 2XU1A 2DC8A 1BGOA 1MIRA 3N4CA 3MJ5A 3HWNA 4N4ZA 2E00A 1SNKA 4HXDB 2YJBA 3CBJA 4PT5A 1TU6A 3WXGA 2BU3A 1THEA 3K8UA 2OZ2A 2P0RA 4M0WA 4QRXA 3BB7A 3DF0A 3H8CA 1AYVA 1U9VA 2HH5A 2FRAA 1U9QX 3PBHA 1ME4A 4MSXA 4CZWA 2DZYA 1ZIVA 3WXFA 1U9XA 2FO5A 1GMYA 9PAPA 3HHAA 2GHUA 2XU3A 2BDLA 4N79A 4QRVA 5JZEA 4OEMA 5F02A 4MI7A 3LXSA 3H7DA 4YYRA 3IMAA 3OF9A 3H8BA 1EWOA 3D6SA 1TL9A 2FT2A 3IHPA 3I3TA 1KFXL 2G6DA 1YZBA 4I07A 4PI3A 4QRGA 3W31A 1F29A 4KLBA 4BS6A 3N3GA 3P5XA 3PDFA 1PADA 2ARYA 1CVZA 5FPWA 4HWYA 2HXZA 3IOQA 2AU1A 4XR7A 1YK8A 2AS8A 2ACTA 3BPMA 4X6HA 3IFUA 1VSNA 5EF4A 1SP4B 3HHIA 2CIOA 1BQIA 2AVWA 3QSDA 2P86A 4R3DA 4BS5A 4YVAA 4RF1A 2R9OA 3RVXA 1ICFA 3KFQA 2AUZA 1UKFA 1GECE 1QOLA 1QDQA 2C0YA 4DMYA 3H6SA 3GCBA 1GLOA 1S4VA 3HD3A 3C0RA 2E03A 4MZSA 4PP2E 1VJVA 2Y5BA 1YT7A 2DCBA 2BTWB 1CSBB 2G8EA 2UZJA 2DOSA 2OULA 3PNRA 1PBHA 1PXVA 3IEJA 2B1NA 5JA7A 3OVXA 4BOZA 3K9MA 3OQCA 1DKIA 1K3BB 3P5WA 2DJGB 4BSQA 4CDFB 1DF0A 4PADA 1STFE 5CVMA 3AI8A 4D8EA 1AYUA 1NQCA 1ZCMA 3TMPA 2JTCA 1NPZA 3O1GA 1EWMA 2XU5A 1MS6A 5CVNB 1JQPA 3MP2A 1EWLA 4P16A 3PHWA 2YJ9A 2PNSA 1QXPA 1O0EA 5EZSA 3PSEA 2E02A 3CH3X 3W30A 2DC7A 2DCDA 3IV2A 3RNVA 1Y08A 2B1MA 3MTNA 2E01A 1F2CA 3QT4A 3S3QA 4FK5A 3E1ZB 3ZNHA 1NL6A 2J7QC 1U5IA 4RKXA 3MTVA 3RVVA 1EWPA 1AECA 4OVZA 3F75A 2AGAA 3BBAA 4YYVA 1CS8A 2R6NA 4OW0A 1AU4A 4BQVA 3BWKA 3F5VA 3KX1A 3RVWA 4OVZB 3BPFA 2NQDB 1PCIA 4BOSA 4W5BA 3S3RA 2AYOA 4A5UA 3OVZA 3ZUAA 1NLJA 1EF7A 3V6EA 4CDCB 2OP3A 3TRKA 3KWZA 1X9YA 2NQIA 2R9FA 2JRIA 3BCNA 4WA6A 3M99A 1TLOA 1PVJA 3QJ3A 4G54A 2FUDA 4Q8HA 3U8EA 1HUCB 4YYWA 4REZA 3V6CA 3B21A 1QMYA 2PREA 5PADA 4K7CA 4N8WA 2VHFA 1BP4A 4AXMA 1Q6KA 2YJCA 1KHQA 2P7UA 4D8BA 2NQGA 3IUTA 2DC9A 3O65A 5KO3A 3OISA 2Y6EA 1AU0A 2O6XA 3E9SA 2R9CA 2DZZA 4DMXA 2F1GA 2FQ9A 2PADA 2J7QA 4X6JA 1Y4HA 3WXEA 4I05A 1DEUA 4BOUA 4D8IA 4PP1A 3KWBX 1YALA 3CH2X 1BY8A 1PE6A 1NB3A 1AYWA 4QH6A 4RY2A 4XZXA 2FRQA 4IUMA 1YK7A 2R9NA 2PBHA 1MHWA 2G8JA 1NB5A 3B79A 1PIPA 2AIMA 1CJLA 1AIMA 1CPJA 2FTDA 4W4UA 3CBKA 2HWKA 3PW3A 4BOPA 2IPPB 3N3KA 4XUIA 2WBFX 4YYUA 5E6JA 1AU3A 2HHNA 5EGWA 1YVBA 2NQAA 2DJFB 2ATOA 2H7JA 3MORA 5CHVA 3KW9A 2DCAA 4OELA 3MHSA 4BOQA 3PHXA 5J94A 4YYSA 1U9WA 3BC3A 6PADA 1PPOA 2FYEA 1POPA 1GCBA 5A24A 1PPPA 3P5UA 4X6IA 3KSEA 1F2AA 1XKGA 4WURA 4CDDB 1M6DA 2HD5A 2CB5A 2XU4A 4Q8GA 2GFOA 1CB5A 1A6RA 5CVOB 4W5CA 4ZUXU 3P5VA 2DCCA 2Z84A 1AU2A 2G7YA 1MEGA 1MEMA 2YJ8A 4RF0A 1ITOA 2DC6A 3I06A 2IBIA 3OF8A 1CQDA 5JH3A 1ME3A 3NHEA 1F2BA 3KKUA 2R9MA 4RNAA 1ATKA 3ERVA 3BOWA 1IWDA
chains in the Genus database with same CATH topology
4BPVA 3H89A 4YV8A 1CV8A 4CDEB 2BDZA 1MDWA 2JQFR 2JQGR 4FIPA 1FH0A 2VHSA 5CHTA 4FJCA 7PCKA 1KHPA 8PCHA 3MHHA 1CTEA 3C9EA 2F7DA 3LFYA 3TNXA 3K24A 2AUXA 4P6GA 4I04A 5K16A 1KFUL 3USVA 4QBBA 4MZOA 1KXRA 2AYNA 2YJ2A 4AXLA 4GUZA 4P6EA 4YYQA 2BSZA 1PPDA 1PPNA 3O0UA 2XU1A 2DC8A 1BGOA 1MIRA 3N4CA 3HWNA 4N4ZA 2E00A 1SNKA 2YJBA 3CBJA 1TU6A 3WXGA 1THEA 3K8UA 2OZ2A 2P0RA 4QRXA 3DF0A 3H8CA 1AYVA 1U9VA 2HH5A 2FRAA 1U9QX 3PBHA 1ME4A 4MSXA 4CZWA 2DZYA 1ZIVA 3WXFA 1U9XA 2FO5A 1GMYA 9PAPA 3HHAA 2GHUA 2XU3A 2BDLA 4N79A 4QRVA 4OEMA 5F02A 3LXSA 3H7DA 4YYRA 3IMAA 3OF9A 3H8BA 1EWOA 3D6SA 1TL9A 2FT2A 4NV7A 3IHPA 3I3TA 1KFXL 2G6DA 4I07A 4PI3A 4QRGA 1F29A 4KLBA 4BS6A 3N3GA 3P5XA 3PDFA 1PADA 2ARYA 1W5RA 1CVZA 5FPWA 4HWYA 1W4TA 2HXZA 3IOQA 2AU1A 4XR7A 1YK8A 2AS8A 2ACTA 3BPMA 4X6HA 1VSNA 5EF4A 1SP4B 3HHIA 2CIOA 1BQIA 1W6FA 2AVWA 3QSDA 2P86A 4BS5A 4YVAA 2R9OA 3RVXA 1ICFA 3KFQA 2AUZA 1GECE 4C5PA 1QOLA 1QDQA 2C0YA 2VFCA 4DMYA 3H6SA 3GCBA 1GLOA 1S4VA 3HD3A 2E03A 4MZSA 4PP2E 1VJVA 2Y5BA 1YT7A 2DCBA 1CSBB 2G8EA 2OULA 3PNRA 1PBHA 4B55A 1PXVA 3IEJA 2B1NA 5JA7A 3OVXA 3K9MA 1E2TA 1K3BB 3P5WA 2DJGB 4BSQA 4CDFB 1DF0A 4PADA 1STFE 5CVMA 3AI8A 1AYUA 1NQCA 1ZCMA 1NPZA 3O1GA 1EWMA 2XU5A 1MS6A 5CVNB 1JQPA 2VFBA 1EWLA 2YJ9A 2PNSA 1QXPA 1O0EA 2E02A 3CH3X 2DC7A 2DCDA 3IV2A 1Y08A 2B1MA 3MTNA 1GX3A 2E01A 1F2CA 3QT4A 3S3QA 4FK5A 3E1ZB 1NL6A 1U5IA 3RVVA 1EWPA 1AECA 3F75A 4YYVA 1CS8A 2R6NA 1AU4A 4BQVA 3BWKA 3F5VA 3KX1A 3RVWA 3BPFA 2NQDB 1PCIA 4W5BA 3S3RA 2AYOA 3OVZA 3ZUAA 1NLJA 1EF7A 3V6EA 4CDCB 2OP3A 3KWZA 1X9YA 2NQIA 2R9FA 3BCNA 4WA6A 3M99A 1TLOA 3QJ3A 4G54A 2FUDA 4Q8HA 3D9WA 3U8EA 1HUCB 4YYWA 3V6CA 1QMYA 2PREA 5PADA 4K7CA 4N8WA 2VHFA 1BP4A 4AXMA 1Q6KA 2YJCA 1KHQA 2P7UA 2NQGA 3IUTA 2DC9A 3LTWA 3OISA 2Y6EA 1AU0A 2O6XA 2R9CA 2DZZA 4DMXA 2F1GA 2FQ9A 2PADA 4X6JA 1Y4HA 3WXEA 4I05A 1DEUA 4PP1A 3KWBX 1YALA 3CH2X 1BY8A 1PE6A 1NB3A 1AYWA 4QH6A 4RY2A 2FRQA 1YK7A 2R9NA 2PBHA 1MHWA 2G8JA 1NB5A 3B79A 1PIPA 2AIMA 1CJLA 1AIMA 4NV8A 1CPJA 2FTDA 4W4UA 3CBKA 3PW3A 2IPPB 3N3KA 4XUIA 2WBFX 4YYUA 1AU3A 2HHNA 5EGWA 4BGFA 1YVBA 2NQAA 2DJFB 2ATOA 2H7JA 3MORA 5CHVA 3KW9A 2DCAA 4OELA 3MHSA 5J94A 4YYSA 1U9WA 3BC3A 6PADA 1PPOA 2FYEA 1POPA 1GCBA 5A24A 1PPPA 3P5UA 4X6IA 3KSEA 1F2AA 1XKGA 4CDDB 1M6DA 2HD5A 2CB5A 2XU4A 4Q8GA 2GFOA 1CB5A 1A6RA 5CVOB 4W5CA 4ZUXU 3P5VA 2DCCA 1AU2A 2G7YA 1MEGA 1MEMA 2YJ8A 1ITOA 2DC6A 3I06A 2IBIA 3OF8A 1CQDA 5JH3A 1ME3A 3NHEA 1F2BA 3KKUA 2R9MA 1ATKA 3ERVA 3BOWA 1IWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPV A;  3H89 A;  4YV8 A;  1CV8 A;  4CDE B;  2BDZ A;  1MDW A;  2JQF R;  2JQG R;  4FIP A;  1FH0 A;  2VHS A;  5CHT A;  4FJC A;  7PCK A;  1KHP A;  8PCH A;  3MHH A;  1CTE A;  3C9E A;  2F7D A;  3LFY A;  3TNX A;  3K24 A;  2AUX A;  4P6G A;  4I04 A;  5K16 A;  1KFU L;  3USV A;  4QBB A;  4MZO A;  1KXR A;  2AYN A;  2YJ2 A;  4AXL A;  4P6E A;  4YYQ A;  1PPD A;  1PPN A;  3O0U A;  2XU1 A;  2DC8 A;  1BGO A;  1MIR A;  3N4C A;  3HWN A;  4N4Z A;  2E00 A;  1SNK A;  2YJB A;  3CBJ A;  1TU6 A;  3WXG A;  1THE A;  3K8U A;  2OZ2 A;  2P0R A;  4QRX A;  3DF0 A;  3H8C A;  1AYV A;  1U9V A;  2HH5 A;  2FRA A;  1U9Q X;  3PBH A;  1ME4 A;  4MSX A;  4CZW A;  2DZY A;  1ZIV A;  3WXF A;  1U9X A;  2FO5 A;  1GMY A;  9PAP A;  3HHA A;  2GHU A;  2XU3 A;  2BDL A;  4N79 A;  4QRV A;  4OEM A;  5F02 A;  3LXS A;  3H7D A;  4YYR A;  3IMA A;  3OF9 A;  3H8B A;  1EWO A;  3D6S A;  1TL9 A;  2FT2 A;  3IHP A;  3I3T A;  1KFX L;  2G6D A;  4I07 A;  4PI3 A;  4QRG A;  1F29 A;  4KLB A;  4BS6 A;  3N3G A;  3P5X A;  3PDF A;  1PAD A;  2ARY A;  1CVZ A;  5FPW A;  4HWY A;  2HXZ A;  3IOQ A;  2AU1 A;  4XR7 A;  1YK8 A;  2AS8 A;  2ACT A;  3BPM A;  4X6H A;  1VSN A;  5EF4 A;  1SP4 B;  3HHI A;  2CIO A;  1BQI A;  2AVW A;  3QSD A;  2P86 A;  4BS5 A;  4YVA A;  2R9O A;  3RVX A;  1ICF A;  3KFQ A;  2AUZ A;  1GEC E;  1QOL A;  1QDQ A;  2C0Y A;  4DMY A;  3H6S A;  3GCB A;  1GLO A;  1S4V A;  3HD3 A;  2E03 A;  4MZS A;  4PP2 E;  1VJV A;  2Y5B A;  1YT7 A;  2DCB A;  1CSB B;  2G8E A;  2OUL A;  3PNR A;  1PBH A;  1PXV A;  3IEJ A;  2B1N A;  5JA7 A;  3OVX A;  3K9M A;  1K3B B;  3P5W A;  2DJG B;  4BSQ A;  4CDF B;  1DF0 A;  4PAD A;  1STF E;  5CVM A;  3AI8 A;  1AYU A;  1NQC A;  1ZCM A;  1NPZ A;  3O1G A;  1EWM A;  2XU5 A;  1MS6 A;  5CVN B;  1JQP A;  1EWL A;  2YJ9 A;  2PNS A;  1QXP A;  1O0E A;  2E02 A;  3CH3 X;  2DC7 A;  2DCD A;  3IV2 A;  1Y08 A;  2B1M A;  3MTN A;  2E01 A;  1F2C A;  3QT4 A;  3S3Q A;  4FK5 A;  3E1Z B;  1NL6 A;  1U5I A;  3RVV A;  1EWP A;  1AEC A;  3F75 A;  4YYV A;  1CS8 A;  2R6N A;  1AU4 A;  4BQV A;  3BWK A;  3F5V A;  3KX1 A;  3RVW A;  3BPF A;  2NQD B;  1PCI A;  4W5B A;  3S3R A;  2AYO A;  3OVZ A;  3ZUA A;  1NLJ A;  1EF7 A;  3V6E A;  4CDC B;  2OP3 A;  3KWZ A;  1X9Y A;  2NQI A;  2R9F A;  3BCN A;  4WA6 A;  3M99 A;  1TLO A;  3QJ3 A;  4G54 A;  2FUD A;  4Q8H A;  3U8E A;  1HUC B;  4YYW A;  3V6C A;  1QMY A;  2PRE A;  5PAD A;  4K7C A;  4N8W A;  2VHF A;  1BP4 A;  4AXM A;  1Q6K A;  2YJC A;  1KHQ A;  2P7U A;  2NQG A;  3IUT A;  2DC9 A;  3OIS A;  2Y6E A;  1AU0 A;  2O6X A;  2R9C A;  2DZZ A;  4DMX A;  2F1G A;  2FQ9 A;  2PAD A;  4X6J A;  1Y4H A;  3WXE A;  4I05 A;  1DEU A;  4PP1 A;  3KWB X;  1YAL A;  3CH2 X;  1BY8 A;  1PE6 A;  1NB3 A;  1AYW A;  4QH6 A;  4RY2 A;  2FRQ A;  1YK7 A;  2R9N A;  2PBH A;  1MHW A;  2G8J A;  1NB5 A;  3B79 A;  1PIP A;  2AIM A;  1CJL A;  1AIM A;  1CPJ A;  2FTD A;  4W4U A;  3CBK A;  3PW3 A;  2IPP B;  3N3K A;  4XUI A;  2WBF X;  4YYU A;  1AU3 A;  2HHN A;  5EGW A;  1YVB A;  2NQA A;  2DJF B;  2ATO A;  2H7J A;  3MOR A;  5CHV A;  3KW9 A;  2DCA A;  4OEL A;  3MHS A;  5J94 A;  4YYS A;  1U9W A;  3BC3 A;  6PAD A;  1PPO A;  2FYE A;  1POP A;  1GCB A;  5A24 A;  1PPP A;  3P5U A;  4X6I A;  3KSE A;  1F2A A;  1XKG A;  4CDD B;  1M6D A;  2HD5 A;  2CB5 A;  2XU4 A;  4Q8G A;  2GFO A;  1CB5 A;  1A6R A;  5CVO B;  4W5C A;  4ZUX U;  3P5V A;  2DCC A;  1AU2 A;  2G7Y A;  1MEG A;  1MEM A;  2YJ8 A;  1ITO A;  2DC6 A;  3I06 A;  2IBI A;  3OF8 A;  1CQD A;  5JH3 A;  1ME3 A;  3NHE A;  1F2B A;  3KKU A;  2R9M A;  1ATK A;  3ERV A;  3BOW A;  1IWD A; 
#chains in the Genus database with same CATH topology
 4BPV A;  3H89 A;  3BY4 A;  4YV8 A;  1CV8 A;  4CDE B;  2BDZ A;  1MDW A;  2JQF R;  2JQG R;  4FIP A;  1FH0 A;  2VHS A;  5CHT A;  4FJC A;  7PCK A;  4MM3 B;  1KHP A;  8PCH A;  2BTW A;  3MHH A;  1CTE A;  3C9E A;  2F7D A;  3LFY A;  4IP3 A;  3TNX A;  3K24 A;  2AUX A;  3PRP A;  4P6G A;  3PRM A;  4I04 A;  4ZTB A;  5K16 A;  1KFU L;  3USV A;  4QBB A;  2FE8 A;  3PT2 A;  4MZO A;  1KXR A;  2AYN A;  4GUA A;  2YJ2 A;  4AXL A;  4P6E A;  4YYQ A;  3PHU A;  1PPD A;  1PPN A;  3O0U A;  5EZQ A;  2XU1 A;  2DC8 A;  1BGO A;  1MIR A;  3N4C A;  3MJ5 A;  3HWN A;  4N4Z A;  2E00 A;  1SNK A;  4HXD B;  2YJB A;  3CBJ A;  4PT5 A;  1TU6 A;  3WXG A;  2BU3 A;  1THE A;  3K8U A;  2OZ2 A;  2P0R A;  4M0W A;  4QRX A;  3BB7 A;  3DF0 A;  3H8C A;  1AYV A;  1U9V A;  2HH5 A;  2FRA A;  1U9Q X;  3PBH A;  1ME4 A;  4MSX A;  4CZW A;  2DZY A;  1ZIV A;  3WXF A;  1U9X A;  2FO5 A;  1GMY A;  9PAP A;  3HHA A;  2GHU A;  2XU3 A;  2BDL A;  4N79 A;  4QRV A;  5JZE A;  4OEM A;  5F02 A;  4MI7 A;  3LXS A;  3H7D A;  4YYR A;  3IMA A;  3OF9 A;  3H8B A;  1EWO A;  3D6S A;  1TL9 A;  2FT2 A;  3IHP A;  3I3T A;  1KFX L;  2G6D A;  1YZB A;  4I07 A;  4PI3 A;  4QRG A;  3W31 A;  1F29 A;  4KLB A;  4BS6 A;  3N3G A;  3P5X A;  3PDF A;  1PAD A;  2ARY A;  1CVZ A;  5FPW A;  4HWY A;  2HXZ A;  3IOQ A;  2AU1 A;  4XR7 A;  1YK8 A;  2AS8 A;  2ACT A;  3BPM A;  4X6H A;  3IFU A;  1VSN A;  5EF4 A;  1SP4 B;  3HHI A;  2CIO A;  1BQI A;  2AVW A;  3QSD A;  2P86 A;  4R3D A;  4BS5 A;  4YVA A;  4RF1 A;  2R9O A;  3RVX A;  1ICF A;  3KFQ A;  2AUZ A;  1UKF A;  1GEC E;  1QOL A;  1QDQ A;  2C0Y A;  4DMY A;  3H6S A;  3GCB A;  1GLO A;  1S4V A;  3HD3 A;  3C0R A;  2E03 A;  4MZS A;  4PP2 E;  1VJV A;  2Y5B A;  1YT7 A;  2DCB A;  2BTW B;  1CSB B;  2G8E A;  2UZJ A;  2DOS A;  2OUL A;  3PNR A;  1PBH A;  1PXV A;  3IEJ A;  2B1N A;  5JA7 A;  3OVX A;  4BOZ A;  3K9M A;  3OQC A;  1DKI A;  1K3B B;  3P5W A;  2DJG B;  4BSQ A;  4CDF B;  1DF0 A;  4PAD A;  1STF E;  5CVM A;  3AI8 A;  4D8E A;  1AYU A;  1NQC A;  1ZCM A;  3TMP A;  2JTC A;  1NPZ A;  3O1G A;  1EWM A;  2XU5 A;  1MS6 A;  5CVN B;  1JQP A;  3MP2 A;  1EWL A;  4P16 A;  3PHW A;  2YJ9 A;  2PNS A;  1QXP A;  1O0E A;  5EZS A;  3PSE A;  2E02 A;  3CH3 X;  3W30 A;  2DC7 A;  2DCD A;  3IV2 A;  3RNV A;  1Y08 A;  2B1M A;  3MTN A;  2E01 A;  1F2C A;  3QT4 A;  3S3Q A;  4FK5 A;  3E1Z B;  3ZNH A;  1NL6 A;  2J7Q C;  1U5I A;  4RKX A;  3MTV A;  3RVV A;  1EWP A;  1AEC A;  4OVZ A;  3F75 A;  2AGA A;  3BBA A;  4YYV A;  1CS8 A;  2R6N A;  4OW0 A;  1AU4 A;  4BQV A;  3BWK A;  3F5V A;  3KX1 A;  3RVW A;  4OVZ B;  3BPF A;  2NQD B;  1PCI A;  4BOS A;  4W5B A;  3S3R A;  2AYO A;  4A5U A;  3OVZ A;  3ZUA A;  1NLJ A;  1EF7 A;  3V6E A;  4CDC B;  2OP3 A;  3TRK A;  3KWZ A;  1X9Y A;  2NQI A;  2R9F A;  2JRI A;  3BCN A;  4WA6 A;  3M99 A;  1TLO A;  1PVJ A;  3QJ3 A;  4G54 A;  2FUD A;  4Q8H A;  3U8E A;  1HUC B;  4YYW A;  4REZ A;  3V6C A;  3B21 A;  1QMY A;  2PRE A;  5PAD A;  4K7C A;  4N8W A;  2VHF A;  1BP4 A;  4AXM A;  1Q6K A;  2YJC A;  1KHQ A;  2P7U A;  4D8B A;  2NQG A;  3IUT A;  2DC9 A;  3O65 A;  5KO3 A;  3OIS A;  2Y6E A;  1AU0 A;  2O6X A;  3E9S A;  2R9C A;  2DZZ A;  4DMX A;  2F1G A;  2FQ9 A;  2PAD A;  2J7Q A;  4X6J A;  1Y4H A;  3WXE A;  4I05 A;  1DEU A;  4BOU A;  4D8I A;  4PP1 A;  3KWB X;  1YAL A;  3CH2 X;  1BY8 A;  1PE6 A;  1NB3 A;  1AYW A;  4QH6 A;  4RY2 A;  4XZX A;  2FRQ A;  4IUM A;  1YK7 A;  2R9N A;  2PBH A;  1MHW A;  2G8J A;  1NB5 A;  3B79 A;  1PIP A;  2AIM A;  1CJL A;  1AIM A;  1CPJ A;  2FTD A;  4W4U A;  3CBK A;  2HWK A;  3PW3 A;  4BOP A;  2IPP B;  3N3K A;  4XUI A;  2WBF X;  4YYU A;  5E6J A;  1AU3 A;  2HHN A;  5EGW A;  1YVB A;  2NQA A;  2DJF B;  2ATO A;  2H7J A;  3MOR A;  5CHV A;  3KW9 A;  2DCA A;  4OEL A;  3MHS A;  4BOQ A;  3PHX A;  5J94 A;  4YYS A;  1U9W A;  3BC3 A;  6PAD A;  1PPO A;  2FYE A;  1POP A;  1GCB A;  5A24 A;  1PPP A;  3P5U A;  4X6I A;  3KSE A;  1F2A A;  1XKG A;  4WUR A;  4CDD B;  1M6D A;  2HD5 A;  2CB5 A;  2XU4 A;  4Q8G A;  2GFO A;  1CB5 A;  1A6R A;  5CVO B;  4W5C A;  4ZUX U;  3P5V A;  2DCC A;  2Z84 A;  1AU2 A;  2G7Y A;  1MEG A;  1MEM A;  2YJ8 A;  4RF0 A;  1ITO A;  2DC6 A;  3I06 A;  2IBI A;  3OF8 A;  1CQD A;  5JH3 A;  1ME3 A;  3NHE A;  1F2B A;  3KKU A;  2R9M A;  4RNA A;  1ATK A;  3ERV A;  3BOW A;  1IWD A; 
#chains in the Genus database with same CATH homology
 4BPV A;  3H89 A;  4YV8 A;  1CV8 A;  4CDE B;  2BDZ A;  1MDW A;  2JQF R;  2JQG R;  4FIP A;  1FH0 A;  2VHS A;  5CHT A;  4FJC A;  7PCK A;  1KHP A;  8PCH A;  3MHH A;  1CTE A;  3C9E A;  2F7D A;  3LFY A;  3TNX A;  3K24 A;  2AUX A;  4P6G A;  4I04 A;  5K16 A;  1KFU L;  3USV A;  4QBB A;  4MZO A;  1KXR A;  2AYN A;  2YJ2 A;  4AXL A;  4GUZ A;  4P6E A;  4YYQ A;  2BSZ A;  1PPD A;  1PPN A;  3O0U A;  2XU1 A;  2DC8 A;  1BGO A;  1MIR A;  3N4C A;  3HWN A;  4N4Z A;  2E00 A;  1SNK A;  2YJB A;  3CBJ A;  1TU6 A;  3WXG A;  1THE A;  3K8U A;  2OZ2 A;  2P0R A;  4QRX A;  3DF0 A;  3H8C A;  1AYV A;  1U9V A;  2HH5 A;  2FRA A;  1U9Q X;  3PBH A;  1ME4 A;  4MSX A;  4CZW A;  2DZY A;  1ZIV A;  3WXF A;  1U9X A;  2FO5 A;  1GMY A;  9PAP A;  3HHA A;  2GHU A;  2XU3 A;  2BDL A;  4N79 A;  4QRV A;  4OEM A;  5F02 A;  3LXS A;  3H7D A;  4YYR A;  3IMA A;  3OF9 A;  3H8B A;  1EWO A;  3D6S A;  1TL9 A;  2FT2 A;  4NV7 A;  3IHP A;  3I3T A;  1KFX L;  2G6D A;  4I07 A;  4PI3 A;  4QRG A;  1F29 A;  4KLB A;  4BS6 A;  3N3G A;  3P5X A;  3PDF A;  1PAD A;  2ARY A;  1W5R A;  1CVZ A;  5FPW A;  4HWY A;  1W4T A;  2HXZ A;  3IOQ A;  2AU1 A;  4XR7 A;  1YK8 A;  2AS8 A;  2ACT A;  3BPM A;  4X6H A;  1VSN A;  5EF4 A;  1SP4 B;  3HHI A;  2CIO A;  1BQI A;  1W6F A;  2AVW A;  3QSD A;  2P86 A;  4BS5 A;  4YVA A;  2R9O A;  3RVX A;  1ICF A;  3KFQ A;  2AUZ A;  1GEC E;  4C5P A;  1QOL A;  1QDQ A;  2C0Y A;  2VFC A;  4DMY A;  3H6S A;  3GCB A;  1GLO A;  1S4V A;  3HD3 A;  2E03 A;  4MZS A;  4PP2 E;  1VJV A;  2Y5B A;  1YT7 A;  2DCB A;  1CSB B;  2G8E A;  2OUL A;  3PNR A;  1PBH A;  4B55 A;  1PXV A;  3IEJ A;  2B1N A;  5JA7 A;  3OVX A;  3K9M A;  1E2T A;  1K3B B;  3P5W A;  2DJG B;  4BSQ A;  4CDF B;  1DF0 A;  4PAD A;  1STF E;  5CVM A;  3AI8 A;  1AYU A;  1NQC A;  1ZCM A;  1NPZ A;  3O1G A;  1EWM A;  2XU5 A;  1MS6 A;  5CVN B;  1JQP A;  2VFB A;  1EWL A;  2YJ9 A;  2PNS A;  1QXP A;  1O0E A;  2E02 A;  3CH3 X;  2DC7 A;  2DCD A;  3IV2 A;  1Y08 A;  2B1M A;  3MTN A;  1GX3 A;  2E01 A;  1F2C A;  3QT4 A;  3S3Q A;  4FK5 A;  3E1Z B;  1NL6 A;  1U5I A;  3RVV A;  1EWP A;  1AEC A;  3F75 A;  4YYV A;  1CS8 A;  2R6N A;  1AU4 A;  4BQV A;  3BWK A;  3F5V A;  3KX1 A;  3RVW A;  3BPF A;  2NQD B;  1PCI A;  4W5B A;  3S3R A;  2AYO A;  3OVZ A;  3ZUA A;  1NLJ A;  1EF7 A;  3V6E A;  4CDC B;  2OP3 A;  3KWZ A;  1X9Y A;  2NQI A;  2R9F A;  3BCN A;  4WA6 A;  3M99 A;  1TLO A;  3QJ3 A;  4G54 A;  2FUD A;  4Q8H A;  3D9W A;  3U8E A;  1HUC B;  4YYW A;  3V6C A;  1QMY A;  2PRE A;  5PAD A;  4K7C A;  4N8W A;  2VHF A;  1BP4 A;  4AXM A;  1Q6K A;  2YJC A;  1KHQ A;  2P7U A;  2NQG A;  3IUT A;  2DC9 A;  3LTW A;  3OIS A;  2Y6E A;  1AU0 A;  2O6X A;  2R9C A;  2DZZ A;  4DMX A;  2F1G A;  2FQ9 A;  2PAD A;  4X6J A;  1Y4H A;  3WXE A;  4I05 A;  1DEU A;  4PP1 A;  3KWB X;  1YAL A;  3CH2 X;  1BY8 A;  1PE6 A;  1NB3 A;  1AYW A;  4QH6 A;  4RY2 A;  2FRQ A;  1YK7 A;  2R9N A;  2PBH A;  1MHW A;  2G8J A;  1NB5 A;  3B79 A;  1PIP A;  2AIM A;  1CJL A;  1AIM A;  4NV8 A;  1CPJ A;  2FTD A;  4W4U A;  3CBK A;  3PW3 A;  2IPP B;  3N3K A;  4XUI A;  2WBF X;  4YYU A;  1AU3 A;  2HHN A;  5EGW A;  4BGF A;  1YVB A;  2NQA A;  2DJF B;  2ATO A;  2H7J A;  3MOR A;  5CHV A;  3KW9 A;  2DCA A;  4OEL A;  3MHS A;  5J94 A;  4YYS A;  1U9W A;  3BC3 A;  6PAD A;  1PPO A;  2FYE A;  1POP A;  1GCB A;  5A24 A;  1PPP A;  3P5U A;  4X6I A;  3KSE A;  1F2A A;  1XKG A;  4CDD B;  1M6D A;  2HD5 A;  2CB5 A;  2XU4 A;  4Q8G A;  2GFO A;  1CB5 A;  1A6R A;  5CVO B;  4W5C A;  4ZUX U;  3P5V A;  2DCC A;  1AU2 A;  2G7Y A;  1MEG A;  1MEM A;  2YJ8 A;  1ITO A;  2DC6 A;  3I06 A;  2IBI A;  3OF8 A;  1CQD A;  5JH3 A;  1ME3 A;  3NHE A;  1F2B A;  3KKU A;  2R9M A;  1ATK A;  3ERV A;  3BOW A;  1IWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...