3PHXA

Otu domain of crimean congo hemorrhagic fever virus in complex with isg15
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
GPMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVSDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
publication title Molecular basis for ubiquitin and ISG15 cross-reactivity in viral ovarian tumor domains.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
total genus 48
structure length 162
sequence length 164
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3phxA00
3C0RA 3BY4A 3PRMA 3PRPA 3ZNHA 3PHXA 4BOSA 4BOZA 4BOPA 4BOQA 4HXDB 5JZEA 3PSEA 3PHUA 3TMPA 4BOUA 3PT2A 3PHWA
chains in the Genus database with same CATH superfamily
2DZZA 3PDFA 1KFUL 3KWZA 4YYVA 3BC3A 3M99A 3MTNA 3ZUAA 1U5IA 5KO3A 1F2AA 3BBAA 2AVWA 4BOUA 5CVOB 3S3RA 3KKUA 4CDEB 2G8EA 4XZXA 1DEUA 3RNVA 1NLJA 4RF0A 1ICFA 1X9YA 2BTWB 2VHFA 3IMAA 2G6DA 1ZIVA 1PBHA 1U9VA 1O0EA 8PCHA 3KSEA 2ARYA 3HHAA 1ATKA 3I06A 5CHVA 2FUDA 3BY4A 1S4VA 4W4UA 3BPFA 2YJ9A 2R9NA 3KWBX 5CVMA 1QDQA 2DC6A 1U9WA 4QRVA 4ZUXU 2DCAA 1YK8A 1TU6A 7PCKA 4DMYA 1F2BA 1Q6KA 4MZSA 4RY2A 2FYEA 4YYWA 1EWMA 2AIMA 3BCNA 3WXFA 3HD3A 1MEMA 2CB5A 2NQDB 4BOPA 1MDWA 2B1NA 2JQGR 4OEMA 4X6HA 4W5BA 2DJGB 1AYVA 1MIRA 1MEGA 4N79A 1SP4B 3C9EA 3O0UA 2DOSA 3MP2A 4PT5A 2PREA 1AU0A 1F29A 1BY8A 2BU3A 2ACTA 3OISA 3RVVA 2FE8A 4FJCA 4BQVA 4RNAA 4FIPA 2YJ8A 1PPPA 2F1GA 4BS6A 4WA6A 1ZCMA 3I3TA 3OVXA 3F75A 5EF4A 2FO5A 3PRMA 1EWOA 4DMXA 9PAPA 4MZOA 4IUMA 5CHTA 3WXGA 4M0WA 2DCCA 3CBKA 4RKXA 5PADA 1YK7A 3MORA 4WURA 3D6SA 1NB5A 4A5UA 4YYSA 2AU1A 3OQCA 4I05A 1FH0A 1EWPA 2R9MA 3NHEA 4N8WA 1ME3A 3IEJA 4K7CA 3F5VA 2P0RA 4BS5A 3IUTA 3OF8A 1AU4A 4OVZA 3ERVA 3H6SA 2J7QC 3IFUA 2PADA 1VSNA 3LFYA 2JRIA 3PHXA 1CSBB 1MHWA 1CV8A 3H8CA 3P5UA 2G7YA 2DCDA 3RVXA 1YT7A 2JQFR 3LXSA 2Y6EA 1DF0A 2DC8A 2E02A 1JQPA 2WBFX 3U8EA 1AYWA 3PSEA 4GUAA 3H89A 1PXVA 2AS8A 1HUCB 3TNXA 1KHPA 1YALA 3C0RA 3KFQA 5JH3A 1CTEA 4YYRA 1NQCA 4OELA 4Q8HA 3B21A 4BPVA 1EF7A 4YV8A 2BDZA 2F7DA 3QT4A 4R3DA 3PHUA 3E9SA 4YYQA 2C0YA 2DCBA 5F02A 1EWLA 1YVBA 1IWDA 1SNKA 3OF9A 3BB7A 3V6EA 2H7JA 3GCBA 3PNRA 3WXEA 2R9FA 3CH2X 4FK5A 2YJ2A 3AI8A 2VHSA 5JZEA 3PT2A 4X6JA 3O65A 4QH6A 2AUZA 2R9OA 1QMYA 2OP3A 1PCIA 1BP4A 4BOZA 1UKFA 4XR7A 3QSDA 4MI7A 4AXLA 4D8BA 4YYUA 4YVAA 4P16A 4CDDB 2HD5A 3K9MA 4REZA 2J7QA 4XUIA 2BDLA 4HXDB 6PADA 5K16A 1CB5A 2E03A 3N4CA 1NB3A 1XKGA 1TLOA 2AGAA 2E00A 3TRKA 4D8IA 1CQDA 3N3GA 2DC7A 3HWNA 3H8BA 1PPOA 4CDFB 2GHUA 2XU3A 3PBHA 2FTDA 4RF1A 2HXZA 1POPA 2ATOA 2G8JA 2JTCA 3HHIA 3MJ5A 4QBBA 4OW0A 2IPPB 3PW3A 2HH5A 2BTWA 1KFXL 2E01A 4G54A 4KLBA 4N4ZA 3IOQA 3OVZA 1YZBA 3BWKA 4X6IA 2HWKA 1PE6A 5FPWA 3MHSA 3K8UA 1CVZA 2DZYA 2P86A 3MTVA 1U9XA 4PADA 1PVJA 4PP2E 4P6EA 1PADA 2O6XA 1AU3A 4QRGA 4BSQA 3P5XA 1U9QX 1GMYA 1Y4HA 1ME4A 3H7DA 2R6NA 1AECA 4I04A 1QOLA 1DKIA 1CJLA 3RVWA 1BGOA 3PHWA 4IP3A 4Q8GA 1STFE 2FRQA 4OVZB 2UZJA 3DF0A 1M6DA 2Y5BA 2P7UA 1PIPA 1NPZA 3BOWA 3W31A 1AYUA 1GCBA 1AU2A 2HHNA 1KXRA 4MM3B 3S3QA 2OZ2A 2PNSA 3MHHA 2FRAA 3USVA 1PPDA 3E1ZB 2CIOA 2AUXA 2DC9A 1AIMA 1CS8A 2FQ9A 4P6GA 4BOSA 2FT2A 3CH3X 3BPMA 2NQAA 1K3BB 5E6JA 1THEA 3P5WA 1GLOA 1VJVA 3IHPA 3N3KA 1F2CA 1TL9A 2DJFB 4ZTBA 1BQIA 4CDCB 3B79A 3KX1A 4CZWA 5EZQA 4W5CA 4BOQA 4PP1A 1GECE 3KW9A 2XU5A 1ITOA 5JA7A 1Y08A 1KHQA 1A6RA 3V6CA 1QXPA 3CBJA 3W30A 5EZSA 5CVNB 4QRXA 1PPNA 3K24A 4PI3A 2AYNA 1NL6A 3ZNHA 3PRPA 2R9CA 2YJCA 5J94A 2Z84A 3IV2A 4HWYA 4I07A 2GFOA 1CPJA 3P5VA 5EGWA 2PBHA 2NQGA 2YJBA 1MS6A 2OULA 2NQIA 4MSXA 2XU1A 2IBIA 2XU4A 3TMPA 2AYOA 3QJ3A 2B1MA 5A24A 3O1GA 4AXMA 4D8EA
chains in the Genus database with same CATH topology
3O65A 4IUMA 4M0WA 4RKXA 3W31A 4BOZA 1UKFA 4WURA 5KO3A 3BBAA 4BOUA 4MI7A 4D8BA 4MM3B 4A5UA 4P16A 3OQCA 4REZA 2J7QA 4XZXA 3RNVA 4HXDB 4RF0A 2BTWB 4OVZA 2AGAA 2J7QC 3IFUA 4BOSA 3TRKA 4D8IA 5E6JA 2JRIA 3PHXA 4ZTBA 3BY4A 4RF1A 5EZQA 4BOQA 2JTCA 3MJ5A 4OW0A 2BTWA 3PSEA 4GUAA 1YZBA 3W30A 5EZSA 3C0RA 2HWKA 4BOPA 3ZNHA 3PRPA 2DOSA 3MP2A 3MTVA 4PT5A 1PVJA 3B21A 2Z84A 4R3DA 3PHUA 3E9SA 2BU3A 2FE8A 4RNAA 3BB7A 3TMPA 1DKIA 3PHWA 4OVZB 4IP3A 3PRMA 5JZEA 4D8EA 3PT2A 2UZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0R A;  3BY4 A;  3PRM A;  3PRP A;  3ZNH A;  3PHX A;  4BOS A;  4BOZ A;  4BOP A;  4BOQ A;  4HXD B;  5JZE A;  3PSE A;  3PHU A;  3TMP A;  4BOU A;  3PT2 A;  3PHW A; 
#chains in the Genus database with same CATH topology
 2DZZ A;  3PDF A;  1KFU L;  3KWZ A;  4YYV A;  3BC3 A;  3M99 A;  3MTN A;  3ZUA A;  1U5I A;  5KO3 A;  1F2A A;  3BBA A;  2AVW A;  4BOU A;  5CVO B;  3S3R A;  3KKU A;  4CDE B;  2G8E A;  4XZX A;  1DEU A;  3RNV A;  1NLJ A;  4RF0 A;  1ICF A;  1X9Y A;  2BTW B;  2VHF A;  3IMA A;  2G6D A;  1ZIV A;  1PBH A;  1U9V A;  1O0E A;  8PCH A;  3KSE A;  2ARY A;  3HHA A;  1ATK A;  3I06 A;  5CHV A;  2FUD A;  3BY4 A;  1S4V A;  4W4U A;  3BPF A;  2YJ9 A;  2R9N A;  3KWB X;  5CVM A;  1QDQ A;  2DC6 A;  1U9W A;  4QRV A;  4ZUX U;  2DCA A;  1YK8 A;  1TU6 A;  7PCK A;  4DMY A;  1F2B A;  1Q6K A;  4MZS A;  4RY2 A;  2FYE A;  4YYW A;  1EWM A;  2AIM A;  3BCN A;  3WXF A;  3HD3 A;  1MEM A;  2CB5 A;  2NQD B;  4BOP A;  1MDW A;  2B1N A;  2JQG R;  4OEM A;  4X6H A;  4W5B A;  2DJG B;  1AYV A;  1MIR A;  1MEG A;  4N79 A;  1SP4 B;  3C9E A;  3O0U A;  2DOS A;  3MP2 A;  4PT5 A;  2PRE A;  1AU0 A;  1F29 A;  1BY8 A;  2BU3 A;  2ACT A;  3OIS A;  3RVV A;  2FE8 A;  4FJC A;  4BQV A;  4RNA A;  4FIP A;  2YJ8 A;  1PPP A;  2F1G A;  4BS6 A;  4WA6 A;  1ZCM A;  3I3T A;  3OVX A;  3F75 A;  5EF4 A;  2FO5 A;  3PRM A;  1EWO A;  4DMX A;  9PAP A;  4MZO A;  4IUM A;  5CHT A;  3WXG A;  4M0W A;  2DCC A;  3CBK A;  4RKX A;  5PAD A;  1YK7 A;  3MOR A;  4WUR A;  3D6S A;  1NB5 A;  4A5U A;  4YYS A;  2AU1 A;  3OQC A;  4I05 A;  1FH0 A;  1EWP A;  2R9M A;  3NHE A;  4N8W A;  1ME3 A;  3IEJ A;  4K7C A;  3F5V A;  2P0R A;  4BS5 A;  3IUT A;  3OF8 A;  1AU4 A;  4OVZ A;  3ERV A;  3H6S A;  2J7Q C;  3IFU A;  2PAD A;  1VSN A;  3LFY A;  2JRI A;  3PHX A;  1CSB B;  1MHW A;  1CV8 A;  3H8C A;  3P5U A;  2G7Y A;  2DCD A;  3RVX A;  1YT7 A;  2JQF R;  3LXS A;  2Y6E A;  1DF0 A;  2DC8 A;  2E02 A;  1JQP A;  2WBF X;  3U8E A;  1AYW A;  3PSE A;  4GUA A;  3H89 A;  1PXV A;  2AS8 A;  1HUC B;  3TNX A;  1KHP A;  1YAL A;  3C0R A;  3KFQ A;  5JH3 A;  1CTE A;  4YYR A;  1NQC A;  4OEL A;  4Q8H A;  3B21 A;  4BPV A;  1EF7 A;  4YV8 A;  2BDZ A;  2F7D A;  3QT4 A;  4R3D A;  3PHU A;  3E9S A;  4YYQ A;  2C0Y A;  2DCB A;  5F02 A;  1EWL A;  1YVB A;  1IWD A;  1SNK A;  3OF9 A;  3BB7 A;  3V6E A;  2H7J A;  3GCB A;  3PNR A;  3WXE A;  2R9F A;  3CH2 X;  4FK5 A;  2YJ2 A;  3AI8 A;  2VHS A;  5JZE A;  3PT2 A;  4X6J A;  3O65 A;  4QH6 A;  2AUZ A;  2R9O A;  1QMY A;  2OP3 A;  1PCI A;  1BP4 A;  4BOZ A;  1UKF A;  4XR7 A;  3QSD A;  4MI7 A;  4AXL A;  4D8B A;  4YYU A;  4YVA A;  4P16 A;  4CDD B;  2HD5 A;  3K9M A;  4REZ A;  2J7Q A;  4XUI A;  2BDL A;  4HXD B;  6PAD A;  5K16 A;  1CB5 A;  2E03 A;  3N4C A;  1NB3 A;  1XKG A;  1TLO A;  2AGA A;  2E00 A;  3TRK A;  4D8I A;  1CQD A;  3N3G A;  2DC7 A;  3HWN A;  3H8B A;  1PPO A;  4CDF B;  2GHU A;  2XU3 A;  3PBH A;  2FTD A;  4RF1 A;  2HXZ A;  1POP A;  2ATO A;  2G8J A;  2JTC A;  3HHI A;  3MJ5 A;  4QBB A;  4OW0 A;  2IPP B;  3PW3 A;  2HH5 A;  2BTW A;  1KFX L;  2E01 A;  4G54 A;  4KLB A;  4N4Z A;  3IOQ A;  3OVZ A;  1YZB A;  3BWK A;  4X6I A;  2HWK A;  1PE6 A;  5FPW A;  3MHS A;  3K8U A;  1CVZ A;  2DZY A;  2P86 A;  3MTV A;  1U9X A;  4PAD A;  1PVJ A;  4PP2 E;  4P6E A;  1PAD A;  2O6X A;  1AU3 A;  4QRG A;  4BSQ A;  3P5X A;  1U9Q X;  1GMY A;  1Y4H A;  1ME4 A;  3H7D A;  2R6N A;  1AEC A;  4I04 A;  1QOL A;  1DKI A;  1CJL A;  3RVW A;  1BGO A;  3PHW A;  4IP3 A;  4Q8G A;  1STF E;  2FRQ A;  4OVZ B;  2UZJ A;  3DF0 A;  1M6D A;  2Y5B A;  2P7U A;  1PIP A;  1NPZ A;  3BOW A;  3W31 A;  1AYU A;  1GCB A;  1AU2 A;  2HHN A;  1KXR A;  4MM3 B;  3S3Q A;  2OZ2 A;  2PNS A;  3MHH A;  2FRA A;  3USV A;  1PPD A;  3E1Z B;  2CIO A;  2AUX A;  2DC9 A;  1AIM A;  1CS8 A;  2FQ9 A;  4P6G A;  4BOS A;  2FT2 A;  3CH3 X;  3BPM A;  2NQA A;  1K3B B;  5E6J A;  1THE A;  3P5W A;  1GLO A;  1VJV A;  3IHP A;  3N3K A;  1F2C A;  1TL9 A;  2DJF B;  4ZTB A;  1BQI A;  4CDC B;  3B79 A;  3KX1 A;  4CZW A;  5EZQ A;  4W5C A;  4BOQ A;  4PP1 A;  1GEC E;  3KW9 A;  2XU5 A;  1ITO A;  5JA7 A;  1Y08 A;  1KHQ A;  1A6R A;  3V6C A;  1QXP A;  3CBJ A;  3W30 A;  5EZS A;  5CVN B;  4QRX A;  1PPN A;  3K24 A;  4PI3 A;  2AYN A;  1NL6 A;  3ZNH A;  3PRP A;  2R9C A;  2YJC A;  5J94 A;  2Z84 A;  3IV2 A;  4HWY A;  4I07 A;  2GFO A;  1CPJ A;  3P5V A;  5EGW A;  2PBH A;  2NQG A;  2YJB A;  1MS6 A;  2OUL A;  2NQI A;  4MSX A;  2XU1 A;  2IBI A;  2XU4 A;  3TMP A;  2AYO A;  3QJ3 A;  2B1M A;  5A24 A;  3O1G A;  4AXM A;  4D8E A; 
#chains in the Genus database with same CATH homology
 3O65 A;  4IUM A;  4M0W A;  4RKX A;  3W31 A;  4BOZ A;  1UKF A;  4WUR A;  5KO3 A;  3BBA A;  4BOU A;  4MI7 A;  4D8B A;  4MM3 B;  4A5U A;  4P16 A;  3OQC A;  4REZ A;  2J7Q A;  4XZX A;  3RNV A;  4HXD B;  4RF0 A;  2BTW B;  4OVZ A;  2AGA A;  2J7Q C;  3IFU A;  4BOS A;  3TRK A;  4D8I A;  5E6J A;  2JRI A;  3PHX A;  4ZTB A;  3BY4 A;  4RF1 A;  5EZQ A;  4BOQ A;  2JTC A;  3MJ5 A;  4OW0 A;  2BTW A;  3PSE A;  4GUA A;  1YZB A;  3W30 A;  5EZS A;  3C0R A;  2HWK A;  4BOP A;  3ZNH A;  3PRP A;  2DOS A;  3MP2 A;  3MTV A;  4PT5 A;  1PVJ A;  3B21 A;  2Z84 A;  4R3D A;  3PHU A;  3E9S A;  2BU3 A;  2FE8 A;  4RNA A;  3BB7 A;  3TMP A;  1DKI A;  3PHW A;  4OVZ B;  4IP3 A;  3PRM A;  5JZE A;  4D8E A;  3PT2 A;  2UZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...