2DC9A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca074me complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
molecule keywords CATHEPSIN B
total genus 78
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc9A00
5EF4A 1GECE 4YV8A 4ZUXU 4XR7A 3N3KA 2FUDA 2P7UA 1POPA 3IMAA 1X9YA 1CVZA 2R6NA 1CB5A 2DC7A 3BPFA 4CDEB 3RVVA 2DC6A 3P5UA 2F7DA 1DF0A 3C9EA 3H6SA 2HD5A 2DCAA 2DJGB 3K8UA 1K3BB 1BGOA 3AI8A 3CBKA 1S4VA 1DEUA 1NB5A 2NQAA 2YJ2A 3QSDA 1CSBB 2HXZA 5CHVA 4YYRA 5CVNB 2R9CA 1F2CA 1NPZA 3PW3A 4MZSA 4X6HA 3V6EA 3H8BA 1YALA 1BY8A 4W5CA 1PE6A 3PBHA 2GFOA 6PADA 3BPMA 4PP2E 1M6DA 3O1GA 2XU5A 7PCKA 1YK7A 1KFXL 3DF0A 1YT7A 2B1NA 3O0UA 4X6IA 3B79A 2XU3A 2VHFA 2P0RA 3RVWA 1U5IA 1YVBA 1STFE 5JA7A 4N4ZA 1VSNA 5F02A 3CH2X 4QH6A 4BS5A 1F29A 1XKGA 4AXLA 3H89A 2NQGA 1TU6A 4MSXA 4K7CA 4I07A 1ATKA 3K24A 2OP3A 1AECA 3CBJA 1EF7A 4YYQA 1MIRA 2DZZA 2DCCA 1PCIA 1QOLA 1MS6A 1AYWA 2AU1A 5JH3A 2OULA 2G6DA 2GHUA 4G54A 3P5WA 2R9NA 2AUXA 1PADA 2FQ9A 4DMYA 4YYWA 1PIPA 5PADA 1EWPA 2XU4A 1TLOA 1ICFA 2CB5A 1MEGA 2Y5BA 1VJVA 3BCNA 4N8WA 4QBBA 2PBHA 2FO5A 1AYVA 2E03A 5K16A 2E00A 4FJCA 5CVMA 3ZUAA 1Q6KA 8PCHA 2AIMA 3HHIA 1PPDA 3OVXA 1ME3A 2Y6EA 2ATOA 2HHNA 2JQFR 3F5VA 1EWOA 2DC9A 2FTDA 2JQGR 4PADA 4DMXA 4CZWA 4FIPA 3QJ3A 1IWDA 4OELA 1NQCA 3MHHA 4I04A 2AYOA 3KFQA 2ACTA 2R9MA 1ZIVA 2E01A 1NL6A 3HWNA 1BQIA 1PPOA 4RY2A 2R9FA 1AU4A 4MZOA 1HUCB 1AYUA 3K9MA 5J94A 1F2BA 4BQVA 1F2AA 3H7DA 3S3RA 2BDZA 1SP4B 4YYSA 3KW9A 3IOQA 1EWLA 3P5VA 3RVXA 1AIMA 3N4CA 1PPPA 1MDWA 5FPWA 1CTEA 3BC3A 1QXPA 2YJ9A 5EGWA 3D6SA 3U8EA 3S3QA 3I3TA 1GLOA 2R9OA 3KWZA 2C0YA 4Q8HA 3LFYA 3IV2A 2WBFX 3HHAA 1U9WA 4FK5A 3IHPA 3MHSA 2P86A 1GMYA 1TL9A 1O0EA 2DCDA 4N79A 4I05A 2H7JA 3OF9A 4BPVA 3WXGA 4AXMA 5CVOB 2G7YA 4QRXA 4PI3A 1GCBA 2DCBA 1CPJA 3IEJA 4W5BA 1ME4A 1A6RA 4Q8GA 2AVWA 3HD3A 4YYUA 2DJFB 2PADA 2XU1A 1U9XA 1PPNA 4YYVA 2G8JA 3I06A 5CHTA 2VHSA 2CIOA 3CH3X 4CDFB 4CDCB 2NQDB 3USVA 1YK8A 2ARYA 1U9VA 1NLJA 3V6CA 1FH0A 2AUZA 1EWMA 2IPPB 4WA6A 5A24A 2PNSA 1ITOA 1CS8A 4HWYA 2OZ2A 2AS8A 3BOWA 3OF8A 2YJ8A 1THEA 1KHPA 2B1MA 4X6JA 3OVZA 1CQDA 9PAPA 4BSQA 4KLBA 3WXFA 1QMYA 1Y08A 4W4UA 2HH5A 2FRQA 4CDDB 2G8EA 3F75A 3GCBA 3KWBX 3PDFA 4XUIA 1PXVA 4QRVA 4BS6A 1ZCMA 4YVAA 2DZYA 1KFUL 4P6GA 4QRGA 3E1ZB 3ERVA 1SNKA 3N3GA 1BP4A 1AU2A 1AU3A 3KSEA 1AU0A 1Y4HA 1QDQA 3IUTA 3LXSA 1CV8A 2YJBA 1CJLA 3MORA 2YJCA 2PREA 2BDLA 2FRAA 1KXRA 2IBIA 3BWKA 4PP1A 2DC8A 2FYEA 3QT4A 2AYNA 2O6XA 2FT2A 3KKUA 3WXEA 2NQIA 3PNRA 3H8CA 1U9QX 3P5XA 4OEMA 1MEMA 1NB3A 3NHEA 4P6EA 3M99A 3MTNA 1KHQA 1MHWA 2E02A 1JQPA 2F1GA 3KX1A 3TNXA 1PBHA 3OISA
chains in the Genus database with same CATH superfamily
5EF4A 1GECE 4YV8A 4ZUXU 4XR7A 4MI7A 3N3KA 2FUDA 3PSEA 2P7UA 1POPA 3IMAA 1X9YA 1CVZA 2R6NA 1CB5A 2DC7A 3BPFA 4CDEB 3RVVA 2DC6A 5KO3A 3P5UA 2F7DA 1DF0A 3C9EA 3H6SA 2HD5A 2DCAA 2DJGB 3K8UA 1K3BB 1BGOA 3AI8A 3CBKA 1S4VA 1DEUA 1NB5A 2NQAA 3PHUA 2YJ2A 3QSDA 1CSBB 2HXZA 5CHVA 4YYRA 5CVNB 2R9CA 1F2CA 4RNAA 2JTCA 1NPZA 3PW3A 1UKFA 4MZSA 2UZJA 4X6HA 3H8BA 3V6EA 1YALA 1BY8A 4W5CA 3OQCA 1PE6A 3PBHA 2GFOA 6PADA 3BPMA 4XZXA 4PP2E 1M6DA 4BOQA 3O1GA 2XU5A 7PCKA 5EZQA 1YK7A 3ZNHA 4OW0A 1KFXL 3DF0A 2J7QC 3C0RA 1YT7A 2B1NA 3O0UA 4X6IA 5EZSA 3B79A 2XU3A 2VHFA 4A5UA 2P0RA 3RVWA 1U5IA 1YVBA 1STFE 5JA7A 4N4ZA 1VSNA 5F02A 3CH2X 4QH6A 4ZTBA 4BS5A 3PRMA 1F29A 1XKGA 2AGAA 4AXLA 3H89A 2NQGA 1TU6A 4MSXA 4K7CA 4I07A 1ATKA 3K24A 2OP3A 1AECA 3CBJA 1EF7A 4YYQA 1MIRA 2DZZA 2DCCA 1PCIA 4BOSA 1QOLA 1MS6A 1AYWA 2AU1A 5JH3A 2OULA 2G6DA 2GHUA 4G54A 3P5WA 4REZA 2R9NA 2AUXA 1PADA 2FQ9A 4DMYA 4YYWA 1PIPA 5PADA 1EWPA 4D8BA 3RNVA 2XU4A 1TLOA 1ICFA 4RKXA 2CB5A 1MEGA 2Y5BA 1VJVA 3BCNA 4N8WA 4QBBA 2PBHA 2BTWA 2FO5A 1AYVA 2E03A 5K16A 2E00A 4FJCA 5CVMA 3ZUAA 1Q6KA 8PCHA 2AIMA 3HHIA 1PPDA 3MP2A 3OVXA 1ME3A 2Y6EA 2J7QA 2ATOA 2HHNA 2JQFR 3F5VA 1EWOA 2DC9A 2FTDA 2JQGR 3BY4A 4PADA 4DMXA 4CZWA 4FIPA 3QJ3A 1IWDA 4OELA 1NQCA 3MHHA 2BU3A 2AYOA 3KFQA 4I04A 2ACTA 2R9MA 4OVZB 1ZIVA 2E01A 1NL6A 2BTWB 3HWNA 1BQIA 1PPOA 4RY2A 2R9FA 3TMPA 1AU4A 4MZOA 1HUCB 1AYUA 3K9MA 3BBAA 5J94A 5E6JA 1F2BA 4BQVA 1F2AA 3H7DA 3S3RA 1PVJA 2BDZA 1SP4B 2Z84A 4YYSA 4D8EA 4BOUA 3KW9A 3IOQA 1EWLA 3P5VA 3RVXA 1AIMA 3N4CA 1PPPA 1MDWA 5FPWA 1CTEA 3BC3A 1QXPA 2YJ9A 5EGWA 3D6SA 3U8EA 3S3QA 4BOZA 2JRIA 3I3TA 1GLOA 2R9OA 3KWZA 2C0YA 4Q8HA 3LFYA 4WURA 3IV2A 4P16A 2WBFX 3HHAA 1U9WA 4FK5A 4IP3A 3IHPA 3MHSA 3PT2A 4HXDB 2P86A 1GMYA 1TL9A 1O0EA 2DCDA 4N79A 4I05A 2H7JA 3OF9A 4BPVA 3WXGA 4AXMA 5CVOB 2G7YA 4QRXA 4PI3A 1GCBA 2DCBA 1CPJA 3IEJA 4W5BA 1ME4A 3PHXA 1A6RA 4Q8GA 2AVWA 3O65A 4R3DA 3HD3A 4YYUA 3B21A 2DJFB 4PT5A 2PADA 4IUMA 4GUAA 2XU1A 1U9XA 1PPNA 4YYVA 2G8JA 3I06A 5CHTA 3MJ5A 5JZEA 2VHSA 2CIOA 3CH3X 4CDFB 4CDCB 2NQDB 4MM3B 3USVA 1YK8A 2ARYA 1U9VA 1NLJA 3V6CA 1FH0A 2AUZA 1EWMA 4RF1A 2IPPB 1DKIA 4WA6A 5A24A 2PNSA 1ITOA 3PRPA 4BOPA 1CS8A 4HWYA 2OZ2A 2AS8A 3BOWA 3OF8A 2YJ8A 4M0WA 1THEA 2DOSA 1KHPA 2B1MA 4X6JA 3OVZA 3IFUA 1CQDA 9PAPA 4BSQA 1YZBA 4KLBA 3WXFA 1QMYA 1Y08A 4W4UA 2HH5A 4D8IA 2FRQA 4CDDB 2G8EA 3F75A 3GCBA 3KWBX 3PDFA 4XUIA 1PXVA 2FE8A 4QRVA 4BS6A 1ZCMA 4YVAA 2DZYA 1KFUL 4P6GA 4QRGA 3PHWA 3E1ZB 3ERVA 1SNKA 3N3GA 1BP4A 1AU2A 1AU3A 3KSEA 1AU0A 1Y4HA 1QDQA 3IUTA 3LXSA 1CV8A 3W31A 2YJBA 1CJLA 3TRKA 3MORA 3W30A 2YJCA 2PREA 2HWKA 2BDLA 2FRAA 1KXRA 2IBIA 3BWKA 4PP1A 2DC8A 2FYEA 3QT4A 2AYNA 2O6XA 2FT2A 3KKUA 3WXEA 2NQIA 3PNRA 3H8CA 1U9QX 3P5XA 4OEMA 1MEMA 3BB7A 4RF0A 1NB3A 3E9SA 4OVZA 3NHEA 4P6EA 3M99A 3MTNA 1KHQA 3MTVA 1MHWA 2E02A 1JQPA 2F1GA 3KX1A 3TNXA 1PBHA 3OISA
chains in the Genus database with same CATH topology
5EF4A 1GECE 4YV8A 4ZUXU 4XR7A 3N3KA 2FUDA 2P7UA 1POPA 3IMAA 1X9YA 1CVZA 2R6NA 1CB5A 2DC7A 3BPFA 4CDEB 3RVVA 2DC6A 3P5UA 2F7DA 1DF0A 3C9EA 3H6SA 2HD5A 2DCAA 2DJGB 3K8UA 1K3BB 1BGOA 3AI8A 3CBKA 1S4VA 1DEUA 1NB5A 2NQAA 2YJ2A 3QSDA 1CSBB 2HXZA 5CHVA 4YYRA 5CVNB 2R9CA 1F2CA 1NPZA 3PW3A 4MZSA 4X6HA 3V6EA 3H8BA 1YALA 1BY8A 4W5CA 1PE6A 3PBHA 2GFOA 6PADA 3BPMA 4PP2E 1M6DA 3O1GA 2VFCA 2XU5A 7PCKA 1YK7A 1KFXL 3DF0A 1YT7A 2B1NA 3O0UA 4X6IA 3B79A 2XU3A 2VHFA 4GUZA 2P0RA 3RVWA 1U5IA 1YVBA 1STFE 5JA7A 4N4ZA 1VSNA 5F02A 3CH2X 4QH6A 4BS5A 1F29A 1XKGA 4AXLA 3H89A 2NQGA 1TU6A 4C5PA 4MSXA 4K7CA 4I07A 1ATKA 3K24A 2OP3A 1AECA 3CBJA 1EF7A 4YYQA 1MIRA 2DZZA 2DCCA 1PCIA 1QOLA 1MS6A 1AYWA 2AU1A 5JH3A 2OULA 2G6DA 2GHUA 4G54A 3P5WA 2R9NA 2AUXA 1PADA 2FQ9A 4DMYA 4YYWA 1PIPA 5PADA 1EWPA 2XU4A 1TLOA 1ICFA 2CB5A 1MEGA 2Y5BA 1VJVA 3BCNA 4N8WA 4QBBA 2PBHA 4NV8A 2FO5A 1AYVA 2E03A 5K16A 2E00A 4FJCA 5CVMA 3ZUAA 1Q6KA 8PCHA 2AIMA 3HHIA 1PPDA 3OVXA 1ME3A 2Y6EA 2ATOA 2HHNA 2JQFR 3F5VA 1EWOA 2DC9A 2FTDA 2JQGR 2VFBA 4PADA 4DMXA 4CZWA 4FIPA 3QJ3A 1IWDA 4OELA 1NQCA 3MHHA 4I04A 2AYOA 3KFQA 2ACTA 2R9MA 1ZIVA 2E01A 1NL6A 3HWNA 1BQIA 1PPOA 4RY2A 2R9FA 1AU4A 4MZOA 1E2TA 1HUCB 1AYUA 3K9MA 5J94A 1F2BA 4BQVA 1F2AA 3H7DA 3S3RA 1W4TA 2BDZA 1SP4B 4YYSA 3KW9A 3IOQA 1EWLA 3P5VA 3RVXA 1AIMA 3N4CA 1PPPA 1MDWA 5FPWA 1CTEA 3BC3A 1QXPA 2YJ9A 5EGWA 3D6SA 3U8EA 3S3QA 3I3TA 1GLOA 2R9OA 3KWZA 2C0YA 4Q8HA 3LFYA 3IV2A 3LTWA 2WBFX 3HHAA 1U9WA 4FK5A 3IHPA 3MHSA 2P86A 1GMYA 1TL9A 1O0EA 2DCDA 4N79A 4I05A 2H7JA 3OF9A 4BPVA 3WXGA 4AXMA 5CVOB 2BSZA 2G7YA 4QRXA 4PI3A 1GCBA 2DCBA 1CPJA 3IEJA 4W5BA 1ME4A 1A6RA 4Q8GA 2AVWA 3HD3A 4YYUA 2DJFB 2PADA 4NV7A 1W6FA 2XU1A 1U9XA 1PPNA 4YYVA 2G8JA 3I06A 5CHTA 2VHSA 2CIOA 3CH3X 4CDFB 4CDCB 2NQDB 3USVA 1YK8A 2ARYA 1U9VA 1NLJA 1W5RA 3V6CA 1FH0A 2AUZA 1EWMA 2IPPB 4WA6A 5A24A 2PNSA 1ITOA 1CS8A 4HWYA 2OZ2A 2AS8A 4BGFA 3BOWA 3OF8A 2YJ8A 1THEA 1KHPA 2B1MA 4X6JA 3OVZA 4B55A 1CQDA 9PAPA 4BSQA 4KLBA 3WXFA 1QMYA 1Y08A 4W4UA 2HH5A 2FRQA 4CDDB 2G8EA 3F75A 3GCBA 3KWBX 3PDFA 4XUIA 1PXVA 4QRVA 4BS6A 1ZCMA 4YVAA 2DZYA 1KFUL 4P6GA 4QRGA 3E1ZB 3ERVA 1SNKA 3N3GA 1BP4A 1AU2A 1AU3A 3KSEA 1AU0A 1Y4HA 1QDQA 3IUTA 3LXSA 3D9WA 1CV8A 2YJBA 1CJLA 3MORA 2YJCA 2PREA 2BDLA 2FRAA 1KXRA 2IBIA 3BWKA 4PP1A 2DC8A 2FYEA 3QT4A 2AYNA 2O6XA 2FT2A 3KKUA 3WXEA 2NQIA 3PNRA 3H8CA 1GX3A 1U9QX 3P5XA 4OEMA 1MEMA 1NB3A 3NHEA 4P6EA 3M99A 3MTNA 1KHQA 1MHWA 2E02A 1JQPA 2F1GA 3KX1A 3TNXA 1PBHA 3OISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EF4 A;  1GEC E;  4YV8 A;  4ZUX U;  4XR7 A;  3N3K A;  2FUD A;  2P7U A;  1POP A;  3IMA A;  1X9Y A;  1CVZ A;  2R6N A;  1CB5 A;  2DC7 A;  3BPF A;  4CDE B;  3RVV A;  2DC6 A;  3P5U A;  2F7D A;  1DF0 A;  3C9E A;  3H6S A;  2HD5 A;  2DCA A;  2DJG B;  3K8U A;  1K3B B;  1BGO A;  3AI8 A;  3CBK A;  1S4V A;  1DEU A;  1NB5 A;  2NQA A;  2YJ2 A;  3QSD A;  1CSB B;  2HXZ A;  5CHV A;  4YYR A;  5CVN B;  2R9C A;  1F2C A;  1NPZ A;  3PW3 A;  4MZS A;  4X6H A;  3V6E A;  3H8B A;  1YAL A;  1BY8 A;  4W5C A;  1PE6 A;  3PBH A;  2GFO A;  6PAD A;  3BPM A;  4PP2 E;  1M6D A;  3O1G A;  2XU5 A;  7PCK A;  1YK7 A;  1KFX L;  3DF0 A;  1YT7 A;  2B1N A;  3O0U A;  4X6I A;  3B79 A;  2XU3 A;  2VHF A;  2P0R A;  3RVW A;  1U5I A;  1YVB A;  1STF E;  5JA7 A;  4N4Z A;  1VSN A;  5F02 A;  3CH2 X;  4QH6 A;  4BS5 A;  1F29 A;  1XKG A;  4AXL A;  3H89 A;  2NQG A;  1TU6 A;  4MSX A;  4K7C A;  4I07 A;  1ATK A;  3K24 A;  2OP3 A;  1AEC A;  3CBJ A;  1EF7 A;  4YYQ A;  1MIR A;  2DZZ A;  2DCC A;  1PCI A;  1QOL A;  1MS6 A;  1AYW A;  2AU1 A;  5JH3 A;  2OUL A;  2G6D A;  2GHU A;  4G54 A;  3P5W A;  2R9N A;  2AUX A;  1PAD A;  2FQ9 A;  4DMY A;  4YYW A;  1PIP A;  5PAD A;  1EWP A;  2XU4 A;  1TLO A;  1ICF A;  2CB5 A;  1MEG A;  2Y5B A;  1VJV A;  3BCN A;  4N8W A;  4QBB A;  2PBH A;  2FO5 A;  1AYV A;  2E03 A;  5K16 A;  2E00 A;  4FJC A;  5CVM A;  3ZUA A;  1Q6K A;  8PCH A;  2AIM A;  3HHI A;  1PPD A;  3OVX A;  1ME3 A;  2Y6E A;  2ATO A;  2HHN A;  2JQF R;  3F5V A;  1EWO A;  2DC9 A;  2FTD A;  2JQG R;  4PAD A;  4DMX A;  4CZW A;  4FIP A;  3QJ3 A;  1IWD A;  4OEL A;  1NQC A;  3MHH A;  4I04 A;  2AYO A;  3KFQ A;  2ACT A;  2R9M A;  1ZIV A;  2E01 A;  1NL6 A;  3HWN A;  1BQI A;  1PPO A;  4RY2 A;  2R9F A;  1AU4 A;  4MZO A;  1HUC B;  1AYU A;  3K9M A;  5J94 A;  1F2B A;  4BQV A;  1F2A A;  3H7D A;  3S3R A;  2BDZ A;  1SP4 B;  4YYS A;  3KW9 A;  3IOQ A;  1EWL A;  3P5V A;  3RVX A;  1AIM A;  3N4C A;  1PPP A;  1MDW A;  5FPW A;  1CTE A;  3BC3 A;  1QXP A;  2YJ9 A;  5EGW A;  3D6S A;  3U8E A;  3S3Q A;  3I3T A;  1GLO A;  2R9O A;  3KWZ A;  2C0Y A;  4Q8H A;  3LFY A;  3IV2 A;  2WBF X;  3HHA A;  1U9W A;  4FK5 A;  3IHP A;  3MHS A;  2P86 A;  1GMY A;  1TL9 A;  1O0E A;  2DCD A;  4N79 A;  4I05 A;  2H7J A;  3OF9 A;  4BPV A;  3WXG A;  4AXM A;  5CVO B;  2G7Y A;  4QRX A;  4PI3 A;  1GCB A;  2DCB A;  1CPJ A;  3IEJ A;  4W5B A;  1ME4 A;  1A6R A;  4Q8G A;  2AVW A;  3HD3 A;  4YYU A;  2DJF B;  2PAD A;  2XU1 A;  1U9X A;  1PPN A;  4YYV A;  2G8J A;  3I06 A;  5CHT A;  2VHS A;  2CIO A;  3CH3 X;  4CDF B;  4CDC B;  2NQD B;  3USV A;  1YK8 A;  2ARY A;  1U9V A;  1NLJ A;  3V6C A;  1FH0 A;  2AUZ A;  1EWM A;  2IPP B;  4WA6 A;  5A24 A;  2PNS A;  1ITO A;  1CS8 A;  4HWY A;  2OZ2 A;  2AS8 A;  3BOW A;  3OF8 A;  2YJ8 A;  1THE A;  1KHP A;  2B1M A;  4X6J A;  3OVZ A;  1CQD A;  9PAP A;  4BSQ A;  4KLB A;  3WXF A;  1QMY A;  1Y08 A;  4W4U A;  2HH5 A;  2FRQ A;  4CDD B;  2G8E A;  3F75 A;  3GCB A;  3KWB X;  3PDF A;  4XUI A;  1PXV A;  4QRV A;  4BS6 A;  1ZCM A;  4YVA A;  2DZY A;  1KFU L;  4P6G A;  4QRG A;  3E1Z B;  3ERV A;  1SNK A;  3N3G A;  1BP4 A;  1AU2 A;  1AU3 A;  3KSE A;  1AU0 A;  1Y4H A;  1QDQ A;  3IUT A;  3LXS A;  1CV8 A;  2YJB A;  1CJL A;  3MOR A;  2YJC A;  2PRE A;  2BDL A;  2FRA A;  1KXR A;  2IBI A;  3BWK A;  4PP1 A;  2DC8 A;  2FYE A;  3QT4 A;  2AYN A;  2O6X A;  2FT2 A;  3KKU A;  3WXE A;  2NQI A;  3PNR A;  3H8C A;  1U9Q X;  3P5X A;  4OEM A;  1MEM A;  1NB3 A;  3NHE A;  4P6E A;  3M99 A;  3MTN A;  1KHQ A;  1MHW A;  2E02 A;  1JQP A;  2F1G A;  3KX1 A;  3TNX A;  1PBH A;  3OIS A; 
#chains in the Genus database with same CATH topology
 5EF4 A;  1GEC E;  4YV8 A;  4ZUX U;  4XR7 A;  4MI7 A;  3N3K A;  2FUD A;  3PSE A;  2P7U A;  1POP A;  3IMA A;  1X9Y A;  1CVZ A;  2R6N A;  1CB5 A;  2DC7 A;  3BPF A;  4CDE B;  3RVV A;  2DC6 A;  5KO3 A;  3P5U A;  2F7D A;  1DF0 A;  3C9E A;  3H6S A;  2HD5 A;  2DCA A;  2DJG B;  3K8U A;  1K3B B;  1BGO A;  3AI8 A;  3CBK A;  1S4V A;  1DEU A;  1NB5 A;  2NQA A;  3PHU A;  2YJ2 A;  3QSD A;  1CSB B;  2HXZ A;  5CHV A;  4YYR A;  5CVN B;  2R9C A;  1F2C A;  4RNA A;  2JTC A;  1NPZ A;  3PW3 A;  1UKF A;  4MZS A;  2UZJ A;  4X6H A;  3H8B A;  3V6E A;  1YAL A;  1BY8 A;  4W5C A;  3OQC A;  1PE6 A;  3PBH A;  2GFO A;  6PAD A;  3BPM A;  4XZX A;  4PP2 E;  1M6D A;  4BOQ A;  3O1G A;  2XU5 A;  7PCK A;  5EZQ A;  1YK7 A;  3ZNH A;  4OW0 A;  1KFX L;  3DF0 A;  2J7Q C;  3C0R A;  1YT7 A;  2B1N A;  3O0U A;  4X6I A;  5EZS A;  3B79 A;  2XU3 A;  2VHF A;  4A5U A;  2P0R A;  3RVW A;  1U5I A;  1YVB A;  1STF E;  5JA7 A;  4N4Z A;  1VSN A;  5F02 A;  3CH2 X;  4QH6 A;  4ZTB A;  4BS5 A;  3PRM A;  1F29 A;  1XKG A;  2AGA A;  4AXL A;  3H89 A;  2NQG A;  1TU6 A;  4MSX A;  4K7C A;  4I07 A;  1ATK A;  3K24 A;  2OP3 A;  1AEC A;  3CBJ A;  1EF7 A;  4YYQ A;  1MIR A;  2DZZ A;  2DCC A;  1PCI A;  4BOS A;  1QOL A;  1MS6 A;  1AYW A;  2AU1 A;  5JH3 A;  2OUL A;  2G6D A;  2GHU A;  4G54 A;  3P5W A;  4REZ A;  2R9N A;  2AUX A;  1PAD A;  2FQ9 A;  4DMY A;  4YYW A;  1PIP A;  5PAD A;  1EWP A;  4D8B A;  3RNV A;  2XU4 A;  1TLO A;  1ICF A;  4RKX A;  2CB5 A;  1MEG A;  2Y5B A;  1VJV A;  3BCN A;  4N8W A;  4QBB A;  2PBH A;  2BTW A;  2FO5 A;  1AYV A;  2E03 A;  5K16 A;  2E00 A;  4FJC A;  5CVM A;  3ZUA A;  1Q6K A;  8PCH A;  2AIM A;  3HHI A;  1PPD A;  3MP2 A;  3OVX A;  1ME3 A;  2Y6E A;  2J7Q A;  2ATO A;  2HHN A;  2JQF R;  3F5V A;  1EWO A;  2DC9 A;  2FTD A;  2JQG R;  3BY4 A;  4PAD A;  4DMX A;  4CZW A;  4FIP A;  3QJ3 A;  1IWD A;  4OEL A;  1NQC A;  3MHH A;  2BU3 A;  2AYO A;  3KFQ A;  4I04 A;  2ACT A;  2R9M A;  4OVZ B;  1ZIV A;  2E01 A;  1NL6 A;  2BTW B;  3HWN A;  1BQI A;  1PPO A;  4RY2 A;  2R9F A;  3TMP A;  1AU4 A;  4MZO A;  1HUC B;  1AYU A;  3K9M A;  3BBA A;  5J94 A;  5E6J A;  1F2B A;  4BQV A;  1F2A A;  3H7D A;  3S3R A;  1PVJ A;  2BDZ A;  1SP4 B;  2Z84 A;  4YYS A;  4D8E A;  4BOU A;  3KW9 A;  3IOQ A;  1EWL A;  3P5V A;  3RVX A;  1AIM A;  3N4C A;  1PPP A;  1MDW A;  5FPW A;  1CTE A;  3BC3 A;  1QXP A;  2YJ9 A;  5EGW A;  3D6S A;  3U8E A;  3S3Q A;  4BOZ A;  2JRI A;  3I3T A;  1GLO A;  2R9O A;  3KWZ A;  2C0Y A;  4Q8H A;  3LFY A;  4WUR A;  3IV2 A;  4P16 A;  2WBF X;  3HHA A;  1U9W A;  4FK5 A;  4IP3 A;  3IHP A;  3MHS A;  3PT2 A;  4HXD B;  2P86 A;  1GMY A;  1TL9 A;  1O0E A;  2DCD A;  4N79 A;  4I05 A;  2H7J A;  3OF9 A;  4BPV A;  3WXG A;  4AXM A;  5CVO B;  2G7Y A;  4QRX A;  4PI3 A;  1GCB A;  2DCB A;  1CPJ A;  3IEJ A;  4W5B A;  1ME4 A;  3PHX A;  1A6R A;  4Q8G A;  2AVW A;  3O65 A;  4R3D A;  3HD3 A;  4YYU A;  3B21 A;  2DJF B;  4PT5 A;  2PAD A;  4IUM A;  4GUA A;  2XU1 A;  1U9X A;  1PPN A;  4YYV A;  2G8J A;  3I06 A;  5CHT A;  3MJ5 A;  5JZE A;  2VHS A;  2CIO A;  3CH3 X;  4CDF B;  4CDC B;  2NQD B;  4MM3 B;  3USV A;  1YK8 A;  2ARY A;  1U9V A;  1NLJ A;  3V6C A;  1FH0 A;  2AUZ A;  1EWM A;  4RF1 A;  2IPP B;  1DKI A;  4WA6 A;  5A24 A;  2PNS A;  1ITO A;  3PRP A;  4BOP A;  1CS8 A;  4HWY A;  2OZ2 A;  2AS8 A;  3BOW A;  3OF8 A;  2YJ8 A;  4M0W A;  1THE A;  2DOS A;  1KHP A;  2B1M A;  4X6J A;  3OVZ A;  3IFU A;  1CQD A;  9PAP A;  4BSQ A;  1YZB A;  4KLB A;  3WXF A;  1QMY A;  1Y08 A;  4W4U A;  2HH5 A;  4D8I A;  2FRQ A;  4CDD B;  2G8E A;  3F75 A;  3GCB A;  3KWB X;  3PDF A;  4XUI A;  1PXV A;  2FE8 A;  4QRV A;  4BS6 A;  1ZCM A;  4YVA A;  2DZY A;  1KFU L;  4P6G A;  4QRG A;  3PHW A;  3E1Z B;  3ERV A;  1SNK A;  3N3G A;  1BP4 A;  1AU2 A;  1AU3 A;  3KSE A;  1AU0 A;  1Y4H A;  1QDQ A;  3IUT A;  3LXS A;  1CV8 A;  3W31 A;  2YJB A;  1CJL A;  3TRK A;  3MOR A;  3W30 A;  2YJC A;  2PRE A;  2HWK A;  2BDL A;  2FRA A;  1KXR A;  2IBI A;  3BWK A;  4PP1 A;  2DC8 A;  2FYE A;  3QT4 A;  2AYN A;  2O6X A;  2FT2 A;  3KKU A;  3WXE A;  2NQI A;  3PNR A;  3H8C A;  1U9Q X;  3P5X A;  4OEM A;  1MEM A;  3BB7 A;  4RF0 A;  1NB3 A;  3E9S A;  4OVZ A;  3NHE A;  4P6E A;  3M99 A;  3MTN A;  1KHQ A;  3MTV A;  1MHW A;  2E02 A;  1JQP A;  2F1G A;  3KX1 A;  3TNX A;  1PBH A;  3OIS A; 
#chains in the Genus database with same CATH homology
 5EF4 A;  1GEC E;  4YV8 A;  4ZUX U;  4XR7 A;  3N3K A;  2FUD A;  2P7U A;  1POP A;  3IMA A;  1X9Y A;  1CVZ A;  2R6N A;  1CB5 A;  2DC7 A;  3BPF A;  4CDE B;  3RVV A;  2DC6 A;  3P5U A;  2F7D A;  1DF0 A;  3C9E A;  3H6S A;  2HD5 A;  2DCA A;  2DJG B;  3K8U A;  1K3B B;  1BGO A;  3AI8 A;  3CBK A;  1S4V A;  1DEU A;  1NB5 A;  2NQA A;  2YJ2 A;  3QSD A;  1CSB B;  2HXZ A;  5CHV A;  4YYR A;  5CVN B;  2R9C A;  1F2C A;  1NPZ A;  3PW3 A;  4MZS A;  4X6H A;  3V6E A;  3H8B A;  1YAL A;  1BY8 A;  4W5C A;  1PE6 A;  3PBH A;  2GFO A;  6PAD A;  3BPM A;  4PP2 E;  1M6D A;  3O1G A;  2VFC A;  2XU5 A;  7PCK A;  1YK7 A;  1KFX L;  3DF0 A;  1YT7 A;  2B1N A;  3O0U A;  4X6I A;  3B79 A;  2XU3 A;  2VHF A;  4GUZ A;  2P0R A;  3RVW A;  1U5I A;  1YVB A;  1STF E;  5JA7 A;  4N4Z A;  1VSN A;  5F02 A;  3CH2 X;  4QH6 A;  4BS5 A;  1F29 A;  1XKG A;  4AXL A;  3H89 A;  2NQG A;  1TU6 A;  4C5P A;  4MSX A;  4K7C A;  4I07 A;  1ATK A;  3K24 A;  2OP3 A;  1AEC A;  3CBJ A;  1EF7 A;  4YYQ A;  1MIR A;  2DZZ A;  2DCC A;  1PCI A;  1QOL A;  1MS6 A;  1AYW A;  2AU1 A;  5JH3 A;  2OUL A;  2G6D A;  2GHU A;  4G54 A;  3P5W A;  2R9N A;  2AUX A;  1PAD A;  2FQ9 A;  4DMY A;  4YYW A;  1PIP A;  5PAD A;  1EWP A;  2XU4 A;  1TLO A;  1ICF A;  2CB5 A;  1MEG A;  2Y5B A;  1VJV A;  3BCN A;  4N8W A;  4QBB A;  2PBH A;  4NV8 A;  2FO5 A;  1AYV A;  2E03 A;  5K16 A;  2E00 A;  4FJC A;  5CVM A;  3ZUA A;  1Q6K A;  8PCH A;  2AIM A;  3HHI A;  1PPD A;  3OVX A;  1ME3 A;  2Y6E A;  2ATO A;  2HHN A;  2JQF R;  3F5V A;  1EWO A;  2DC9 A;  2FTD A;  2JQG R;  2VFB A;  4PAD A;  4DMX A;  4CZW A;  4FIP A;  3QJ3 A;  1IWD A;  4OEL A;  1NQC A;  3MHH A;  4I04 A;  2AYO A;  3KFQ A;  2ACT A;  2R9M A;  1ZIV A;  2E01 A;  1NL6 A;  3HWN A;  1BQI A;  1PPO A;  4RY2 A;  2R9F A;  1AU4 A;  4MZO A;  1E2T A;  1HUC B;  1AYU A;  3K9M A;  5J94 A;  1F2B A;  4BQV A;  1F2A A;  3H7D A;  3S3R A;  1W4T A;  2BDZ A;  1SP4 B;  4YYS A;  3KW9 A;  3IOQ A;  1EWL A;  3P5V A;  3RVX A;  1AIM A;  3N4C A;  1PPP A;  1MDW A;  5FPW A;  1CTE A;  3BC3 A;  1QXP A;  2YJ9 A;  5EGW A;  3D6S A;  3U8E A;  3S3Q A;  3I3T A;  1GLO A;  2R9O A;  3KWZ A;  2C0Y A;  4Q8H A;  3LFY A;  3IV2 A;  3LTW A;  2WBF X;  3HHA A;  1U9W A;  4FK5 A;  3IHP A;  3MHS A;  2P86 A;  1GMY A;  1TL9 A;  1O0E A;  2DCD A;  4N79 A;  4I05 A;  2H7J A;  3OF9 A;  4BPV A;  3WXG A;  4AXM A;  5CVO B;  2BSZ A;  2G7Y A;  4QRX A;  4PI3 A;  1GCB A;  2DCB A;  1CPJ A;  3IEJ A;  4W5B A;  1ME4 A;  1A6R A;  4Q8G A;  2AVW A;  3HD3 A;  4YYU A;  2DJF B;  2PAD A;  4NV7 A;  1W6F A;  2XU1 A;  1U9X A;  1PPN A;  4YYV A;  2G8J A;  3I06 A;  5CHT A;  2VHS A;  2CIO A;  3CH3 X;  4CDF B;  4CDC B;  2NQD B;  3USV A;  1YK8 A;  2ARY A;  1U9V A;  1NLJ A;  1W5R A;  3V6C A;  1FH0 A;  2AUZ A;  1EWM A;  2IPP B;  4WA6 A;  5A24 A;  2PNS A;  1ITO A;  1CS8 A;  4HWY A;  2OZ2 A;  2AS8 A;  4BGF A;  3BOW A;  3OF8 A;  2YJ8 A;  1THE A;  1KHP A;  2B1M A;  4X6J A;  3OVZ A;  4B55 A;  1CQD A;  9PAP A;  4BSQ A;  4KLB A;  3WXF A;  1QMY A;  1Y08 A;  4W4U A;  2HH5 A;  2FRQ A;  4CDD B;  2G8E A;  3F75 A;  3GCB A;  3KWB X;  3PDF A;  4XUI A;  1PXV A;  4QRV A;  4BS6 A;  1ZCM A;  4YVA A;  2DZY A;  1KFU L;  4P6G A;  4QRG A;  3E1Z B;  3ERV A;  1SNK A;  3N3G A;  1BP4 A;  1AU2 A;  1AU3 A;  3KSE A;  1AU0 A;  1Y4H A;  1QDQ A;  3IUT A;  3LXS A;  3D9W A;  1CV8 A;  2YJB A;  1CJL A;  3MOR A;  2YJC A;  2PRE A;  2BDL A;  2FRA A;  1KXR A;  2IBI A;  3BWK A;  4PP1 A;  2DC8 A;  2FYE A;  3QT4 A;  2AYN A;  2O6X A;  2FT2 A;  3KKU A;  3WXE A;  2NQI A;  3PNR A;  3H8C A;  1GX3 A;  1U9Q X;  3P5X A;  4OEM A;  1MEM A;  1NB3 A;  3NHE A;  4P6E A;  3M99 A;  3MTN A;  1KHQ A;  1MHW A;  2E02 A;  1JQP A;  2F1G A;  3KX1 A;  3TNX A;  1PBH A;  3OIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...