3PHXA

Otu domain of crimean congo hemorrhagic fever virus in complex with isg15
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
b'GPMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVSDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
molecule tags Hydrolase/protein binding
source organism Crimean-congo hemorrhagic fever virus
publication title Molecular basis for ubiquitin and ISG15 cross-reactivity in viral ovarian tumor domains.
pubmed doi rcsb
total genus 48
structure length 162
sequence length 164
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3phxA00
4BOSA 4BOZA 4BOUA 3BY4A 3PRMA 5JZEA 3C0RA 3PRPA 4BOQA 3PHXA 4HXDB 3PSEA 3PHUA 3PT2A 4BOPA 3TMPA 3PHWA 3ZNHA
chains in the Genus database with same CATH superfamily
1CTEA 1UKFA 3P5XA 1O0EA 3HD3A 3RVVA 1AYVA 1DKIA 1NLJA 4HXDB 2IPPB 3PDFA 4G54A 1KXRA 4WURA 3S3RA 4BOSA 1DF0A 3K24A 1ZIVA 2CIOA 3OVXA 2FE8A 1BY8A 4MZSA 2J7QC 1QDQA 2XU3A 4RY2A 2J7QA 4N79A 2DC7A 2R9MA 4D8EA 2BTWB 3OISA 2FO5A 3NHEA 1CPJA 1CS8A 4WA6A 3H6SA 3DF0A 2NQIA 1U9WA 2P7UA 2DC9A 2DCCA 3P5VA 4MI7A 1S4VA 3IEJA 4AXMA 1MHWA 2XU4A 1ATKA 1CB5A 4W4UA 5EZSA 3BY4A 1THEA 4P6GA 2F7DA 2NQGA 2AGAA 2ATOA 3QSDA 6PADA 1TL9A 1F29A 1PPOA 5FPWA 2FYEA 3V6EA 3OF9A 1QOLA 2E00A 3HHIA 3MORA 3HHAA 5EF4A 4I04A 4CZWA 3K9MA 2JTCA 2JQFR 5EGWA 4YVAA 2WBFX 4MSXA 2AUXA 1GECE 4X6IA 1ME3A 3P5UA 4X6HA 3AI8A 2AS8A 2NQAA 4BPVA 1MS6A 4Q8GA 5EZQA 1YVBA 3D6SA 2P0RA 3IFUA 2F1GA 1VJVA 1NB3A 2R6NA 2DZZA 2OP3A 4QH6A 1CSBB 1YALA 2BTWA 3IOQA 3BCNA 1AU2A 3M99A 2P86A 3IUTA 3N3KA 3O65A 1GCBA 3BB7A 3WXEA 2B1NA 5KO3A 2R9OA 3WXFA 1MIRA 1PCIA 1Y08A 3RVXA 3E1ZB 1U9QX 2HD5A 4DMXA 3O0UA 2YJ8A 1KFXL 5E6JA 2Y5BA 1BP4A 3KWBX 4FIPA 2UZJA 1YZBA 3KW9A 4D8IA 1MEGA 2BDZA 1EWMA 1DEUA 3OQCA 3BBAA 2OULA 1TLOA 1NL6A 3ZUAA 1MEMA 2YJCA 5K16A 3PSEA 1NB5A 1F2CA 3CH2X 2OZ2A 1CVZA 1PIPA 1AIMA 3N3GA 3BPFA 1STFE 4QRXA 1KHQA 4FK5A 4IP3A 2XU1A 4BOQA 2BU3A 1KFUL 1JQPA 2PADA 4PADA 4XR7A 4YYUA 4HWYA 8PCHA 3K8UA 1Y4HA 4BS6A 1CV8A 4P6EA 2YJ2A 2FRQA 1QMYA 2AYNA 2FUDA 1XKGA 1BQIA 4YYQA 4YYRA 5CHTA 3C0RA 5CVNB 2AUZA 4W5BA 2FT2A 4Q8HA 3BC3A 3CH3X 2DCAA 1PPDA 3F75A 1AYWA 3H7DA 3N4CA 4BOPA 1AU4A 3PHWA 5CVMA 1ME4A 3GCBA 4QRVA 9PAPA 4W5CA 2GFOA 3TRKA 1TU6A 1ICFA 2DCBA 1KHPA 2FRAA 4QRGA 1F2BA 4ZTBA 1IWDA 3MHHA 3USVA 3P5WA 3OF8A 2HWKA 3PBHA 1PPNA 4YV8A 4D8BA 1PBHA 4OVZB 2NQDB 2DZYA 4YYWA 1SNKA 4PI3A 2AYOA 2DJGB 4RF1A 3IMAA 1EF7A 2B1MA 4GUAA 3I06A 4N4ZA 4BS5A 2FQ9A 3TNXA 1AYUA 2YJ9A 1GMYA 3I3TA 3B79A 3ZNHA 5F02A 4MZOA 2R9FA 1SP4B 1EWLA 1A6RA 2H7JA 4CDDB 4YYVA 3CBKA 3MTNA 4OW0A 2AIMA 2DC8A 2AVWA 3BWKA 1YK8A 4DMYA 3S3QA 5JA7A 1GLOA 3U8EA 4IUMA 5J94A 2C0YA 4CDFB 2BDLA 3LFYA 3QJ3A 2E02A 2G8JA 4P16A 3BOWA 2G6DA 4OVZA 4PP1A 4REZA 2DJFB 4QBBA 2Y6EA 3KFQA 1K3BB 3H8CA 3KX1A 4KLBA 2ACTA 3RNVA 1POPA 2E01A 3O1GA 4ZUXU 4XUIA 2HH5A 1Q6KA 3H89A 3BPMA 2E03A 4RNAA 1ZCMA 4AXLA 2G7YA 3RVWA 2PREA 1U9XA 3MHSA 1YK7A 1AU3A 1X9YA 4MM3B 2DCDA 1NPZA 2G8EA 3IV2A 3HWNA 2HXZA 3C9EA 3H8BA 2DC6A 4OEMA 2HHNA 1PPPA 2IBIA 5JZEA 3B21A 4A5UA 2CB5A 4I05A 5CHVA 1PE6A 4I07A 2VHSA 4BQVA 1CJLA 1U5IA 1YT7A 2VHFA 2R9NA 2FTDA 1M6DA 3QT4A 3E9SA 3MJ5A 4CDEB 2AU1A 4R3DA 1PVJA 3KWZA 3PNRA 4FJCA 3CBJA 5A24A 3PW3A 2YJBA 1PADA 4K7CA 4CDCB 2PBHA 3KKUA 1EWPA 3PHUA 1HUCB 4XZXA 1AECA 5JH3A 1CQDA 1U9VA 2XU5A 3W31A 3PRMA 4X6JA 2GHUA 3W30A 2O6XA 1F2AA 3KSEA 1AU0A 3PRPA 7PCKA 4RKXA 2PNSA 1QXPA 4BOZA 2ARYA 3V6CA 2JRIA 3LXSA 1ITOA 1MDWA 1PXVA 2R9CA 3WXGA 1NQCA 4BSQA 4PT5A 1VSNA 3MTVA 3PHXA 1FH0A 4M0WA 2JQGR 2DOSA 3OVZA 4BOUA 1BGOA 5PADA 4N8WA 4YYSA 3F5VA 3MP2A 4OELA 3ERVA 3IHPA 4RF0A 4PP2E 2Z84A 1EWOA 3PT2A 5CVOB 3TMPA
chains in the Genus database with same CATH topology
4OW0A 4RF1A 5EZSA 4D8EA 3BY4A 2BTWB 1UKFA 4GUAA 3E9SA 3MTVA 3PHXA 3PSEA 3MJ5A 3TRKA 3IFUA 4M0WA 4MM3B 2DOSA 3W30A 4R3DA 1PVJA 1DKIA 2AGAA 4BOUA 3RNVA 3C0RA 3PRPA 4HXDB 4IUMA 4RKXA 4ZTBA 2BTWA 3MP2A 5E6JA 4WURA 3ZNHA 4BOSA 4BOZA 2HWKA 4BOPA 4IP3A 5JZEA 3B21A 4A5UA 4BOQA 2BU3A 2JRIA 2UZJA 1YZBA 4RF0A 3PHUA 2Z84A 4D8IA 3O65A 2FE8A 4D8BA 3BB7A 4OVZB 4XZXA 4P16A 4MI7A 2J7QC 3PRMA 3W31A 5KO3A 4OVZA 4PT5A 2J7QA 4RNAA 3OQCA 3PT2A 4REZA 3BBAA 3TMPA 3PHWA 5EZQA 2JTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOS A;  4BOZ A;  4BOU A;  3BY4 A;  3PRM A;  5JZE A;  3C0R A;  3PRP A;  4BOQ A;  3PHX A;  4HXD B;  3PSE A;  3PHU A;  3PT2 A;  4BOP A;  3TMP A;  3PHW A;  3ZNH A; 
#chains in the Genus database with same CATH topology
 1CTE A;  1UKF A;  3P5X A;  1O0E A;  3HD3 A;  3RVV A;  1AYV A;  1DKI A;  1NLJ A;  4HXD B;  2IPP B;  3PDF A;  4G54 A;  1KXR A;  4WUR A;  3S3R A;  4BOS A;  1DF0 A;  3K24 A;  1ZIV A;  2CIO A;  3OVX A;  2FE8 A;  1BY8 A;  4MZS A;  2J7Q C;  1QDQ A;  2XU3 A;  4RY2 A;  2J7Q A;  4N79 A;  2DC7 A;  2R9M A;  4D8E A;  2BTW B;  3OIS A;  2FO5 A;  3NHE A;  1CPJ A;  1CS8 A;  4WA6 A;  3H6S A;  3DF0 A;  2NQI A;  1U9W A;  2P7U A;  2DC9 A;  2DCC A;  3P5V A;  4MI7 A;  1S4V A;  3IEJ A;  4AXM A;  1MHW A;  2XU4 A;  1ATK A;  1CB5 A;  4W4U A;  5EZS A;  3BY4 A;  1THE A;  4P6G A;  2F7D A;  2NQG A;  2AGA A;  2ATO A;  3QSD A;  6PAD A;  1TL9 A;  1F29 A;  1PPO A;  5FPW A;  2FYE A;  3V6E A;  3OF9 A;  1QOL A;  2E00 A;  3HHI A;  3MOR A;  3HHA A;  5EF4 A;  4I04 A;  4CZW A;  3K9M A;  2JTC A;  2JQF R;  5EGW A;  4YVA A;  2WBF X;  4MSX A;  2AUX A;  1GEC E;  4X6I A;  1ME3 A;  3P5U A;  4X6H A;  3AI8 A;  2AS8 A;  2NQA A;  4BPV A;  1MS6 A;  4Q8G A;  5EZQ A;  1YVB A;  3D6S A;  2P0R A;  3IFU A;  2F1G A;  1VJV A;  1NB3 A;  2R6N A;  2DZZ A;  2OP3 A;  4QH6 A;  1CSB B;  1YAL A;  2BTW A;  3IOQ A;  3BCN A;  1AU2 A;  3M99 A;  2P86 A;  3IUT A;  3N3K A;  3O65 A;  1GCB A;  3BB7 A;  3WXE A;  2B1N A;  5KO3 A;  2R9O A;  3WXF A;  1MIR A;  1PCI A;  1Y08 A;  3RVX A;  3E1Z B;  1U9Q X;  2HD5 A;  4DMX A;  3O0U A;  2YJ8 A;  1KFX L;  5E6J A;  2Y5B A;  1BP4 A;  3KWB X;  4FIP A;  2UZJ A;  1YZB A;  3KW9 A;  4D8I A;  1MEG A;  2BDZ A;  1EWM A;  1DEU A;  3OQC A;  3BBA A;  2OUL A;  1TLO A;  1NL6 A;  3ZUA A;  1MEM A;  2YJC A;  5K16 A;  3PSE A;  1NB5 A;  1F2C A;  3CH2 X;  2OZ2 A;  1CVZ A;  1PIP A;  1AIM A;  3N3G A;  3BPF A;  1STF E;  4QRX A;  1KHQ A;  4FK5 A;  4IP3 A;  2XU1 A;  4BOQ A;  2BU3 A;  1KFU L;  1JQP A;  2PAD A;  4PAD A;  4XR7 A;  4YYU A;  4HWY A;  8PCH A;  3K8U A;  1Y4H A;  4BS6 A;  1CV8 A;  4P6E A;  2YJ2 A;  2FRQ A;  1QMY A;  2AYN A;  2FUD A;  1XKG A;  1BQI A;  4YYQ A;  4YYR A;  5CHT A;  3C0R A;  5CVN B;  2AUZ A;  4W5B A;  2FT2 A;  4Q8H A;  3BC3 A;  3CH3 X;  2DCA A;  1PPD A;  3F75 A;  1AYW A;  3H7D A;  3N4C A;  4BOP A;  1AU4 A;  3PHW A;  5CVM A;  1ME4 A;  3GCB A;  4QRV A;  9PAP A;  4W5C A;  2GFO A;  3TRK A;  1TU6 A;  1ICF A;  2DCB A;  1KHP A;  2FRA A;  4QRG A;  1F2B A;  4ZTB A;  1IWD A;  3MHH A;  3USV A;  3P5W A;  3OF8 A;  2HWK A;  3PBH A;  1PPN A;  4YV8 A;  4D8B A;  1PBH A;  4OVZ B;  2NQD B;  2DZY A;  4YYW A;  1SNK A;  4PI3 A;  2AYO A;  2DJG B;  4RF1 A;  3IMA A;  1EF7 A;  2B1M A;  4GUA A;  3I06 A;  4N4Z A;  4BS5 A;  2FQ9 A;  3TNX A;  1AYU A;  2YJ9 A;  1GMY A;  3I3T A;  3B79 A;  3ZNH A;  5F02 A;  4MZO A;  2R9F A;  1SP4 B;  1EWL A;  1A6R A;  2H7J A;  4CDD B;  4YYV A;  3CBK A;  3MTN A;  4OW0 A;  2AIM A;  2DC8 A;  2AVW A;  3BWK A;  1YK8 A;  4DMY A;  3S3Q A;  5JA7 A;  1GLO A;  3U8E A;  4IUM A;  5J94 A;  2C0Y A;  4CDF B;  2BDL A;  3LFY A;  3QJ3 A;  2E02 A;  2G8J A;  4P16 A;  3BOW A;  2G6D A;  4OVZ A;  4PP1 A;  4REZ A;  2DJF B;  4QBB A;  2Y6E A;  3KFQ A;  1K3B B;  3H8C A;  3KX1 A;  4KLB A;  2ACT A;  3RNV A;  1POP A;  2E01 A;  3O1G A;  4ZUX U;  4XUI A;  2HH5 A;  1Q6K A;  3H89 A;  3BPM A;  2E03 A;  4RNA A;  1ZCM A;  4AXL A;  2G7Y A;  3RVW A;  2PRE A;  1U9X A;  3MHS A;  1YK7 A;  1AU3 A;  1X9Y A;  4MM3 B;  2DCD A;  1NPZ A;  2G8E A;  3IV2 A;  3HWN A;  2HXZ A;  3C9E A;  3H8B A;  2DC6 A;  4OEM A;  2HHN A;  1PPP A;  2IBI A;  5JZE A;  3B21 A;  4A5U A;  2CB5 A;  4I05 A;  5CHV A;  1PE6 A;  4I07 A;  2VHS A;  4BQV A;  1CJL A;  1U5I A;  1YT7 A;  2VHF A;  2R9N A;  2FTD A;  1M6D A;  3QT4 A;  3E9S A;  3MJ5 A;  4CDE B;  2AU1 A;  4R3D A;  1PVJ A;  3KWZ A;  3PNR A;  4FJC A;  3CBJ A;  5A24 A;  3PW3 A;  2YJB A;  1PAD A;  4K7C A;  4CDC B;  2PBH A;  3KKU A;  1EWP A;  3PHU A;  1HUC B;  4XZX A;  1AEC A;  5JH3 A;  1CQD A;  1U9V A;  2XU5 A;  3W31 A;  3PRM A;  4X6J A;  2GHU A;  3W30 A;  2O6X A;  1F2A A;  3KSE A;  1AU0 A;  3PRP A;  7PCK A;  4RKX A;  2PNS A;  1QXP A;  4BOZ A;  2ARY A;  3V6C A;  2JRI A;  3LXS A;  1ITO A;  1MDW A;  1PXV A;  2R9C A;  3WXG A;  1NQC A;  4BSQ A;  4PT5 A;  1VSN A;  3MTV A;  3PHX A;  1FH0 A;  4M0W A;  2JQG R;  2DOS A;  3OVZ A;  4BOU A;  1BGO A;  5PAD A;  4N8W A;  4YYS A;  3F5V A;  3MP2 A;  4OEL A;  3ERV A;  3IHP A;  4RF0 A;  4PP2 E;  2Z84 A;  1EWO A;  3PT2 A;  5CVO B;  3TMP A; 
#chains in the Genus database with same CATH homology
 4OW0 A;  4RF1 A;  5EZS A;  4D8E A;  3BY4 A;  2BTW B;  1UKF A;  4GUA A;  3E9S A;  3MTV A;  3PHX A;  3PSE A;  3MJ5 A;  3TRK A;  3IFU A;  4M0W A;  4MM3 B;  2DOS A;  3W30 A;  4R3D A;  1PVJ A;  1DKI A;  2AGA A;  4BOU A;  3RNV A;  3C0R A;  3PRP A;  4HXD B;  4IUM A;  4RKX A;  4ZTB A;  2BTW A;  3MP2 A;  5E6J A;  4WUR A;  3ZNH A;  4BOS A;  4BOZ A;  2HWK A;  4BOP A;  4IP3 A;  5JZE A;  3B21 A;  4A5U A;  4BOQ A;  2BU3 A;  2JRI A;  2UZJ A;  1YZB A;  4RF0 A;  3PHU A;  2Z84 A;  4D8I A;  3O65 A;  2FE8 A;  4D8B A;  3BB7 A;  4OVZ B;  4XZX A;  4P16 A;  4MI7 A;  2J7Q C;  3PRM A;  3W31 A;  5KO3 A;  4OVZ A;  4PT5 A;  2J7Q A;  4RNA A;  3OQC A;  3PT2 A;  4REZ A;  3BBA A;  3TMP A;  3PHW A;  5EZQ A;  2JTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...