2DC9A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca074me complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
molecule keywords CATHEPSIN B
total genus 78
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc9A00
5JH3A 2HHNA 1CJLA 4BSQA 2ARYA 3C9EA 1IWDA 2BDZA 1PXVA 3KSEA 3ERVA 3H8BA 2XU1A 3DF0A 4CDDB 1BQIA 5EGWA 3CBJA 1PPDA 1ZIVA 3RVWA 3MORA 5JA7A 2DCDA 4DMXA 1MIRA 2B1MA 1F2CA 2AUXA 3N3KA 4N79A 4BPVA 2R9NA 3TNXA 1CB5A 1POPA 3O0UA 1YVBA 3HD3A 2NQAA 3WXGA 1AU0A 1U9VA 4PI3A 2OP3A 3CH2X 1PE6A 3P5WA 5CVNB 4YYRA 4YYVA 2G8EA 1KHPA 3V6EA 3N4CA 3BCNA 1F2AA 1CV8A 5EF4A 4XR7A 6PADA 1CTEA 1PADA 1GLOA 3LFYA 3IV2A 4PP1A 3H89A 2C0YA 2R9CA 2AYOA 1GCBA 4RY2A 1AYVA 2YJ2A 1EWLA 3MHHA 1EF7A 3IMAA 2OULA 1XKGA 1KFXL 3BPFA 4Q8HA 2XU4A 3QSDA 4FK5A 2PADA 4BQVA 3BC3A 1PBHA 1DF0A 3WXFA 4ZUXU 3IHPA 2AVWA 5K16A 5CVOB 2E00A 1TLOA 4BS5A 3B79A 3K24A 4MSXA 1AU4A 1JQPA 2ACTA 2BDLA 3OVZA 2VHSA 3RVVA 2AIMA 1MDWA 3MTNA 2NQDB 1PPOA 4N4ZA 3IEJA 1EWOA 4AXLA 4DMYA 1FH0A 2XU3A 2G6DA 9PAPA 3USVA 5A24A 1QDQA 1YT7A 1NLJA 3KWBX 1QMYA 1U9WA 3P5UA 4YYWA 1O0EA 2F1GA 1MEGA 2CIOA 2FO5A 2AYNA 1AIMA 2DJFB 1PPNA 4KLBA 1NB3A 4YVAA 4YYUA 2GFOA 4CDEB 4PP2E 2AUZA 2XU5A 3QJ3A 2FRAA 4FIPA 3S3QA 5CHVA 3OF8A 2NQIA 4I07A 2FUDA 1STFE 4PADA 1K3BB 2Y6EA 4X6HA 3PBHA 1NL6A 4CZWA 1ICFA 3F75A 4QRVA 3GCBA 2F7DA 2P86A 2YJBA 2E03A 1CQDA 4YYQA 4G54A 3U8EA 4YV8A 3D6SA 3ZUAA 1DEUA 2R6NA 1TU6A 3KFQA 2HXZA 2O6XA 3OISA 1KHQA 3KWZA 3HWNA 1YK8A 3NHEA 1YALA 1GMYA 1Y4HA 4FJCA 4QH6A 2DCCA 3AI8A 4P6EA 2R9OA 1GECE 1M6DA 1VJVA 2WBFX 2YJCA 3KW9A 3QT4A 5J94A 2CB5A 3PW3A 5FPWA 1PPPA 1MHWA 4CDFB 1QOLA 1BGOA 1CSBB 2PBHA 1AU2A 2FRQA 1EWMA 1ZCMA 1CS8A 1Y08A 1ME3A 1AU3A 1CPJA 2HD5A 3OF9A 3KX1A 4I04A 1HUCB 3K9MA 4OELA 2YJ8A 7PCKA 1NQCA 2JQGR 2PNSA 2NQGA 4W5CA 1F29A 1TL9A 5CHTA 3K8UA 3S3RA 1Q6KA 1PCIA 3RVXA 1NPZA 2GHUA 4MZSA 4WA6A 2P0RA 3WXEA 2Y5BA 1X9YA 1AECA 1SP4B 1BP4A 3IUTA 2P7UA 3I06A 5F02A 3N3GA 1KXRA 1U9XA 3BOWA 3H7DA 1AYWA 3H6SA 1MEMA 1BY8A 2R9MA 4P6GA 2IPPB 5CVMA 2DC7A 3H8CA 4AXMA 4CDCB 4W4UA 1ME4A 3HHIA 2DC8A 3MHSA 1AYUA 2R9FA 2AS8A 1ATKA 3E1ZB 2DZZA 2YJ9A 3BWKA 1QXPA 3I3TA 3PDFA 2DJGB 4YYSA 2FTDA 3V6CA 1THEA 1KFUL 3CH3X 4MZOA 3O1GA 2E01A 4K7CA 2B1NA 2DC9A 3PNRA 2VHFA 2G7YA 3OVXA 2FQ9A 2DZYA 1EWPA 2HH5A 2DCBA 2AU1A 2ATOA 1YK7A 4QRGA 4QRXA 4BS6A 4HWYA 4Q8GA 2OZ2A 1S4VA 3F5VA 1F2BA 1SNKA 3P5VA 5PADA 2FT2A 3HHAA 2JQFR 3CBKA 2H7JA 4N8WA 3M99A 4QBBA 1MS6A 1U9QX 2G8JA 2FYEA 4OEMA 2DCAA 3LXSA 4I05A 8PCHA 4X6IA 1PIPA 1ITOA 1VSNA 2DC6A 4XUIA 3IOQA 3BPMA 4X6JA 3P5XA 2E02A 2PREA 1NB5A 1A6RA 1CVZA 3KKUA 4W5BA 1U5IA 2IBIA
chains in the Genus database with same CATH superfamily
5E6JA 5JH3A 2HHNA 1CJLA 4BSQA 2ARYA 3C9EA 1IWDA 2BDZA 1PXVA 3KSEA 3ERVA 1PVJA 3H8BA 2XU1A 3DF0A 3ZNHA 3PHXA 4CDDB 1BQIA 4D8BA 5EGWA 3CBJA 1PPDA 3MTVA 1ZIVA 4BOQA 3RVWA 3MORA 5JA7A 2DCDA 4DMXA 1UKFA 1MIRA 2B1MA 1F2CA 2AUXA 3N3KA 4N79A 4BPVA 2R9NA 3TNXA 1CB5A 1POPA 4A5UA 3O0UA 1YVBA 3HD3A 2NQAA 3WXGA 1AU0A 1U9VA 4PI3A 2OP3A 3CH2X 1PE6A 3PRPA 3P5WA 5CVNB 4YYRA 4YYVA 2G8EA 4RF1A 2HWKA 1KHPA 3V6EA 3N4CA 3BCNA 4D8IA 1F2AA 1CV8A 5EF4A 4XR7A 4MI7A 6PADA 3PHUA 1CTEA 1PADA 1GLOA 3LFYA 2AGAA 3IV2A 4PP1A 3H89A 2C0YA 2R9CA 2AYOA 1GCBA 4OW0A 4RY2A 1AYVA 2YJ2A 1EWLA 3MHHA 1EF7A 3IMAA 3W30A 2OULA 1XKGA 1KFXL 3MP2A 3BPFA 4Q8HA 2XU4A 4BOPA 3QSDA 4FK5A 2PADA 4BQVA 3BC3A 1PBHA 1DF0A 3WXFA 4ZUXU 3IHPA 2AVWA 5K16A 5CVOB 2E00A 1TLOA 4BS5A 3B79A 3K24A 4MSXA 1AU4A 1JQPA 2ACTA 2BDLA 3OVZA 2VHSA 3RVVA 2AIMA 1MDWA 3MTNA 3BB7A 2NQDB 1PPOA 4N4ZA 3IEJA 1EWOA 4AXLA 4DMYA 1FH0A 2XU3A 2G6DA 4RF0A 9PAPA 4XZXA 3USVA 5A24A 1QDQA 1YT7A 1NLJA 3KWBX 3C0RA 3TMPA 1QMYA 1U9WA 3P5UA 4YYWA 1O0EA 2F1GA 1MEGA 2CIOA 2FO5A 2AYNA 5KO3A 1AIMA 2DJFB 1PPNA 4KLBA 1NB3A 4YVAA 4YYUA 2GFOA 4CDEB 4PP2E 2AUZA 2XU5A 3QJ3A 2FRAA 4FIPA 3S3QA 5CHVA 3OF8A 2BTWA 2NQIA 4I07A 2FUDA 1STFE 4PADA 1K3BB 2Y6EA 4X6HA 3PBHA 1NL6A 4CZWA 1ICFA 3F75A 4QRVA 3GCBA 2FE8A 2F7DA 2P86A 1YZBA 3RNVA 2YJBA 2E03A 1CQDA 4YYQA 4BOSA 2JTCA 4G54A 3BY4A 3U8EA 4YV8A 3D6SA 3ZUAA 1DEUA 2R6NA 2J7QA 4IUMA 1TU6A 3KFQA 2HXZA 2O6XA 4HXDB 3OISA 1KHQA 3KWZA 4IP3A 3HWNA 1YK8A 3NHEA 1YALA 1GMYA 2UZJA 1Y4HA 4FJCA 4QH6A 2DCCA 3AI8A 4P6EA 2R9OA 1GECE 1M6DA 2DOSA 1VJVA 2WBFX 2YJCA 3KW9A 3QT4A 5J94A 2CB5A 3PW3A 3O65A 5FPWA 4M0WA 1PPPA 1MHWA 4CDFB 4R3DA 1QOLA 4P16A 1BGOA 2J7QC 1CSBB 3W31A 4REZA 2PBHA 1AU2A 2FRQA 4WURA 1EWMA 1ZCMA 1CS8A 1Y08A 1ME3A 4ZTBA 1AU3A 1CPJA 2HD5A 3OF9A 2JRIA 3KX1A 4I04A 1HUCB 3K9MA 4OELA 2YJ8A 7PCKA 1NQCA 2JQGR 2PNSA 2NQGA 4W5CA 1F29A 1TL9A 5CHTA 3K8UA 4GUAA 3S3RA 1Q6KA 1PCIA 3RVXA 1NPZA 2GHUA 4MZSA 4PT5A 4WA6A 2P0RA 3WXEA 4OVZB 3PT2A 2Y5BA 1X9YA 1AECA 1BP4A 1SP4B 3IUTA 2P7UA 3I06A 4OVZA 5F02A 3N3GA 1KXRA 1U9XA 3BOWA 3H7DA 1AYWA 3H6SA 2BU3A 1MEMA 4D8EA 3PHWA 1BY8A 2R9MA 4P6GA 2IPPB 5CVMA 2DC7A 3H8CA 4AXMA 4CDCB 3MHSA 1ME4A 3HHIA 2DC8A 4W4UA 3B21A 1AYUA 2R9FA 2AS8A 1ATKA 3E1ZB 2DZZA 2YJ9A 3BWKA 1QXPA 3I3TA 3PSEA 3PDFA 2DJGB 4YYSA 2FTDA 3BBAA 3V6CA 1THEA 1KFUL 3CH3X 4MZOA 3O1GA 2E01A 4BOZA 3OQCA 4K7CA 2B1NA 2DC9A 3PNRA 4RKXA 4MM3B 2VHFA 2G7YA 3OVXA 2FQ9A 1DKIA 1EWPA 2DZYA 2HH5A 2DCBA 2AU1A 2ATOA 1YK7A 4QRGA 4QRXA 4BS6A 5JZEA 4HWYA 4Q8GA 2Z84A 2OZ2A 1S4VA 3F5VA 1F2BA 1SNKA 3P5VA 5PADA 3TRKA 3PRMA 2FT2A 3HHAA 2JQFR 2BTWB 4RNAA 3CBKA 2H7JA 4N8WA 3M99A 4QBBA 1MS6A 1U9QX 2G8JA 2FYEA 4BOUA 4OEMA 2DCAA 3LXSA 5EZQA 4I05A 3IFUA 8PCHA 4X6IA 1PIPA 1ITOA 1VSNA 2DC6A 4XUIA 3IOQA 3BPMA 4X6JA 3P5XA 2E02A 3E9SA 2PREA 1NB5A 1A6RA 1CVZA 5EZSA 3KKUA 4W5BA 1U5IA 2IBIA 3MJ5A
chains in the Genus database with same CATH topology
5JH3A 2HHNA 1CJLA 4BSQA 2ARYA 3C9EA 1IWDA 2BDZA 1PXVA 3KSEA 3ERVA 3H8BA 2XU1A 3DF0A 4CDDB 1BQIA 5EGWA 3CBJA 1PPDA 1ZIVA 3RVWA 3MORA 5JA7A 2DCDA 4DMXA 1MIRA 2B1MA 1F2CA 2AUXA 4NV7A 3N3KA 4N79A 4BPVA 2R9NA 3TNXA 1CB5A 1POPA 3O0UA 1YVBA 3HD3A 2NQAA 3WXGA 1AU0A 1U9VA 4GUZA 4PI3A 2OP3A 3CH2X 1PE6A 3P5WA 5CVNB 4YYRA 4YYVA 2G8EA 1KHPA 3V6EA 3N4CA 3BCNA 1F2AA 1CV8A 5EF4A 4XR7A 6PADA 1CTEA 1PADA 1GLOA 3LFYA 3IV2A 4PP1A 3H89A 2C0YA 2R9CA 2AYOA 1GCBA 4RY2A 1AYVA 2YJ2A 1EWLA 3MHHA 1EF7A 3IMAA 2OULA 1E2TA 1XKGA 1KFXL 3BPFA 4Q8HA 2XU4A 3QSDA 4NV8A 2VFCA 4FK5A 2PADA 4BQVA 3BC3A 1PBHA 1DF0A 3WXFA 4ZUXU 3IHPA 2AVWA 5K16A 5CVOB 2E00A 1TLOA 4BS5A 3B79A 3K24A 4MSXA 1AU4A 1JQPA 2ACTA 2BDLA 3OVZA 2VHSA 3RVVA 2AIMA 1MDWA 3MTNA 1W5RA 2NQDB 1PPOA 4N4ZA 3IEJA 1EWOA 4AXLA 4DMYA 1FH0A 4B55A 2XU3A 2G6DA 9PAPA 3USVA 5A24A 1QDQA 1YT7A 1NLJA 3KWBX 1QMYA 1U9WA 3P5UA 4YYWA 1O0EA 2F1GA 1MEGA 2CIOA 2FO5A 2AYNA 1AIMA 2DJFB 1PPNA 4KLBA 1NB3A 4YVAA 4YYUA 2GFOA 4CDEB 4PP2E 2AUZA 2XU5A 3QJ3A 2FRAA 4FIPA 3S3QA 5CHVA 3OF8A 2NQIA 2VFBA 4I07A 2FUDA 1STFE 4PADA 1K3BB 2Y6EA 4X6HA 3PBHA 2BSZA 1NL6A 4CZWA 1ICFA 3F75A 4QRVA 3GCBA 2F7DA 2P86A 2YJBA 2E03A 1CQDA 4YYQA 4G54A 3U8EA 4YV8A 3D6SA 3ZUAA 1DEUA 2R6NA 1TU6A 3KFQA 2HXZA 2O6XA 3OISA 1KHQA 1W6FA 3KWZA 3HWNA 1YK8A 3NHEA 1YALA 1GMYA 3LTWA 1Y4HA 4FJCA 4QH6A 2DCCA 3AI8A 4P6EA 2R9OA 1GECE 1M6DA 1VJVA 2WBFX 2YJCA 3KW9A 3QT4A 5J94A 2CB5A 4BGFA 3PW3A 5FPWA 3D9WA 1PPPA 1MHWA 4CDFB 1QOLA 1BGOA 1CSBB 2PBHA 1AU2A 2FRQA 1EWMA 1ZCMA 1CS8A 1Y08A 1ME3A 1AU3A 1CPJA 2HD5A 3OF9A 3KX1A 1GX3A 4I04A 1HUCB 3K9MA 4OELA 2YJ8A 7PCKA 1NQCA 2JQGR 2PNSA 2NQGA 4W5CA 1F29A 1TL9A 5CHTA 3K8UA 3S3RA 1Q6KA 1PCIA 3RVXA 1NPZA 2GHUA 4MZSA 4WA6A 2P0RA 3WXEA 2Y5BA 1X9YA 1AECA 1BP4A 1SP4B 3IUTA 2P7UA 3I06A 5F02A 3N3GA 1KXRA 1U9XA 3BOWA 3H7DA 1AYWA 3H6SA 4C5PA 1MEMA 1BY8A 2R9MA 4P6GA 2IPPB 5CVMA 2DC7A 3H8CA 4AXMA 4CDCB 4W4UA 3MHSA 1ME4A 2DC8A 3HHIA 1AYUA 2R9FA 2AS8A 1ATKA 3E1ZB 2DZZA 2YJ9A 3BWKA 1QXPA 3I3TA 3PDFA 2DJGB 4YYSA 2FTDA 3V6CA 1THEA 1KFUL 3CH3X 4MZOA 3O1GA 2E01A 4K7CA 2B1NA 2DC9A 3PNRA 2VHFA 2G7YA 3OVXA 2FQ9A 2DZYA 1EWPA 2HH5A 2DCBA 2AU1A 2ATOA 1YK7A 4QRGA 4QRXA 4BS6A 4HWYA 4Q8GA 2OZ2A 1S4VA 3F5VA 1F2BA 1SNKA 3P5VA 5PADA 2FT2A 3HHAA 2JQFR 3CBKA 2H7JA 4N8WA 1W4TA 3M99A 4QBBA 1MS6A 1U9QX 2G8JA 2FYEA 4OEMA 2DCAA 3LXSA 4I05A 8PCHA 4X6IA 1PIPA 1ITOA 1VSNA 2DC6A 4XUIA 3IOQA 3BPMA 4X6JA 3P5XA 2E02A 2PREA 1NB5A 1A6RA 1CVZA 3KKUA 4W5BA 1U5IA 2IBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JH3 A;  2HHN A;  1CJL A;  4BSQ A;  2ARY A;  3C9E A;  1IWD A;  2BDZ A;  1PXV A;  3KSE A;  3ERV A;  3H8B A;  2XU1 A;  3DF0 A;  4CDD B;  1BQI A;  5EGW A;  3CBJ A;  1PPD A;  1ZIV A;  3RVW A;  3MOR A;  5JA7 A;  2DCD A;  4DMX A;  1MIR A;  2B1M A;  1F2C A;  2AUX A;  3N3K A;  4N79 A;  4BPV A;  2R9N A;  3TNX A;  1CB5 A;  1POP A;  3O0U A;  1YVB A;  3HD3 A;  2NQA A;  3WXG A;  1AU0 A;  1U9V A;  4PI3 A;  2OP3 A;  3CH2 X;  1PE6 A;  3P5W A;  5CVN B;  4YYR A;  4YYV A;  2G8E A;  1KHP A;  3V6E A;  3N4C A;  3BCN A;  1F2A A;  1CV8 A;  5EF4 A;  4XR7 A;  6PAD A;  1CTE A;  1PAD A;  1GLO A;  3LFY A;  3IV2 A;  4PP1 A;  3H89 A;  2C0Y A;  2R9C A;  2AYO A;  1GCB A;  4RY2 A;  1AYV A;  2YJ2 A;  1EWL A;  3MHH A;  1EF7 A;  3IMA A;  2OUL A;  1XKG A;  1KFX L;  3BPF A;  4Q8H A;  2XU4 A;  3QSD A;  4FK5 A;  2PAD A;  4BQV A;  3BC3 A;  1PBH A;  1DF0 A;  3WXF A;  4ZUX U;  3IHP A;  2AVW A;  5K16 A;  5CVO B;  2E00 A;  1TLO A;  4BS5 A;  3B79 A;  3K24 A;  4MSX A;  1AU4 A;  1JQP A;  2ACT A;  2BDL A;  3OVZ A;  2VHS A;  3RVV A;  2AIM A;  1MDW A;  3MTN A;  2NQD B;  1PPO A;  4N4Z A;  3IEJ A;  1EWO A;  4AXL A;  4DMY A;  1FH0 A;  2XU3 A;  2G6D A;  9PAP A;  3USV A;  5A24 A;  1QDQ A;  1YT7 A;  1NLJ A;  3KWB X;  1QMY A;  1U9W A;  3P5U A;  4YYW A;  1O0E A;  2F1G A;  1MEG A;  2CIO A;  2FO5 A;  2AYN A;  1AIM A;  2DJF B;  1PPN A;  4KLB A;  1NB3 A;  4YVA A;  4YYU A;  2GFO A;  4CDE B;  4PP2 E;  2AUZ A;  2XU5 A;  3QJ3 A;  2FRA A;  4FIP A;  3S3Q A;  5CHV A;  3OF8 A;  2NQI A;  4I07 A;  2FUD A;  1STF E;  4PAD A;  1K3B B;  2Y6E A;  4X6H A;  3PBH A;  1NL6 A;  4CZW A;  1ICF A;  3F75 A;  4QRV A;  3GCB A;  2F7D A;  2P86 A;  2YJB A;  2E03 A;  1CQD A;  4YYQ A;  4G54 A;  3U8E A;  4YV8 A;  3D6S A;  3ZUA A;  1DEU A;  2R6N A;  1TU6 A;  3KFQ A;  2HXZ A;  2O6X A;  3OIS A;  1KHQ A;  3KWZ A;  3HWN A;  1YK8 A;  3NHE A;  1YAL A;  1GMY A;  1Y4H A;  4FJC A;  4QH6 A;  2DCC A;  3AI8 A;  4P6E A;  2R9O A;  1GEC E;  1M6D A;  1VJV A;  2WBF X;  2YJC A;  3KW9 A;  3QT4 A;  5J94 A;  2CB5 A;  3PW3 A;  5FPW A;  1PPP A;  1MHW A;  4CDF B;  1QOL A;  1BGO A;  1CSB B;  2PBH A;  1AU2 A;  2FRQ A;  1EWM A;  1ZCM A;  1CS8 A;  1Y08 A;  1ME3 A;  1AU3 A;  1CPJ A;  2HD5 A;  3OF9 A;  3KX1 A;  4I04 A;  1HUC B;  3K9M A;  4OEL A;  2YJ8 A;  7PCK A;  1NQC A;  2JQG R;  2PNS A;  2NQG A;  4W5C A;  1F29 A;  1TL9 A;  5CHT A;  3K8U A;  3S3R A;  1Q6K A;  1PCI A;  3RVX A;  1NPZ A;  2GHU A;  4MZS A;  4WA6 A;  2P0R A;  3WXE A;  2Y5B A;  1X9Y A;  1AEC A;  1SP4 B;  1BP4 A;  3IUT A;  2P7U A;  3I06 A;  5F02 A;  3N3G A;  1KXR A;  1U9X A;  3BOW A;  3H7D A;  1AYW A;  3H6S A;  1MEM A;  1BY8 A;  2R9M A;  4P6G A;  2IPP B;  5CVM A;  2DC7 A;  3H8C A;  4AXM A;  4CDC B;  4W4U A;  1ME4 A;  3HHI A;  2DC8 A;  3MHS A;  1AYU A;  2R9F A;  2AS8 A;  1ATK A;  3E1Z B;  2DZZ A;  2YJ9 A;  3BWK A;  1QXP A;  3I3T A;  3PDF A;  2DJG B;  4YYS A;  2FTD A;  3V6C A;  1THE A;  1KFU L;  3CH3 X;  4MZO A;  3O1G A;  2E01 A;  4K7C A;  2B1N A;  2DC9 A;  3PNR A;  2VHF A;  2G7Y A;  3OVX A;  2FQ9 A;  2DZY A;  1EWP A;  2HH5 A;  2DCB A;  2AU1 A;  2ATO A;  1YK7 A;  4QRG A;  4QRX A;  4BS6 A;  4HWY A;  4Q8G A;  2OZ2 A;  1S4V A;  3F5V A;  1F2B A;  1SNK A;  3P5V A;  5PAD A;  2FT2 A;  3HHA A;  2JQF R;  3CBK A;  2H7J A;  4N8W A;  3M99 A;  4QBB A;  1MS6 A;  1U9Q X;  2G8J A;  2FYE A;  4OEM A;  2DCA A;  3LXS A;  4I05 A;  8PCH A;  4X6I A;  1PIP A;  1ITO A;  1VSN A;  2DC6 A;  4XUI A;  3IOQ A;  3BPM A;  4X6J A;  3P5X A;  2E02 A;  2PRE A;  1NB5 A;  1A6R A;  1CVZ A;  3KKU A;  4W5B A;  1U5I A;  2IBI A; 
#chains in the Genus database with same CATH topology
 5E6J A;  5JH3 A;  2HHN A;  1CJL A;  4BSQ A;  2ARY A;  3C9E A;  1IWD A;  2BDZ A;  1PXV A;  3KSE A;  3ERV A;  1PVJ A;  3H8B A;  2XU1 A;  3DF0 A;  3ZNH A;  3PHX A;  4CDD B;  1BQI A;  4D8B A;  5EGW A;  3CBJ A;  1PPD A;  3MTV A;  1ZIV A;  4BOQ A;  3RVW A;  3MOR A;  5JA7 A;  2DCD A;  4DMX A;  1UKF A;  1MIR A;  2B1M A;  1F2C A;  2AUX A;  3N3K A;  4N79 A;  4BPV A;  2R9N A;  3TNX A;  1CB5 A;  1POP A;  4A5U A;  3O0U A;  1YVB A;  3HD3 A;  2NQA A;  3WXG A;  1AU0 A;  1U9V A;  4PI3 A;  2OP3 A;  3CH2 X;  1PE6 A;  3PRP A;  3P5W A;  5CVN B;  4YYR A;  4YYV A;  2G8E A;  4RF1 A;  2HWK A;  1KHP A;  3V6E A;  3N4C A;  3BCN A;  4D8I A;  1F2A A;  1CV8 A;  5EF4 A;  4XR7 A;  4MI7 A;  6PAD A;  3PHU A;  1CTE A;  1PAD A;  1GLO A;  3LFY A;  2AGA A;  3IV2 A;  4PP1 A;  3H89 A;  2C0Y A;  2R9C A;  2AYO A;  1GCB A;  4OW0 A;  4RY2 A;  1AYV A;  2YJ2 A;  1EWL A;  3MHH A;  1EF7 A;  3IMA A;  3W30 A;  2OUL A;  1XKG A;  1KFX L;  3MP2 A;  3BPF A;  4Q8H A;  2XU4 A;  4BOP A;  3QSD A;  4FK5 A;  2PAD A;  4BQV A;  3BC3 A;  1PBH A;  1DF0 A;  3WXF A;  4ZUX U;  3IHP A;  2AVW A;  5K16 A;  5CVO B;  2E00 A;  1TLO A;  4BS5 A;  3B79 A;  3K24 A;  4MSX A;  1AU4 A;  1JQP A;  2ACT A;  2BDL A;  3OVZ A;  2VHS A;  3RVV A;  2AIM A;  1MDW A;  3MTN A;  3BB7 A;  2NQD B;  1PPO A;  4N4Z A;  3IEJ A;  1EWO A;  4AXL A;  4DMY A;  1FH0 A;  2XU3 A;  2G6D A;  4RF0 A;  9PAP A;  4XZX A;  3USV A;  5A24 A;  1QDQ A;  1YT7 A;  1NLJ A;  3KWB X;  3C0R A;  3TMP A;  1QMY A;  1U9W A;  3P5U A;  4YYW A;  1O0E A;  2F1G A;  1MEG A;  2CIO A;  2FO5 A;  2AYN A;  5KO3 A;  1AIM A;  2DJF B;  1PPN A;  4KLB A;  1NB3 A;  4YVA A;  4YYU A;  2GFO A;  4CDE B;  4PP2 E;  2AUZ A;  2XU5 A;  3QJ3 A;  2FRA A;  4FIP A;  3S3Q A;  5CHV A;  3OF8 A;  2BTW A;  2NQI A;  4I07 A;  2FUD A;  1STF E;  4PAD A;  1K3B B;  2Y6E A;  4X6H A;  3PBH A;  1NL6 A;  4CZW A;  1ICF A;  3F75 A;  4QRV A;  3GCB A;  2FE8 A;  2F7D A;  2P86 A;  1YZB A;  3RNV A;  2YJB A;  2E03 A;  1CQD A;  4YYQ A;  4BOS A;  2JTC A;  4G54 A;  3BY4 A;  3U8E A;  4YV8 A;  3D6S A;  3ZUA A;  1DEU A;  2R6N A;  2J7Q A;  4IUM A;  1TU6 A;  3KFQ A;  2HXZ A;  2O6X A;  4HXD B;  3OIS A;  1KHQ A;  3KWZ A;  4IP3 A;  3HWN A;  1YK8 A;  3NHE A;  1YAL A;  1GMY A;  2UZJ A;  1Y4H A;  4FJC A;  4QH6 A;  2DCC A;  3AI8 A;  4P6E A;  2R9O A;  1GEC E;  1M6D A;  2DOS A;  1VJV A;  2WBF X;  2YJC A;  3KW9 A;  3QT4 A;  5J94 A;  2CB5 A;  3PW3 A;  3O65 A;  5FPW A;  4M0W A;  1PPP A;  1MHW A;  4CDF B;  4R3D A;  1QOL A;  4P16 A;  1BGO A;  2J7Q C;  1CSB B;  3W31 A;  4REZ A;  2PBH A;  1AU2 A;  2FRQ A;  4WUR A;  1EWM A;  1ZCM A;  1CS8 A;  1Y08 A;  1ME3 A;  4ZTB A;  1AU3 A;  1CPJ A;  2HD5 A;  3OF9 A;  2JRI A;  3KX1 A;  4I04 A;  1HUC B;  3K9M A;  4OEL A;  2YJ8 A;  7PCK A;  1NQC A;  2JQG R;  2PNS A;  2NQG A;  4W5C A;  1F29 A;  1TL9 A;  5CHT A;  3K8U A;  4GUA A;  3S3R A;  1Q6K A;  1PCI A;  3RVX A;  1NPZ A;  2GHU A;  4MZS A;  4PT5 A;  4WA6 A;  2P0R A;  3WXE A;  4OVZ B;  3PT2 A;  2Y5B A;  1X9Y A;  1AEC A;  1BP4 A;  1SP4 B;  3IUT A;  2P7U A;  3I06 A;  4OVZ A;  5F02 A;  3N3G A;  1KXR A;  1U9X A;  3BOW A;  3H7D A;  1AYW A;  3H6S A;  2BU3 A;  1MEM A;  4D8E A;  3PHW A;  1BY8 A;  2R9M A;  4P6G A;  2IPP B;  5CVM A;  2DC7 A;  3H8C A;  4AXM A;  4CDC B;  3MHS A;  1ME4 A;  3HHI A;  2DC8 A;  4W4U A;  3B21 A;  1AYU A;  2R9F A;  2AS8 A;  1ATK A;  3E1Z B;  2DZZ A;  2YJ9 A;  3BWK A;  1QXP A;  3I3T A;  3PSE A;  3PDF A;  2DJG B;  4YYS A;  2FTD A;  3BBA A;  3V6C A;  1THE A;  1KFU L;  3CH3 X;  4MZO A;  3O1G A;  2E01 A;  4BOZ A;  3OQC A;  4K7C A;  2B1N A;  2DC9 A;  3PNR A;  4RKX A;  4MM3 B;  2VHF A;  2G7Y A;  3OVX A;  2FQ9 A;  1DKI A;  1EWP A;  2DZY A;  2HH5 A;  2DCB A;  2AU1 A;  2ATO A;  1YK7 A;  4QRG A;  4QRX A;  4BS6 A;  5JZE A;  4HWY A;  4Q8G A;  2Z84 A;  2OZ2 A;  1S4V A;  3F5V A;  1F2B A;  1SNK A;  3P5V A;  5PAD A;  3TRK A;  3PRM A;  2FT2 A;  3HHA A;  2JQF R;  2BTW B;  4RNA A;  3CBK A;  2H7J A;  4N8W A;  3M99 A;  4QBB A;  1MS6 A;  1U9Q X;  2G8J A;  2FYE A;  4BOU A;  4OEM A;  2DCA A;  3LXS A;  5EZQ A;  4I05 A;  3IFU A;  8PCH A;  4X6I A;  1PIP A;  1ITO A;  1VSN A;  2DC6 A;  4XUI A;  3IOQ A;  3BPM A;  4X6J A;  3P5X A;  2E02 A;  3E9S A;  2PRE A;  1NB5 A;  1A6R A;  1CVZ A;  5EZS A;  3KKU A;  4W5B A;  1U5I A;  2IBI A;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 5JH3 A;  2HHN A;  1CJL A;  4BSQ A;  2ARY A;  3C9E A;  1IWD A;  2BDZ A;  1PXV A;  3KSE A;  3ERV A;  3H8B A;  2XU1 A;  3DF0 A;  4CDD B;  1BQI A;  5EGW A;  3CBJ A;  1PPD A;  1ZIV A;  3RVW A;  3MOR A;  5JA7 A;  2DCD A;  4DMX A;  1MIR A;  2B1M A;  1F2C A;  2AUX A;  4NV7 A;  3N3K A;  4N79 A;  4BPV A;  2R9N A;  3TNX A;  1CB5 A;  1POP A;  3O0U A;  1YVB A;  3HD3 A;  2NQA A;  3WXG A;  1AU0 A;  1U9V A;  4GUZ A;  4PI3 A;  2OP3 A;  3CH2 X;  1PE6 A;  3P5W A;  5CVN B;  4YYR A;  4YYV A;  2G8E A;  1KHP A;  3V6E A;  3N4C A;  3BCN A;  1F2A A;  1CV8 A;  5EF4 A;  4XR7 A;  6PAD A;  1CTE A;  1PAD A;  1GLO A;  3LFY A;  3IV2 A;  4PP1 A;  3H89 A;  2C0Y A;  2R9C A;  2AYO A;  1GCB A;  4RY2 A;  1AYV A;  2YJ2 A;  1EWL A;  3MHH A;  1EF7 A;  3IMA A;  2OUL A;  1E2T A;  1XKG A;  1KFX L;  3BPF A;  4Q8H A;  2XU4 A;  3QSD A;  4NV8 A;  2VFC A;  4FK5 A;  2PAD A;  4BQV A;  3BC3 A;  1PBH A;  1DF0 A;  3WXF A;  4ZUX U;  3IHP A;  2AVW A;  5K16 A;  5CVO B;  2E00 A;  1TLO A;  4BS5 A;  3B79 A;  3K24 A;  4MSX A;  1AU4 A;  1JQP A;  2ACT A;  2BDL A;  3OVZ A;  2VHS A;  3RVV A;  2AIM A;  1MDW A;  3MTN A;  1W5R A;  2NQD B;  1PPO A;  4N4Z A;  3IEJ A;  1EWO A;  4AXL A;  4DMY A;  1FH0 A;  4B55 A;  2XU3 A;  2G6D A;  9PAP A;  3USV A;  5A24 A;  1QDQ A;  1YT7 A;  1NLJ A;  3KWB X;  1QMY A;  1U9W A;  3P5U A;  4YYW A;  1O0E A;  2F1G A;  1MEG A;  2CIO A;  2FO5 A;  2AYN A;  1AIM A;  2DJF B;  1PPN A;  4KLB A;  1NB3 A;  4YVA A;  4YYU A;  2GFO A;  4CDE B;  4PP2 E;  2AUZ A;  2XU5 A;  3QJ3 A;  2FRA A;  4FIP A;  3S3Q A;  5CHV A;  3OF8 A;  2NQI A;  2VFB A;  4I07 A;  2FUD A;  1STF E;  4PAD A;  1K3B B;  2Y6E A;  4X6H A;  3PBH A;  2BSZ A;  1NL6 A;  4CZW A;  1ICF A;  3F75 A;  4QRV A;  3GCB A;  2F7D A;  2P86 A;  2YJB A;  2E03 A;  1CQD A;  4YYQ A;  4G54 A;  3U8E A;  4YV8 A;  3D6S A;  3ZUA A;  1DEU A;  2R6N A;  1TU6 A;  3KFQ A;  2HXZ A;  2O6X A;  3OIS A;  1KHQ A;  1W6F A;  3KWZ A;  3HWN A;  1YK8 A;  3NHE A;  1YAL A;  1GMY A;  3LTW A;  1Y4H A;  4FJC A;  4QH6 A;  2DCC A;  3AI8 A;  4P6E A;  2R9O A;  1GEC E;  1M6D A;  1VJV A;  2WBF X;  2YJC A;  3KW9 A;  3QT4 A;  5J94 A;  2CB5 A;  4BGF A;  3PW3 A;  5FPW A;  3D9W A;  1PPP A;  1MHW A;  4CDF B;  1QOL A;  1BGO A;  1CSB B;  2PBH A;  1AU2 A;  2FRQ A;  1EWM A;  1ZCM A;  1CS8 A;  1Y08 A;  1ME3 A;  1AU3 A;  1CPJ A;  2HD5 A;  3OF9 A;  3KX1 A;  1GX3 A;  4I04 A;  1HUC B;  3K9M A;  4OEL A;  2YJ8 A;  7PCK A;  1NQC A;  2JQG R;  2PNS A;  2NQG A;  4W5C A;  1F29 A;  1TL9 A;  5CHT A;  3K8U A;  3S3R A;  1Q6K A;  1PCI A;  3RVX A;  1NPZ A;  2GHU A;  4MZS A;  4WA6 A;  2P0R A;  3WXE A;  2Y5B A;  1X9Y A;  1AEC A;  1BP4 A;  1SP4 B;  3IUT A;  2P7U A;  3I06 A;  5F02 A;  3N3G A;  1KXR A;  1U9X A;  3BOW A;  3H7D A;  1AYW A;  3H6S A;  4C5P A;  1MEM A;  1BY8 A;  2R9M A;  4P6G A;  2IPP B;  5CVM A;  2DC7 A;  3H8C A;  4AXM A;  4CDC B;  4W4U A;  3MHS A;  1ME4 A;  2DC8 A;  3HHI A;  1AYU A;  2R9F A;  2AS8 A;  1ATK A;  3E1Z B;  2DZZ A;  2YJ9 A;  3BWK A;  1QXP A;  3I3T A;  3PDF A;  2DJG B;  4YYS A;  2FTD A;  3V6C A;  1THE A;  1KFU L;  3CH3 X;  4MZO A;  3O1G A;  2E01 A;  4K7C A;  2B1N A;  2DC9 A;  3PNR A;  2VHF A;  2G7Y A;  3OVX A;  2FQ9 A;  2DZY A;  1EWP A;  2HH5 A;  2DCB A;  2AU1 A;  2ATO A;  1YK7 A;  4QRG A;  4QRX A;  4BS6 A;  4HWY A;  4Q8G A;  2OZ2 A;  1S4V A;  3F5V A;  1F2B A;  1SNK A;  3P5V A;  5PAD A;  2FT2 A;  3HHA A;  2JQF R;  3CBK A;  2H7J A;  4N8W A;  1W4T A;  3M99 A;  4QBB A;  1MS6 A;  1U9Q X;  2G8J A;  2FYE A;  4OEM A;  2DCA A;  3LXS A;  4I05 A;  8PCH A;  4X6I A;  1PIP A;  1ITO A;  1VSN A;  2DC6 A;  4XUI A;  3IOQ A;  3BPM A;  4X6J A;  3P5X A;  2E02 A;  2PRE A;  1NB5 A;  1A6R A;  1CVZ A;  3KKU A;  4W5B A;  1U5I A;  2IBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...