3PHXA

Otu domain of crimean congo hemorrhagic fever virus in complex with isg15
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
b'GPMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVSDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
publication title Molecular basis for ubiquitin and ISG15 cross-reactivity in viral ovarian tumor domains.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
total genus 48
structure length 162
sequence length 164
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3phxA00
3PHXA 3PT2A 4BOZA 3TMPA 3PSEA 3PHUA 3ZNHA 3PRMA 3PRPA 5JZEA 4HXDB 4BOUA 4BOPA 4BOSA 3C0RA 3BY4A 4BOQA 3PHWA
chains in the Genus database with same CATH superfamily
4PP1A 2G8JA 4CDFB 2B1NA 1AYWA 1ME3A 3DF0A 1SP4B 3ERVA 3IUTA 1K3BB 3N3GA 4N8WA 3PRPA 4YYQA 2AS8A 1ATKA 1VJVA 3F75A 1PCIA 1MEGA 3MJ5A 4I04A 4PI3A 1AU3A 3HWNA 2YJBA 1CPJA 3M99A 1QMYA 2DZYA 1O0EA 2JRIA 2DOSA 4CDDB 4IUMA 1TL9A 2AVWA 2FT2A 1NQCA 1YT7A 2J7QC 2BTWB 1AU0A 4ZTBA 3KKUA 2ATOA 2AU1A 1PPOA 2AGAA 1KFUL 2PREA 1UKFA 2JQGR 3CBKA 4BOSA 3N3KA 4DMYA 1PPDA 3AI8A 4AXLA 2PNSA 2G6DA 1VSNA 2OP3A 3LFYA 2J7QA 2FRQA 3PNRA 4OVZA 3KWBX 1YZBA 3K24A 1NLJA 4R3DA 1DEUA 2DCBA 3H7DA 1POPA 4KLBA 1MIRA 2AYOA 2DCDA 4YYSA 3OQCA 8PCHA 5F02A 4FIPA 1QOLA 1YVBA 2XU3A 2PADA 3K9MA 2FYEA 2CIOA 2FUDA 2G7YA 1U9QX 3C9EA 2JQFR 1KXRA 2VHSA 4PADA 1ZIVA 4K7CA 3BCNA 4YVAA 1YK7A 3BOWA 3IFUA 2NQDB 4W5BA 1CB5A 5K16A 4CDEB 4Q8GA 1CV8A 5EGWA 3P5XA 5JA7A 1GLOA 1EF7A 4BOQA 1EWOA 1EWMA 4OW0A 3S3QA 4Q8HA 3H8CA 3BPFA 4XUIA 3OF8A 3E1ZB 1U9VA 1F29A 2XU1A 2YJ2A 4BS6A 3CH2X 1EWLA 3OVZA 7PCKA 3H89A 1BQIA 1S4VA 4MZOA 3BPMA 3V6EA 2GFOA 2AYNA 3N4CA 1GMYA 1U9WA 3MHSA 4BOPA 3O65A 1U5IA 4YYUA 2OZ2A 2NQIA 3BBAA 1PXVA 1DF0A 3PSEA 3USVA 4QRGA 4N79A 4RNAA 3PBHA 4P6EA 1EWPA 2UZJA 3P5WA 4OVZB 3P5UA 2ARYA 2JTCA 3IV2A 4BPVA 4X6IA 6PADA 2E01A 5KO3A 4BSQA 3QSDA 2FTDA 3V6CA 1Y08A 5CVNB 2F7DA 2AUXA 4BQVA 3RNVA 4FJCA 4YV8A 4X6JA 4MM3B 5CVOB 1ITOA 2E02A 1GCBA 3LXSA 1TU6A 3I06A 1PIPA 3PW3A 1FH0A 3WXEA 3I3TA 2F1GA 2O6XA 1TLOA 3PDFA 3QT4A 3BC3A 4YYWA 4BOZA 5CVMA 4X6HA 1CSBB 1F2CA 2CB5A 1PADA 3GCBA 2FO5A 4XZXA 1CJLA 2R9NA 2HWKA 3P5VA 4N4ZA 4PP2E 1ME4A 3HHAA 1HUCB 3OVXA 4GUAA 1X9YA 2NQAA 4I05A 1PVJA 1MEMA 2DJFB 1Y4HA 1NL6A 3PHWA 3PT2A 2OULA 3IMAA 4BS5A 1KFXL 2HH5A 5A24A 2DCCA 3U8EA 4P16A 1CTEA 2YJ8A 2R9FA 5JH3A 1BY8A 1AIMA 4QH6A 1STFE 1THEA 2G8EA 3RVXA 2DJGB 2P0RA 1CVZA 3MTVA 3PHXA 2AIMA 4WA6A 2PBHA 1GECE 1U9XA 3QJ3A 4IP3A 5EZSA 3WXGA 4A5UA 4QRXA 1KHPA 2Y5BA 1YK8A 1JQPA 1BP4A 3B79A 2DC8A 3IHPA 1DKIA 1XKGA 2IBIA 4ZUXU 3MHHA 3ZUAA 3IEJA 1MS6A 1PE6A 4I07A 2DC7A 3KW9A 4RKXA 4MSXA 9PAPA 2B1MA 1MHWA 3MTNA 1M6DA 3B21A 1F2AA 4CDCB 3RVWA 3HHIA 2BU3A 3O1GA 4RF1A 1AYUA 4HXDB 1AU2A 3H8BA 2GHUA 1AECA 2FRAA 4REZA 2NQGA 2E03A 3CBJA 1IWDA 2VHFA 3KWZA 5CHVA 1KHQA 2HXZA 3BWKA 1ICFA 3PHUA 1BGOA 1MDWA 2XU4A 2R6NA 3S3RA 2AUZA 4YYRA 5EF4A 3IOQA 3OISA 1PPPA 3C0RA 3KX1A 2Y6EA 2DC9A 2P86A 1CQDA 4D8EA 4QRVA 3O0UA 3W30A 2C0YA 1NB3A 3OF9A 5PADA 4P6GA 2YJ9A 5FPWA 3HD3A 5JZEA 4PT5A 2XU5A 2ACTA 2R9MA 3K8UA 4OELA 3TNXA 1QDQA 1SNKA 4M0WA 4QBBA 4RY2A 1YALA 5EZQA 1Q6KA 2HD5A 2H7JA 3MP2A 2DC6A 3E9SA 4W5CA 4XR7A 4D8IA 1PBHA 3TMPA 1NPZA 3KFQA 2BDZA 3PRMA 4MI7A 4BOUA 2P7UA 1CS8A 2IPPB 4YYVA 3F5VA 2BTWA 4RF0A 3RVVA 3W31A 4WURA 5J94A 3H6SA 4MZSA 2FQ9A 3TRKA 1ZCMA 1AYVA 1F2BA 2BDLA 5CHTA 2FE8A 3MORA 3D6SA 3BB7A 4D8BA 4DMXA 1A6RA 4AXMA 1NB5A 4OEMA 4FK5A 2R9CA 4G54A 2E00A 4W4UA 2HHNA 3KSEA 3WXFA 2WBFX 3NHEA 2DZZA 1QXPA 2Z84A 3ZNHA 2R9OA 5E6JA 4CZWA 1AU4A 4HWYA 2YJCA 2DCAA 3CH3X 1PPNA 3BY4A
chains in the Genus database with same CATH topology
4XZXA 2HWKA 3C0RA 4BOQA 4GUAA 1PVJA 4OW0A 3PHWA 3PRPA 3PT2A 4D8EA 3W30A 4P16A 3MJ5A 5JZEA 4PT5A 3MTVA 3PHXA 2JRIA 4BOPA 3O65A 2DOSA 3BBAA 3PSEA 4IUMA 4M0WA 4IP3A 5EZSA 4A5UA 5EZQA 2J7QC 4RNAA 2BTWB 2UZJA 4ZTBA 3MP2A 3E9SA 4D8IA 2AGAA 4OVZB 1DKIA 3TMPA 2JTCA 3PRMA 1UKFA 4MI7A 4BOUA 4BOSA 5KO3A 2BTWA 4RF0A 3W31A 4WURA 2J7QA 4OVZA 4RKXA 3TRKA 1YZBA 3RNVA 2FE8A 3B21A 4R3DA 4MM3B 3BB7A 4D8BA 3OQCA 2BU3A 4RF1A 4HXDB 4REZA 2Z84A 3ZNHA 5E6JA 3IFUA 4BOZA 3PHUA 3BY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHX A;  3PT2 A;  4BOZ A;  3TMP A;  3PSE A;  3PHU A;  3ZNH A;  3PRM A;  3PRP A;  5JZE A;  4HXD B;  4BOU A;  4BOP A;  4BOS A;  3C0R A;  3BY4 A;  4BOQ A;  3PHW A; 
#chains in the Genus database with same CATH topology
 4PP1 A;  2G8J A;  4CDF B;  2B1N A;  1AYW A;  1ME3 A;  3DF0 A;  1SP4 B;  3ERV A;  3IUT A;  1K3B B;  3N3G A;  4N8W A;  3PRP A;  4YYQ A;  2AS8 A;  1ATK A;  1VJV A;  3F75 A;  1PCI A;  1MEG A;  3MJ5 A;  4I04 A;  4PI3 A;  1AU3 A;  3HWN A;  2YJB A;  1CPJ A;  3M99 A;  1QMY A;  2DZY A;  1O0E A;  2JRI A;  2DOS A;  4CDD B;  4IUM A;  1TL9 A;  2AVW A;  2FT2 A;  1NQC A;  1YT7 A;  2J7Q C;  2BTW B;  1AU0 A;  4ZTB A;  3KKU A;  2ATO A;  2AU1 A;  1PPO A;  2AGA A;  1KFU L;  2PRE A;  1UKF A;  2JQG R;  3CBK A;  4BOS A;  3N3K A;  4DMY A;  1PPD A;  3AI8 A;  4AXL A;  2PNS A;  2G6D A;  1VSN A;  2OP3 A;  3LFY A;  2J7Q A;  2FRQ A;  3PNR A;  4OVZ A;  3KWB X;  1YZB A;  3K24 A;  1NLJ A;  4R3D A;  1DEU A;  2DCB A;  3H7D A;  1POP A;  4KLB A;  1MIR A;  2AYO A;  2DCD A;  4YYS A;  3OQC A;  8PCH A;  5F02 A;  4FIP A;  1QOL A;  1YVB A;  2XU3 A;  2PAD A;  3K9M A;  2FYE A;  2CIO A;  2FUD A;  2G7Y A;  1U9Q X;  3C9E A;  2JQF R;  1KXR A;  2VHS A;  4PAD A;  1ZIV A;  4K7C A;  3BCN A;  4YVA A;  1YK7 A;  3BOW A;  3IFU A;  2NQD B;  4W5B A;  1CB5 A;  5K16 A;  4CDE B;  4Q8G A;  1CV8 A;  5EGW A;  3P5X A;  5JA7 A;  1GLO A;  1EF7 A;  4BOQ A;  1EWO A;  1EWM A;  4OW0 A;  3S3Q A;  4Q8H A;  3H8C A;  3BPF A;  4XUI A;  3OF8 A;  3E1Z B;  1U9V A;  1F29 A;  2XU1 A;  2YJ2 A;  4BS6 A;  3CH2 X;  1EWL A;  3OVZ A;  7PCK A;  3H89 A;  1BQI A;  1S4V A;  4MZO A;  3BPM A;  3V6E A;  2GFO A;  2AYN A;  3N4C A;  1GMY A;  1U9W A;  3MHS A;  4BOP A;  3O65 A;  1U5I A;  4YYU A;  2OZ2 A;  2NQI A;  3BBA A;  1PXV A;  1DF0 A;  3PSE A;  3USV A;  4QRG A;  4N79 A;  4RNA A;  3PBH A;  4P6E A;  1EWP A;  2UZJ A;  3P5W A;  4OVZ B;  3P5U A;  2ARY A;  2JTC A;  3IV2 A;  4BPV A;  4X6I A;  6PAD A;  2E01 A;  5KO3 A;  4BSQ A;  3QSD A;  2FTD A;  3V6C A;  1Y08 A;  5CVN B;  2F7D A;  2AUX A;  4BQV A;  3RNV A;  4FJC A;  4YV8 A;  4X6J A;  4MM3 B;  5CVO B;  1ITO A;  2E02 A;  1GCB A;  3LXS A;  1TU6 A;  3I06 A;  1PIP A;  3PW3 A;  1FH0 A;  3WXE A;  3I3T A;  2F1G A;  2O6X A;  1TLO A;  3PDF A;  3QT4 A;  3BC3 A;  4YYW A;  4BOZ A;  5CVM A;  4X6H A;  1CSB B;  1F2C A;  2CB5 A;  1PAD A;  3GCB A;  2FO5 A;  4XZX A;  1CJL A;  2R9N A;  2HWK A;  3P5V A;  4N4Z A;  4PP2 E;  1ME4 A;  3HHA A;  1HUC B;  3OVX A;  4GUA A;  1X9Y A;  2NQA A;  4I05 A;  1PVJ A;  1MEM A;  2DJF B;  1Y4H A;  1NL6 A;  3PHW A;  3PT2 A;  2OUL A;  3IMA A;  4BS5 A;  1KFX L;  2HH5 A;  5A24 A;  2DCC A;  3U8E A;  4P16 A;  1CTE A;  2YJ8 A;  2R9F A;  5JH3 A;  1BY8 A;  1AIM A;  4QH6 A;  1STF E;  1THE A;  2G8E A;  3RVX A;  2DJG B;  2P0R A;  1CVZ A;  3MTV A;  3PHX A;  2AIM A;  4WA6 A;  2PBH A;  1GEC E;  1U9X A;  3QJ3 A;  4IP3 A;  5EZS A;  3WXG A;  4A5U A;  4QRX A;  1KHP A;  2Y5B A;  1YK8 A;  1JQP A;  1BP4 A;  3B79 A;  2DC8 A;  3IHP A;  1DKI A;  1XKG A;  2IBI A;  4ZUX U;  3MHH A;  3ZUA A;  3IEJ A;  1MS6 A;  1PE6 A;  4I07 A;  2DC7 A;  3KW9 A;  4RKX A;  4MSX A;  9PAP A;  2B1M A;  1MHW A;  3MTN A;  1M6D A;  3B21 A;  1F2A A;  4CDC B;  3RVW A;  3HHI A;  2BU3 A;  3O1G A;  4RF1 A;  1AYU A;  4HXD B;  1AU2 A;  3H8B A;  2GHU A;  1AEC A;  2FRA A;  4REZ A;  2NQG A;  2E03 A;  3CBJ A;  1IWD A;  2VHF A;  3KWZ A;  5CHV A;  1KHQ A;  2HXZ A;  3BWK A;  1ICF A;  3PHU A;  1BGO A;  1MDW A;  2XU4 A;  2R6N A;  3S3R A;  2AUZ A;  4YYR A;  5EF4 A;  3IOQ A;  3OIS A;  1PPP A;  3C0R A;  3KX1 A;  2Y6E A;  2DC9 A;  2P86 A;  1CQD A;  4D8E A;  4QRV A;  3O0U A;  3W30 A;  2C0Y A;  1NB3 A;  3OF9 A;  5PAD A;  4P6G A;  2YJ9 A;  5FPW A;  3HD3 A;  5JZE A;  4PT5 A;  2XU5 A;  2ACT A;  2R9M A;  3K8U A;  4OEL A;  3TNX A;  1QDQ A;  1SNK A;  4M0W A;  4QBB A;  4RY2 A;  1YAL A;  5EZQ A;  1Q6K A;  2HD5 A;  2H7J A;  3MP2 A;  2DC6 A;  3E9S A;  4W5C A;  4XR7 A;  4D8I A;  1PBH A;  3TMP A;  1NPZ A;  3KFQ A;  2BDZ A;  3PRM A;  4MI7 A;  4BOU A;  2P7U A;  1CS8 A;  2IPP B;  4YYV A;  3F5V A;  2BTW A;  4RF0 A;  3RVV A;  3W31 A;  4WUR A;  5J94 A;  3H6S A;  4MZS A;  2FQ9 A;  3TRK A;  1ZCM A;  1AYV A;  1F2B A;  2BDL A;  5CHT A;  2FE8 A;  3MOR A;  3D6S A;  3BB7 A;  4D8B A;  4DMX A;  1A6R A;  4AXM A;  1NB5 A;  4OEM A;  4FK5 A;  2R9C A;  4G54 A;  2E00 A;  4W4U A;  2HHN A;  3KSE A;  3WXF A;  2WBF X;  3NHE A;  2DZZ A;  1QXP A;  2Z84 A;  3ZNH A;  2R9O A;  5E6J A;  4CZW A;  1AU4 A;  4HWY A;  2YJC A;  2DCA A;  3CH3 X;  1PPN A;  3BY4 A; 
#chains in the Genus database with same CATH homology
 4XZX A;  2HWK A;  3C0R A;  4BOQ A;  4GUA A;  1PVJ A;  4OW0 A;  3PHW A;  3PRP A;  3PT2 A;  4D8E A;  3W30 A;  4P16 A;  3MJ5 A;  5JZE A;  4PT5 A;  3MTV A;  3PHX A;  2JRI A;  4BOP A;  3O65 A;  2DOS A;  3BBA A;  3PSE A;  4IUM A;  4M0W A;  4IP3 A;  5EZS A;  4A5U A;  5EZQ A;  2J7Q C;  4RNA A;  2BTW B;  2UZJ A;  4ZTB A;  3MP2 A;  3E9S A;  4D8I A;  2AGA A;  4OVZ B;  1DKI A;  3TMP A;  2JTC A;  3PRM A;  1UKF A;  4MI7 A;  4BOU A;  4BOS A;  5KO3 A;  2BTW A;  4RF0 A;  3W31 A;  4WUR A;  2J7Q A;  4OVZ A;  4RKX A;  3TRK A;  1YZB A;  3RNV A;  2FE8 A;  3B21 A;  4R3D A;  4MM3 B;  3BB7 A;  4D8B A;  3OQC A;  2BU3 A;  4RF1 A;  4HXD B;  4REZ A;  2Z84 A;  3ZNH A;  5E6J A;  3IFU A;  4BOZ A;  3PHU A;  3BY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...