3PHXA

Otu domain of crimean congo hemorrhagic fever virus in complex with isg15
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
GPMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVSDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords RNA-directed RNA polymerase L
publication title Molecular basis for ubiquitin and ISG15 cross-reactivity in viral ovarian tumor domains.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
total genus 48
structure length 162
sequence length 164
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3phxA00
3ZNHA 4BOUA 4BOQA 3PSEA 4BOZA 3PRMA 4HXDB 4BOSA 3PT2A 5JZEA 3PHUA 3PHWA 3TMPA 4BOPA 3BY4A 3PRPA 3C0RA 3PHXA
chains in the Genus database with same CATH superfamily
1Y08A 3PRMA 3MTVA 2IBIA 1TU6A 2XU4A 2OULA 4BOQA 1XKGA 4CDDB 4BPVA 3MJ5A 2G8EA 4YYRA 2XU1A 3H89A 3B79A 4QH6A 2BU3A 1MEMA 5FPWA 3K8UA 1NL6A 4N4ZA 1AIMA 5CHVA 4FJCA 4QRXA 2DC6A 1PVJA 2E01A 3N3GA 8PCHA 3IOQA 2YJBA 3E9SA 4BOSA 1AYVA 3PDFA 4XR7A 2P7UA 3BBAA 4XZXA 2VHSA 2C0YA 2JRIA 5A24A 1CQDA 2JQGR 3OVXA 3USVA 4A5UA 1CS8A 1AYUA 1THEA 4YYWA 1ITOA 4Q8GA 2F7DA 1AU0A 1X9YA 4QRGA 1CVZA 1AU3A 2AS8A 1KFXL 1NLJA 1IWDA 3H8BA 2E00A 5EZSA 1AU2A 1VJVA 3B21A 4WA6A 1AYWA 1DF0A 3OF8A 3H6SA 3LXSA 2G7YA 1SNKA 2AGAA 3W31A 1GECE 3N3KA 1QDQA 3PNRA 3TRKA 3P5UA 3D6SA 3RVWA 2G8JA 1YK8A 1O0EA 1YZBA 3MHHA 2PREA 1PCIA 4RY2A 4BOZA 2HXZA 3MP2A 1ATKA 3K24A 4N79A 3KWZA 1QMYA 1F2CA 4PT5A 2HHNA 2R6NA 1VSNA 1Y4HA 2AVWA 3HHAA 1EF7A 3HHIA 7PCKA 3PHUA 3DF0A 3C0RA 3PHXA 2YJCA 3NHEA 3QSDA 4BS5A 3BPMA 4OVZA 1JQPA 3MHSA 3V6CA 3MORA 4CDFB 1CB5A 1YVBA 3BC3A 2FUDA 4AXLA 3M99A 2NQDB 3HWNA 4YYSA 1EWPA 9PAPA 4PP2E 3N4CA 1ME3A 1ME4A 2DCAA 5J94A 1U5IA 3O1GA 2VHFA 3O65A 2E03A 2Y6EA 4AXMA 3KW9A 1PBHA 2Y5BA 4CDEB 2DCBA 2ARYA 3IFUA 4Q8HA 3CBKA 2O6XA 2DC7A 2P0RA 2PBHA 3C9EA 5EZQA 2AU1A 4P6GA 2WBFX 1AU4A 1DEUA 2HWKA 4FK5A 4MSXA 3PW3A 4MZSA 4YVAA 1EWMA 1POPA 2IPPB 2FRAA 2YJ2A 3F75A 4K7CA 3GCBA 4P6EA 2NQGA 3KWBX 4BQVA 2H7JA 2FYEA 1PIPA 4D8IA 1CPJA 3WXEA 1QXPA 1NB3A 4OEMA 1FH0A 2DZYA 3E1ZB 1F2BA 2ACTA 1ZCMA 4MZOA 1STFE 4X6IA 2DC9A 2B1MA 3RVXA 1KXRA 4HXDB 1U9QX 5PADA 1KHPA 4FIPA 1A6RA 3IV2A 1GLOA 1AECA 2FTDA 1SP4B 3BWKA 4HWYA 3RNVA 3OVZA 2JQFR 1GCBA 4ZUXU 3LFYA 4N8WA 4XUIA 4RNAA 4YYUA 1BY8A 2CIOA 2FO5A 4DMYA 3U8EA 1PPDA 3ZUAA 2YJ9A 1U9VA 3HD3A 4I05A 1F2AA 1NQCA 3IHPA 4CZWA 2Z84A 2AIMA 5CHTA 1KHQA 3QJ3A 5CVOB 2PADA 1F29A 1YALA 2FRQA 1PADA 2NQIA 1EWLA 3IEJA 3OISA 2DJGB 5EGWA 2DOSA 2CB5A 1U9WA 5JA7A 4QBBA 4CDCB 4YYQA 1BGOA 3QT4A 4M0WA 2R9FA 4KLBA 3W30A 4RKXA 4OVZB 4I04A 2HD5A 3PBHA 3P5WA 4BSQA 1CSBB 3P5VA 4YYVA 3BY4A 1EWOA 1M6DA 5E6JA 4OELA 1CTEA 3OQCA 5EF4A 3K9MA 2G6DA 2BDZA 1BP4A 2XU5A 4IP3A 1GMYA 3RVVA 3BOWA 1PPPA 1MIRA 4X6JA 1HUCB 5CVMA 1YK7A 2R9CA 1PXVA 3KKUA 2BDLA 3TNXA 1TL9A 3V6EA 3F5VA 3S3RA 1MHWA 3WXGA 4BS6A 1MDWA 2J7QC 4PI3A 3WXFA 4P16A 3TMPA 3IMAA 3CBJA 2HH5A 4DMXA 4W5CA 3KSEA 3H8CA 4YV8A 1MS6A 2DCCA 4GUAA 3S3QA 1PPNA 4RF1A 2DZZA 2YJ8A 5JZEA 1UKFA 4PADA 3BCNA 2AYOA 4RF0A 1YT7A 4MI7A 1S4VA 4D8EA 2R9MA 2AUXA 2DC8A 3IUTA 1CJLA 3I06A 3AI8A 1Q6KA 1U9XA 2FE8A 2P86A 3ZNHA 1PE6A 3MTNA 3CH3X 2R9OA 3PHWA 4PP1A 3I3TA 2J7QA 2BTWA 2OP3A 5KO3A 1ICFA 2GHUA 4W5BA 3CH2X 1QOLA 2F1GA 1BQIA 1NB5A 3H7DA 4R3DA 4IUMA 2B1NA 4BOUA 4ZTBA 1NPZA 4QRVA 1PPOA 2BTWB 3KFQA 3O0UA 4OW0A 1DKIA 4X6HA 1TLOA 6PADA 2JTCA 3BB7A 2GFOA 1MEGA 3PT2A 5CVNB 2AYNA 4G54A 2FT2A 1ZIVA 3BPFA 3KX1A 4REZA 3PRPA 2XU3A 1CV8A 5F02A 2NQAA 3PSEA 3P5XA 3ERVA 1K3BB 4MM3B 4BOPA 2R9NA 3OF9A 2PNSA 1KFUL 4D8BA 4WURA 4W4UA 2ATOA 2AUZA 5K16A 2E02A 2FQ9A 2DCDA 5JH3A 2DJFB 2OZ2A 4I07A 2UZJA
chains in the Genus database with same CATH topology
4PT5A 3PRMA 3MTVA 4P16A 3TMPA 4BOQA 3RNVA 3MJ5A 3PHUA 3C0RA 3PHXA 4GUAA 4RF1A 2BU3A 5JZEA 1UKFA 4RF0A 4MI7A 4OVZA 4RNAA 4D8EA 1PVJA 3E9SA 2FE8A 4BOSA 3BBAA 4XZXA 3ZNHA 2JRIA 3PHWA 2J7QA 2BTWA 5KO3A 4A5UA 3O65A 2Z84A 4R3DA 3IFUA 4IUMA 4BOUA 2DOSA 4ZTBA 5EZQA 2BTWB 4OW0A 2HWKA 1DKIA 4M0WA 3W30A 4RKXA 4OVZB 2JTCA 5EZSA 3BB7A 3B21A 3PT2A 4REZA 3BY4A 3PRPA 2AGAA 3W31A 5E6JA 3TRKA 4D8IA 3OQCA 3PSEA 4MM3B 4BOPA 4IP3A 4D8BA 1YZBA 4WURA 4BOZA 3MP2A 2UZJA 4HXDB 2J7QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNH A;  4BOU A;  4BOQ A;  3PSE A;  4BOZ A;  3PRM A;  4HXD B;  4BOS A;  3PT2 A;  5JZE A;  3PHU A;  3PHW A;  3TMP A;  4BOP A;  3BY4 A;  3PRP A;  3C0R A;  3PHX A; 
#chains in the Genus database with same CATH topology
 1Y08 A;  3PRM A;  3MTV A;  2IBI A;  1TU6 A;  2XU4 A;  2OUL A;  4BOQ A;  1XKG A;  4CDD B;  4BPV A;  3MJ5 A;  2G8E A;  4YYR A;  2XU1 A;  3H89 A;  3B79 A;  4QH6 A;  2BU3 A;  1MEM A;  5FPW A;  3K8U A;  1NL6 A;  4N4Z A;  1AIM A;  5CHV A;  4FJC A;  4QRX A;  2DC6 A;  1PVJ A;  2E01 A;  3N3G A;  8PCH A;  3IOQ A;  2YJB A;  3E9S A;  4BOS A;  1AYV A;  3PDF A;  4XR7 A;  2P7U A;  3BBA A;  4XZX A;  2VHS A;  2C0Y A;  2JRI A;  5A24 A;  1CQD A;  2JQG R;  3OVX A;  3USV A;  4A5U A;  1CS8 A;  1AYU A;  1THE A;  4YYW A;  1ITO A;  4Q8G A;  2F7D A;  1AU0 A;  1X9Y A;  4QRG A;  1CVZ A;  1AU3 A;  2AS8 A;  1KFX L;  1NLJ A;  1IWD A;  3H8B A;  2E00 A;  5EZS A;  1AU2 A;  1VJV A;  3B21 A;  4WA6 A;  1AYW A;  1DF0 A;  3OF8 A;  3H6S A;  3LXS A;  2G7Y A;  1SNK A;  2AGA A;  3W31 A;  1GEC E;  3N3K A;  1QDQ A;  3PNR A;  3TRK A;  3P5U A;  3D6S A;  3RVW A;  2G8J A;  1YK8 A;  1O0E A;  1YZB A;  3MHH A;  2PRE A;  1PCI A;  4RY2 A;  4BOZ A;  2HXZ A;  3MP2 A;  1ATK A;  3K24 A;  4N79 A;  3KWZ A;  1QMY A;  1F2C A;  4PT5 A;  2HHN A;  2R6N A;  1VSN A;  1Y4H A;  2AVW A;  3HHA A;  1EF7 A;  3HHI A;  7PCK A;  3PHU A;  3DF0 A;  3C0R A;  3PHX A;  2YJC A;  3NHE A;  3QSD A;  4BS5 A;  3BPM A;  4OVZ A;  1JQP A;  3MHS A;  3V6C A;  3MOR A;  4CDF B;  1CB5 A;  1YVB A;  3BC3 A;  2FUD A;  4AXL A;  3M99 A;  2NQD B;  3HWN A;  4YYS A;  1EWP A;  9PAP A;  4PP2 E;  3N4C A;  1ME3 A;  1ME4 A;  2DCA A;  5J94 A;  1U5I A;  3O1G A;  2VHF A;  3O65 A;  2E03 A;  2Y6E A;  4AXM A;  3KW9 A;  1PBH A;  2Y5B A;  4CDE B;  2DCB A;  2ARY A;  3IFU A;  4Q8H A;  3CBK A;  2O6X A;  2DC7 A;  2P0R A;  2PBH A;  3C9E A;  5EZQ A;  2AU1 A;  4P6G A;  2WBF X;  1AU4 A;  1DEU A;  2HWK A;  4FK5 A;  4MSX A;  3PW3 A;  4MZS A;  4YVA A;  1EWM A;  1POP A;  2IPP B;  2FRA A;  2YJ2 A;  3F75 A;  4K7C A;  3GCB A;  4P6E A;  2NQG A;  3KWB X;  4BQV A;  2H7J A;  2FYE A;  1PIP A;  4D8I A;  1CPJ A;  3WXE A;  1QXP A;  1NB3 A;  4OEM A;  1FH0 A;  2DZY A;  3E1Z B;  1F2B A;  2ACT A;  1ZCM A;  4MZO A;  1STF E;  4X6I A;  2DC9 A;  2B1M A;  3RVX A;  1KXR A;  4HXD B;  1U9Q X;  5PAD A;  1KHP A;  4FIP A;  1A6R A;  3IV2 A;  1GLO A;  1AEC A;  2FTD A;  1SP4 B;  3BWK A;  4HWY A;  3RNV A;  3OVZ A;  2JQF R;  1GCB A;  4ZUX U;  3LFY A;  4N8W A;  4XUI A;  4RNA A;  4YYU A;  1BY8 A;  2CIO A;  2FO5 A;  4DMY A;  3U8E A;  1PPD A;  3ZUA A;  2YJ9 A;  1U9V A;  3HD3 A;  4I05 A;  1F2A A;  1NQC A;  3IHP A;  4CZW A;  2Z84 A;  2AIM A;  5CHT A;  1KHQ A;  3QJ3 A;  5CVO B;  2PAD A;  1F29 A;  1YAL A;  2FRQ A;  1PAD A;  2NQI A;  1EWL A;  3IEJ A;  3OIS A;  2DJG B;  5EGW A;  2DOS A;  2CB5 A;  1U9W A;  5JA7 A;  4QBB A;  4CDC B;  4YYQ A;  1BGO A;  3QT4 A;  4M0W A;  2R9F A;  4KLB A;  3W30 A;  4RKX A;  4OVZ B;  4I04 A;  2HD5 A;  3PBH A;  3P5W A;  4BSQ A;  1CSB B;  3P5V A;  4YYV A;  3BY4 A;  1EWO A;  1M6D A;  5E6J A;  4OEL A;  1CTE A;  3OQC A;  5EF4 A;  3K9M A;  2G6D A;  2BDZ A;  1BP4 A;  2XU5 A;  4IP3 A;  1GMY A;  3RVV A;  3BOW A;  1PPP A;  1MIR A;  4X6J A;  1HUC B;  5CVM A;  1YK7 A;  2R9C A;  1PXV A;  3KKU A;  2BDL A;  3TNX A;  1TL9 A;  3V6E A;  3F5V A;  3S3R A;  1MHW A;  3WXG A;  4BS6 A;  1MDW A;  2J7Q C;  4PI3 A;  3WXF A;  4P16 A;  3TMP A;  3IMA A;  3CBJ A;  2HH5 A;  4DMX A;  4W5C A;  3KSE A;  3H8C A;  4YV8 A;  1MS6 A;  2DCC A;  4GUA A;  3S3Q A;  1PPN A;  4RF1 A;  2DZZ A;  2YJ8 A;  5JZE A;  1UKF A;  4PAD A;  3BCN A;  2AYO A;  4RF0 A;  1YT7 A;  4MI7 A;  1S4V A;  4D8E A;  2R9M A;  2AUX A;  2DC8 A;  3IUT A;  1CJL A;  3I06 A;  3AI8 A;  1Q6K A;  1U9X A;  2FE8 A;  2P86 A;  3ZNH A;  1PE6 A;  3MTN A;  3CH3 X;  2R9O A;  3PHW A;  4PP1 A;  3I3T A;  2J7Q A;  2BTW A;  2OP3 A;  5KO3 A;  1ICF A;  2GHU A;  4W5B A;  3CH2 X;  1QOL A;  2F1G A;  1BQI A;  1NB5 A;  3H7D A;  4R3D A;  4IUM A;  2B1N A;  4BOU A;  4ZTB A;  1NPZ A;  4QRV A;  1PPO A;  2BTW B;  3KFQ A;  3O0U A;  4OW0 A;  1DKI A;  4X6H A;  1TLO A;  6PAD A;  2JTC A;  3BB7 A;  2GFO A;  1MEG A;  3PT2 A;  5CVN B;  2AYN A;  4G54 A;  2FT2 A;  1ZIV A;  3BPF A;  3KX1 A;  4REZ A;  3PRP A;  2XU3 A;  1CV8 A;  5F02 A;  2NQA A;  3PSE A;  3P5X A;  3ERV A;  1K3B B;  4MM3 B;  4BOP A;  2R9N A;  3OF9 A;  2PNS A;  1KFU L;  4D8B A;  4WUR A;  4W4U A;  2ATO A;  2AUZ A;  5K16 A;  2E02 A;  2FQ9 A;  2DCD A;  5JH3 A;  2DJF B;  2OZ2 A;  4I07 A;  2UZJ A; 
#chains in the Genus database with same CATH homology
 4PT5 A;  3PRM A;  3MTV A;  4P16 A;  3TMP A;  4BOQ A;  3RNV A;  3MJ5 A;  3PHU A;  3C0R A;  3PHX A;  4GUA A;  4RF1 A;  2BU3 A;  5JZE A;  1UKF A;  4RF0 A;  4MI7 A;  4OVZ A;  4RNA A;  4D8E A;  1PVJ A;  3E9S A;  2FE8 A;  4BOS A;  3BBA A;  4XZX A;  3ZNH A;  2JRI A;  3PHW A;  2J7Q A;  2BTW A;  5KO3 A;  4A5U A;  3O65 A;  2Z84 A;  4R3D A;  3IFU A;  4IUM A;  4BOU A;  2DOS A;  4ZTB A;  5EZQ A;  2BTW B;  4OW0 A;  2HWK A;  1DKI A;  4M0W A;  3W30 A;  4RKX A;  4OVZ B;  2JTC A;  5EZS A;  3BB7 A;  3B21 A;  3PT2 A;  4REZ A;  3BY4 A;  3PRP A;  2AGA A;  3W31 A;  5E6J A;  3TRK A;  4D8I A;  3OQC A;  3PSE A;  4MM3 B;  4BOP A;  4IP3 A;  4D8B A;  1YZB A;  4WUR A;  4BOZ A;  3MP2 A;  2UZJ A;  4HXD B;  2J7Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...