1PXVA

The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
183
Chain Sequence
GHHHHHHEFDQVQYENTLKNFKIREQQFDNSWAAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cysteine protease
publication title The Staphostatin-Staphopain Complex: A FORWARD BINDING INHIBITOR IN COMPLEX WITH ITS TARGET CYSTEINE PROTEASE.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 53
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pxvA00
2ATOA 1PIPA 1PPOA 1GLOA 4QRXA 4QH6A 3CBKA 4CDDB 4CZWA 1AU0A 2GHUA 4YYQA 3TNXA 3KKUA 1JQPA 1CB5A 2JQFR 1POPA 3HD3A 2E03A 2NQAA 4CDEB 1AYWA 2DZZA 2R6NA 2FUDA 1CS8A 4P6EA 2R9OA 3WXFA 1TL9A 2FRQA 1Q6KA 3KWZA 2O6XA 1Y4HA 2JQGR 2H7JA 2HHNA 1XKGA 2XU4A 2AUZA 1STFE 1NB5A 5JH3A 4FIPA 1CQDA 2DCAA 4XUIA 4RY2A 2ACTA 3LFYA 3ZUAA 4CDCB 5CVMA 1MIRA 4WA6A 4PP2E 1HUCB 4PADA 2FTDA 9PAPA 3N3KA 1TLOA 6PADA 1GECE 1Y08A 4X6IA 1BP4A 1QXPA 4YYSA 1CTEA 2PBHA 2HXZA 2XU5A 1PPDA 3PW3A 3F5VA 1GCBA 2DCBA 4BS6A 3KWBX 4QBBA 4AXMA 1CV8A 2OULA 1ITOA 3WXEA 2F1GA 3N4CA 1KFXL 2HH5A 2G7YA 3KX1A 2YJ9A 2DJFB 2Y5BA 1GMYA 3OVXA 1AYVA 3PDFA 3USVA 4PI3A 1NL6A 4BPVA 2ARYA 1KHPA 4N8WA 3QSDA 1NLJA 4DMXA 3K24A 4ZUXU 4G54A 1YALA 4XR7A 3GCBA 4MZSA 3BPFA 3OF8A 4BS5A 4BSQA 4MZOA 1AECA 5CHVA 1MDWA 4CDFB 3H8CA 1PCIA 1FH0A 3OVZA 1BQIA 3H7DA 1KFUL 2F7DA 2B1NA 1NB3A 3IOQA 2YJBA 1AU3A 4AXLA 4YYRA 1TU6A 1MEGA 4DMYA 3QT4A 2FQ9A 3I3TA 3O0UA 2DJGB 1S4VA 1NPZA 3IMAA 1ZCMA 2DCDA 4X6HA 1EWLA 2BDLA 2R9FA 1DEUA 1CSBB 1A6RA 4YVAA 5CVOB 4W5CA 2OP3A 2BDZA 5F02A 1SP4B 8PCHA 2G6DA 1PADA 3D6SA 1CPJA 5A24A 1YVBA 1EWMA 2NQGA 3S3RA 2E01A 4YV8A 4YYVA 3BC3A 2PADA 4YYUA 1QOLA 3MORA 2E00A 4HWYA 5J94A 1BGOA 1IWDA 3K8UA 2XU1A 4MSXA 3P5WA 3C9EA 2AYOA 2E02A 4I04A 4QRVA 1EF7A 2HD5A 1MEMA 1ME4A 4FJCA 2R9NA 2DCCA 3I06A 3B79A 3CH2X 3CH3X 2YJ8A 3M99A 1YK7A 3K9MA 2C0YA 3AI8A 3IHPA 4Q8GA 3WXGA 1QDQA 3PNRA 4K7CA 2G8EA 2DC7A 3BPMA 3IEJA 1U9QX 3RVXA 3V6EA 4YYWA 2YJ2A 2IPPB 3ERVA 4PP1A 3P5VA 2P0RA 3BOWA 1ATKA 2GFOA 4X6JA 3S3QA 4QRGA 1ZIVA 2NQDB 7PCKA 3H6SA 3KW9A 1KXRA 2AUXA 1CVZA 2OZ2A 2NQIA 3OF9A 5CHTA 1U9XA 1F2BA 2FT2A 2DC8A 1AU4A 2DZYA 3QJ3A 1PE6A 3E1ZB 5PADA 2CIOA 2AU1A 2PNSA 3H89A 1AYUA 3BWKA 1PPPA 1YT7A 4OELA 1U9WA 3CBJA 1PXVA 2VHSA 1ICFA 2FYEA 3NHEA 3F75A 1K3BB 3DF0A 3MHHA 5FPWA 1PBHA 2WBFX 2VHFA 1THEA 4N79A 3V6CA 2B1MA 1ME3A 4OEMA 1X9YA 4BQVA 1SNKA 1U9VA 2R9CA 3LXSA 1PPNA 3O1GA 1CJLA 3MTNA 3MHSA 2AYNA 2AVWA 2R9MA 1QMYA 2PREA 2YJCA 1O0EA 3BCNA 1MS6A 2G8JA 3IV2A 2P86A 4N4ZA 4KLBA 4FK5A 1MHWA 1VJVA 3KSEA 2DC6A 2P7UA 3RVWA 3P5XA 3IUTA 1VSNA 2IBIA 3HHAA 1KHQA 1AIMA 4P6GA 4I05A 2Y6EA 1EWPA 1AU2A 3P5UA 2AS8A 1YK8A 1DF0A 1EWOA 5CVNB 1M6DA 4Q8HA 3U8EA 2DC9A 4W4UA 1U5IA 5JA7A 1NQCA 2FRAA 3RVVA 3H8BA 3OISA 5K16A 5EF4A 1F29A 1BY8A 4W5BA 3HWNA 3PBHA 3N3GA 1F2AA 3HHIA 2AIMA 2XU3A 1F2CA 2CB5A 3KFQA 4I07A 2FO5A 5EGWA
chains in the Genus database with same CATH superfamily
3O65A 2ATOA 1PIPA 1PPOA 1GLOA 4QRXA 4QH6A 2DOSA 3B21A 3CBKA 4CDDB 4CZWA 3C0RA 1AU0A 2GHUA 4YYQA 4D8IA 3TNXA 3KKUA 1JQPA 1CB5A 4REZA 2JQFR 1POPA 3HD3A 4R3DA 2E03A 2NQAA 4CDEB 1AYWA 2DZZA 2R6NA 2FUDA 1CS8A 4P6EA 2R9OA 3WXFA 1TL9A 2FRQA 1Q6KA 3KWZA 2O6XA 1Y4HA 2JQGR 4RNAA 2H7JA 2HHNA 1XKGA 5KO3A 2XU4A 2AUZA 1STFE 1NB5A 5JH3A 4FIPA 1CQDA 2DCAA 4RKXA 4XUIA 4RY2A 2ACTA 3LFYA 3ZUAA 4OVZB 4CDCB 5CVMA 1MIRA 4WA6A 4PP2E 3E9SA 3RNVA 1HUCB 4PADA 2FTDA 9PAPA 3N3KA 1TLOA 6PADA 1GECE 3IFUA 1Y08A 4X6IA 1BP4A 1QXPA 4YYSA 5EZSA 1CTEA 2PBHA 2HXZA 3BY4A 2XU5A 1PPDA 3PW3A 3F5VA 1GCBA 2DCBA 4BS6A 3KWBX 3BB7A 4QBBA 4AXMA 3TMPA 1CV8A 2OULA 1ITOA 3WXEA 2F1GA 3N4CA 4BOPA 1KFXL 2HH5A 2G7YA 5JZEA 3KX1A 2YJ9A 2DJFB 2Y5BA 1GMYA 4GUAA 3W31A 3OVXA 1AYVA 3PDFA 3USVA 4PI3A 4HXDB 1NL6A 4BPVA 2ARYA 4OVZA 1KHPA 2J7QA 4N8WA 3QSDA 1NLJA 4DMXA 3K24A 2BU3A 4ZUXU 4G54A 4RF1A 1YALA 4XR7A 3GCBA 4MZSA 3BPFA 3MJ5A 3OF8A 4BS5A 4BSQA 4MZOA 1AECA 5CHVA 1MDWA 4CDFB 3H8CA 1PCIA 1FH0A 3OVZA 1BQIA 3H7DA 1KFUL 2F7DA 2B1NA 1NB3A 3IOQA 2YJBA 1AU3A 4MI7A 4AXLA 1TU6A 1MEGA 4DMYA 4YYRA 3QT4A 2FQ9A 3BBAA 3I3TA 3O0UA 2DJGB 1S4VA 1NPZA 3IMAA 1ZCMA 2DCDA 4X6HA 1EWLA 2BDLA 2R9FA 3W30A 1DEUA 1CSBB 1A6RA 3PHWA 4YVAA 5CVOB 4W5CA 2OP3A 4BOSA 4BOUA 2BDZA 5F02A 3PHXA 1SP4B 8PCHA 2G6DA 1PADA 3D6SA 1CPJA 5A24A 1YVBA 1EWMA 2NQGA 1YZBA 3S3RA 2E01A 3PRMA 4YV8A 4YYVA 3BC3A 2PADA 4YYUA 1QOLA 3MORA 2E00A 4HWYA 5J94A 1BGOA 1IWDA 3K8UA 2XU1A 4BOZA 4MSXA 4IUMA 2UZJA 3P5WA 3C9EA 2AYOA 3ZNHA 2E02A 4I04A 4QRVA 1EF7A 2HD5A 2JTCA 1MEMA 1ME4A 4FJCA 2R9NA 2DCCA 3I06A 3B79A 3CH2X 2BTWB 3CH3X 2YJ8A 3M99A 5E6JA 1YK7A 3K9MA 2C0YA 3AI8A 3IHPA 4Q8GA 3WXGA 1QDQA 4MM3B 3OQCA 3PNRA 4K7CA 4P16A 2G8EA 2DC7A 3BPMA 4PT5A 3IEJA 1U9QX 3RVXA 3V6EA 4YYWA 2YJ2A 2IPPB 3ERVA 4PP1A 4A5UA 3P5VA 2P0RA 3BOWA 3PSEA 1ATKA 2GFOA 3MP2A 4X6JA 3S3QA 4QRGA 1ZIVA 2NQDB 7PCKA 3H6SA 3KW9A 1KXRA 2AUXA 1CVZA 2OZ2A 2NQIA 3OF9A 3PRPA 5CHTA 1PVJA 5EZQA 1U9XA 2Z84A 1F2BA 2FT2A 2DC8A 1AU4A 2DZYA 3QJ3A 1PE6A 3E1ZB 5PADA 2CIOA 4BOQA 2AU1A 2PNSA 3H89A 2BTWA 1AYUA 3BWKA 1DKIA 1PPPA 1YT7A 4OELA 1U9WA 3CBJA 1PXVA 2VHSA 4XZXA 1ICFA 2FYEA 3PHUA 2HWKA 3NHEA 3F75A 1K3BB 3DF0A 3MHHA 5FPWA 4M0WA 1PBHA 2WBFX 2VHFA 1THEA 4N79A 3V6CA 2B1MA 1ME3A 4OEMA 4OW0A 1X9YA 4BQVA 1SNKA 1U9VA 2R9CA 3LXSA 1PPNA 3O1GA 1CJLA 3MTNA 3MHSA 2AYNA 2AVWA 2R9MA 1QMYA 3TRKA 2PREA 2AGAA 2YJCA 1O0EA 3BCNA 3PT2A 1MS6A 2G8JA 4RF0A 4D8BA 4ZTBA 3IV2A 2P86A 4N4ZA 4KLBA 4FK5A 1MHWA 1VJVA 3KSEA 2DC6A 2P7UA 3RVWA 3P5XA 3IUTA 1VSNA 2IBIA 3HHAA 1KHQA 4D8EA 1AIMA 2J7QC 4P6GA 3MTVA 4I05A 2Y6EA 1EWPA 1AU2A 3P5UA 2AS8A 1YK8A 1DF0A 1EWOA 5CVNB 1M6DA 4Q8HA 4WURA 4IP3A 3U8EA 2DC9A 1UKFA 4W4UA 1U5IA 5JA7A 1NQCA 2FE8A 2FRAA 3RVVA 3H8BA 3OISA 5K16A 5EF4A 1F29A 1BY8A 4W5BA 3HWNA 3PBHA 3N3GA 1F2AA 3HHIA 2AIMA 2XU3A 1F2CA 2CB5A 2JRIA 3KFQA 4I07A 2FO5A 5EGWA
chains in the Genus database with same CATH topology
2ATOA 1PIPA 1PPOA 1GLOA 4QRXA 4QH6A 3CBKA 4CDDB 4CZWA 1AU0A 2GHUA 3LTWA 4YYQA 3TNXA 3KKUA 1JQPA 1CB5A 2JQFR 1POPA 1W6FA 3HD3A 2E03A 2NQAA 4CDEB 1AYWA 2DZZA 2R6NA 2FUDA 1CS8A 1W5RA 4P6EA 2R9OA 3WXFA 1TL9A 2FRQA 1Q6KA 3KWZA 2O6XA 1Y4HA 2JQGR 2H7JA 2HHNA 1XKGA 2XU4A 2AUZA 1STFE 1NB5A 5JH3A 4FIPA 1CQDA 2DCAA 4XUIA 4RY2A 2ACTA 3LFYA 3ZUAA 4CDCB 5CVMA 1MIRA 4WA6A 4PP2E 1HUCB 4PADA 2FTDA 9PAPA 3N3KA 1TLOA 6PADA 1GECE 1Y08A 4X6IA 1BP4A 1QXPA 4YYSA 1E2TA 1CTEA 2PBHA 2HXZA 2XU5A 1PPDA 3PW3A 3F5VA 1GCBA 2DCBA 4BS6A 3KWBX 4QBBA 4AXMA 1CV8A 2OULA 1ITOA 3WXEA 2F1GA 3N4CA 1KFXL 2HH5A 2G7YA 3KX1A 2YJ9A 4BGFA 2DJFB 2Y5BA 1GMYA 3OVXA 1AYVA 3PDFA 3USVA 4PI3A 1NL6A 4BPVA 2ARYA 1KHPA 2VFBA 4N8WA 4NV8A 3QSDA 4NV7A 1NLJA 4DMXA 3K24A 4ZUXU 4G54A 1YALA 4XR7A 3GCBA 4MZSA 3BPFA 3OF8A 4BS5A 4BSQA 4MZOA 1AECA 5CHVA 1MDWA 4CDFB 3H8CA 1PCIA 1FH0A 3OVZA 1BQIA 3H7DA 4B55A 1KFUL 2F7DA 2B1NA 1NB3A 3IOQA 2YJBA 1AU3A 4AXLA 4YYRA 1TU6A 1MEGA 4DMYA 3QT4A 2FQ9A 3I3TA 3O0UA 2DJGB 1S4VA 1NPZA 3IMAA 1ZCMA 2DCDA 4X6HA 1EWLA 2BDLA 2R9FA 1DEUA 1CSBB 1A6RA 4YVAA 5CVOB 4W5CA 2OP3A 2BDZA 5F02A 1SP4B 8PCHA 2G6DA 1PADA 3D6SA 1CPJA 5A24A 1YVBA 1EWMA 2NQGA 4GUZA 3S3RA 2E01A 4YV8A 2BSZA 4YYVA 3BC3A 2PADA 4YYUA 1QOLA 3MORA 2E00A 4HWYA 5J94A 1BGOA 1IWDA 3K8UA 2XU1A 4MSXA 3P5WA 3C9EA 2AYOA 2E02A 4I04A 4QRVA 1EF7A 2HD5A 1MEMA 1ME4A 4FJCA 2R9NA 2DCCA 3I06A 3B79A 3CH2X 3CH3X 2YJ8A 3M99A 1YK7A 3K9MA 2C0YA 3AI8A 3IHPA 4Q8GA 3WXGA 1GX3A 1QDQA 3PNRA 4K7CA 2G8EA 2DC7A 3BPMA 3IEJA 1U9QX 3RVXA 3V6EA 4YYWA 2YJ2A 2IPPB 3ERVA 4PP1A 3P5VA 2P0RA 3BOWA 1ATKA 2GFOA 4X6JA 3S3QA 4QRGA 1ZIVA 2NQDB 7PCKA 3H6SA 3KW9A 1KXRA 2AUXA 1CVZA 2OZ2A 2NQIA 3OF9A 5CHTA 1U9XA 1F2BA 2FT2A 2DC8A 1AU4A 3QJ3A 2DZYA 2VFCA 1PE6A 3E1ZB 5PADA 2CIOA 2AU1A 2PNSA 3H89A 1AYUA 3D9WA 3BWKA 1PPPA 1YT7A 4OELA 1U9WA 3CBJA 1PXVA 2VHSA 1ICFA 2FYEA 3NHEA 3F75A 1K3BB 3DF0A 3MHHA 5FPWA 1PBHA 2WBFX 2VHFA 1THEA 4N79A 3V6CA 2B1MA 1ME3A 4OEMA 1X9YA 4BQVA 1SNKA 1U9VA 2R9CA 3LXSA 1PPNA 3O1GA 1CJLA 3MTNA 3MHSA 2AYNA 2AVWA 2R9MA 1QMYA 2PREA 2YJCA 1O0EA 3BCNA 1MS6A 2G8JA 3IV2A 2P86A 4N4ZA 4KLBA 4FK5A 1MHWA 1VJVA 3KSEA 2DC6A 2P7UA 3RVWA 3P5XA 4C5PA 3IUTA 1VSNA 2IBIA 3HHAA 1KHQA 1AIMA 4P6GA 4I05A 2Y6EA 1EWPA 1AU2A 3P5UA 2AS8A 1YK8A 1DF0A 1EWOA 5CVNB 1M6DA 4Q8HA 3U8EA 2DC9A 4W4UA 1U5IA 1W4TA 5JA7A 1NQCA 2FRAA 3RVVA 3H8BA 3OISA 5K16A 5EF4A 1F29A 1BY8A 4W5BA 3HWNA 3PBHA 3N3GA 1F2AA 3HHIA 2AIMA 2XU3A 1F2CA 2CB5A 3KFQA 4I07A 2FO5A 5EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATO A;  1PIP A;  1PPO A;  1GLO A;  4QRX A;  4QH6 A;  3CBK A;  4CDD B;  4CZW A;  1AU0 A;  2GHU A;  4YYQ A;  3TNX A;  3KKU A;  1JQP A;  1CB5 A;  2JQF R;  1POP A;  3HD3 A;  2E03 A;  2NQA A;  4CDE B;  1AYW A;  2DZZ A;  2R6N A;  2FUD A;  1CS8 A;  4P6E A;  2R9O A;  3WXF A;  1TL9 A;  2FRQ A;  1Q6K A;  3KWZ A;  2O6X A;  1Y4H A;  2JQG R;  2H7J A;  2HHN A;  1XKG A;  2XU4 A;  2AUZ A;  1STF E;  1NB5 A;  5JH3 A;  4FIP A;  1CQD A;  2DCA A;  4XUI A;  4RY2 A;  2ACT A;  3LFY A;  3ZUA A;  4CDC B;  5CVM A;  1MIR A;  4WA6 A;  4PP2 E;  1HUC B;  4PAD A;  2FTD A;  9PAP A;  3N3K A;  1TLO A;  6PAD A;  1GEC E;  1Y08 A;  4X6I A;  1BP4 A;  1QXP A;  4YYS A;  1CTE A;  2PBH A;  2HXZ A;  2XU5 A;  1PPD A;  3PW3 A;  3F5V A;  1GCB A;  2DCB A;  4BS6 A;  3KWB X;  4QBB A;  4AXM A;  1CV8 A;  2OUL A;  1ITO A;  3WXE A;  2F1G A;  3N4C A;  1KFX L;  2HH5 A;  2G7Y A;  3KX1 A;  2YJ9 A;  2DJF B;  2Y5B A;  1GMY A;  3OVX A;  1AYV A;  3PDF A;  3USV A;  4PI3 A;  1NL6 A;  4BPV A;  2ARY A;  1KHP A;  4N8W A;  3QSD A;  1NLJ A;  4DMX A;  3K24 A;  4ZUX U;  4G54 A;  1YAL A;  4XR7 A;  3GCB A;  4MZS A;  3BPF A;  3OF8 A;  4BS5 A;  4BSQ A;  4MZO A;  1AEC A;  5CHV A;  1MDW A;  4CDF B;  3H8C A;  1PCI A;  1FH0 A;  3OVZ A;  1BQI A;  3H7D A;  1KFU L;  2F7D A;  2B1N A;  1NB3 A;  3IOQ A;  2YJB A;  1AU3 A;  4AXL A;  4YYR A;  1TU6 A;  1MEG A;  4DMY A;  3QT4 A;  2FQ9 A;  3I3T A;  3O0U A;  2DJG B;  1S4V A;  1NPZ A;  3IMA A;  1ZCM A;  2DCD A;  4X6H A;  1EWL A;  2BDL A;  2R9F A;  1DEU A;  1CSB B;  1A6R A;  4YVA A;  5CVO B;  4W5C A;  2OP3 A;  2BDZ A;  5F02 A;  1SP4 B;  8PCH A;  2G6D A;  1PAD A;  3D6S A;  1CPJ A;  5A24 A;  1YVB A;  1EWM A;  2NQG A;  3S3R A;  2E01 A;  4YV8 A;  4YYV A;  3BC3 A;  2PAD A;  4YYU A;  1QOL A;  3MOR A;  2E00 A;  4HWY A;  5J94 A;  1BGO A;  1IWD A;  3K8U A;  2XU1 A;  4MSX A;  3P5W A;  3C9E A;  2AYO A;  2E02 A;  4I04 A;  4QRV A;  1EF7 A;  2HD5 A;  1MEM A;  1ME4 A;  4FJC A;  2R9N A;  2DCC A;  3I06 A;  3B79 A;  3CH2 X;  3CH3 X;  2YJ8 A;  3M99 A;  1YK7 A;  3K9M A;  2C0Y A;  3AI8 A;  3IHP A;  4Q8G A;  3WXG A;  1QDQ A;  3PNR A;  4K7C A;  2G8E A;  2DC7 A;  3BPM A;  3IEJ A;  1U9Q X;  3RVX A;  3V6E A;  4YYW A;  2YJ2 A;  2IPP B;  3ERV A;  4PP1 A;  3P5V A;  2P0R A;  3BOW A;  1ATK A;  2GFO A;  4X6J A;  3S3Q A;  4QRG A;  1ZIV A;  2NQD B;  7PCK A;  3H6S A;  3KW9 A;  1KXR A;  2AUX A;  1CVZ A;  2OZ2 A;  2NQI A;  3OF9 A;  5CHT A;  1U9X A;  1F2B A;  2FT2 A;  2DC8 A;  1AU4 A;  2DZY A;  3QJ3 A;  1PE6 A;  3E1Z B;  5PAD A;  2CIO A;  2AU1 A;  2PNS A;  3H89 A;  1AYU A;  3BWK A;  1PPP A;  1YT7 A;  4OEL A;  1U9W A;  3CBJ A;  1PXV A;  2VHS A;  1ICF A;  2FYE A;  3NHE A;  3F75 A;  1K3B B;  3DF0 A;  3MHH A;  5FPW A;  1PBH A;  2WBF X;  2VHF A;  1THE A;  4N79 A;  3V6C A;  2B1M A;  1ME3 A;  4OEM A;  1X9Y A;  4BQV A;  1SNK A;  1U9V A;  2R9C A;  3LXS A;  1PPN A;  3O1G A;  1CJL A;  3MTN A;  3MHS A;  2AYN A;  2AVW A;  2R9M A;  1QMY A;  2PRE A;  2YJC A;  1O0E A;  3BCN A;  1MS6 A;  2G8J A;  3IV2 A;  2P86 A;  4N4Z A;  4KLB A;  4FK5 A;  1MHW A;  1VJV A;  3KSE A;  2DC6 A;  2P7U A;  3RVW A;  3P5X A;  3IUT A;  1VSN A;  2IBI A;  3HHA A;  1KHQ A;  1AIM A;  4P6G A;  4I05 A;  2Y6E A;  1EWP A;  1AU2 A;  3P5U A;  2AS8 A;  1YK8 A;  1DF0 A;  1EWO A;  5CVN B;  1M6D A;  4Q8H A;  3U8E A;  2DC9 A;  4W4U A;  1U5I A;  5JA7 A;  1NQC A;  2FRA A;  3RVV A;  3H8B A;  3OIS A;  5K16 A;  5EF4 A;  1F29 A;  1BY8 A;  4W5B A;  3HWN A;  3PBH A;  3N3G A;  1F2A A;  3HHI A;  2AIM A;  2XU3 A;  1F2C A;  2CB5 A;  3KFQ A;  4I07 A;  2FO5 A;  5EGW A; 
#chains in the Genus database with same CATH topology
 3O65 A;  2ATO A;  1PIP A;  1PPO A;  1GLO A;  4QRX A;  4QH6 A;  2DOS A;  3B21 A;  3CBK A;  4CDD B;  4CZW A;  3C0R A;  1AU0 A;  2GHU A;  4YYQ A;  4D8I A;  3TNX A;  3KKU A;  1JQP A;  1CB5 A;  4REZ A;  2JQF R;  1POP A;  3HD3 A;  4R3D A;  2E03 A;  2NQA A;  4CDE B;  1AYW A;  2DZZ A;  2R6N A;  2FUD A;  1CS8 A;  4P6E A;  2R9O A;  3WXF A;  1TL9 A;  2FRQ A;  1Q6K A;  3KWZ A;  2O6X A;  1Y4H A;  2JQG R;  4RNA A;  2H7J A;  2HHN A;  1XKG A;  5KO3 A;  2XU4 A;  2AUZ A;  1STF E;  1NB5 A;  5JH3 A;  4FIP A;  1CQD A;  2DCA A;  4RKX A;  4XUI A;  4RY2 A;  2ACT A;  3LFY A;  3ZUA A;  4OVZ B;  4CDC B;  5CVM A;  1MIR A;  4WA6 A;  4PP2 E;  3E9S A;  3RNV A;  1HUC B;  4PAD A;  2FTD A;  9PAP A;  3N3K A;  1TLO A;  6PAD A;  1GEC E;  3IFU A;  1Y08 A;  4X6I A;  1BP4 A;  1QXP A;  4YYS A;  5EZS A;  1CTE A;  2PBH A;  2HXZ A;  3BY4 A;  2XU5 A;  1PPD A;  3PW3 A;  3F5V A;  1GCB A;  2DCB A;  4BS6 A;  3KWB X;  3BB7 A;  4QBB A;  4AXM A;  3TMP A;  1CV8 A;  2OUL A;  1ITO A;  3WXE A;  2F1G A;  3N4C A;  4BOP A;  1KFX L;  2HH5 A;  2G7Y A;  5JZE A;  3KX1 A;  2YJ9 A;  2DJF B;  2Y5B A;  1GMY A;  4GUA A;  3W31 A;  3OVX A;  1AYV A;  3PDF A;  3USV A;  4PI3 A;  4HXD B;  1NL6 A;  4BPV A;  2ARY A;  4OVZ A;  1KHP A;  2J7Q A;  4N8W A;  3QSD A;  1NLJ A;  4DMX A;  3K24 A;  2BU3 A;  4ZUX U;  4G54 A;  4RF1 A;  1YAL A;  4XR7 A;  3GCB A;  4MZS A;  3BPF A;  3MJ5 A;  3OF8 A;  4BS5 A;  4BSQ A;  4MZO A;  1AEC A;  5CHV A;  1MDW A;  4CDF B;  3H8C A;  1PCI A;  1FH0 A;  3OVZ A;  1BQI A;  3H7D A;  1KFU L;  2F7D A;  2B1N A;  1NB3 A;  3IOQ A;  2YJB A;  1AU3 A;  4MI7 A;  4AXL A;  1TU6 A;  1MEG A;  4DMY A;  4YYR A;  3QT4 A;  2FQ9 A;  3BBA A;  3I3T A;  3O0U A;  2DJG B;  1S4V A;  1NPZ A;  3IMA A;  1ZCM A;  2DCD A;  4X6H A;  1EWL A;  2BDL A;  2R9F A;  3W30 A;  1DEU A;  1CSB B;  1A6R A;  3PHW A;  4YVA A;  5CVO B;  4W5C A;  2OP3 A;  4BOS A;  4BOU A;  2BDZ A;  5F02 A;  3PHX A;  1SP4 B;  8PCH A;  2G6D A;  1PAD A;  3D6S A;  1CPJ A;  5A24 A;  1YVB A;  1EWM A;  2NQG A;  1YZB A;  3S3R A;  2E01 A;  3PRM A;  4YV8 A;  4YYV A;  3BC3 A;  2PAD A;  4YYU A;  1QOL A;  3MOR A;  2E00 A;  4HWY A;  5J94 A;  1BGO A;  1IWD A;  3K8U A;  2XU1 A;  4BOZ A;  4MSX A;  4IUM A;  2UZJ A;  3P5W A;  3C9E A;  2AYO A;  3ZNH A;  2E02 A;  4I04 A;  4QRV A;  1EF7 A;  2HD5 A;  2JTC A;  1MEM A;  1ME4 A;  4FJC A;  2R9N A;  2DCC A;  3I06 A;  3B79 A;  3CH2 X;  2BTW B;  3CH3 X;  2YJ8 A;  3M99 A;  5E6J A;  1YK7 A;  3K9M A;  2C0Y A;  3AI8 A;  3IHP A;  4Q8G A;  3WXG A;  1QDQ A;  4MM3 B;  3OQC A;  3PNR A;  4K7C A;  4P16 A;  2G8E A;  2DC7 A;  3BPM A;  4PT5 A;  3IEJ A;  1U9Q X;  3RVX A;  3V6E A;  4YYW A;  2YJ2 A;  2IPP B;  3ERV A;  4PP1 A;  4A5U A;  3P5V A;  2P0R A;  3BOW A;  3PSE A;  1ATK A;  2GFO A;  3MP2 A;  4X6J A;  3S3Q A;  4QRG A;  1ZIV A;  2NQD B;  7PCK A;  3H6S A;  3KW9 A;  1KXR A;  2AUX A;  1CVZ A;  2OZ2 A;  2NQI A;  3OF9 A;  3PRP A;  5CHT A;  1PVJ A;  5EZQ A;  1U9X A;  2Z84 A;  1F2B A;  2FT2 A;  2DC8 A;  1AU4 A;  2DZY A;  3QJ3 A;  1PE6 A;  3E1Z B;  5PAD A;  2CIO A;  4BOQ A;  2AU1 A;  2PNS A;  3H89 A;  2BTW A;  1AYU A;  3BWK A;  1DKI A;  1PPP A;  1YT7 A;  4OEL A;  1U9W A;  3CBJ A;  1PXV A;  2VHS A;  4XZX A;  1ICF A;  2FYE A;  3PHU A;  2HWK A;  3NHE A;  3F75 A;  1K3B B;  3DF0 A;  3MHH A;  5FPW A;  4M0W A;  1PBH A;  2WBF X;  2VHF A;  1THE A;  4N79 A;  3V6C A;  2B1M A;  1ME3 A;  4OEM A;  4OW0 A;  1X9Y A;  4BQV A;  1SNK A;  1U9V A;  2R9C A;  3LXS A;  1PPN A;  3O1G A;  1CJL A;  3MTN A;  3MHS A;  2AYN A;  2AVW A;  2R9M A;  1QMY A;  3TRK A;  2PRE A;  2AGA A;  2YJC A;  1O0E A;  3BCN A;  3PT2 A;  1MS6 A;  2G8J A;  4RF0 A;  4D8B A;  4ZTB A;  3IV2 A;  2P86 A;  4N4Z A;  4KLB A;  4FK5 A;  1MHW A;  1VJV A;  3KSE A;  2DC6 A;  2P7U A;  3RVW A;  3P5X A;  3IUT A;  1VSN A;  2IBI A;  3HHA A;  1KHQ A;  4D8E A;  1AIM A;  2J7Q C;  4P6G A;  3MTV A;  4I05 A;  2Y6E A;  1EWP A;  1AU2 A;  3P5U A;  2AS8 A;  1YK8 A;  1DF0 A;  1EWO A;  5CVN B;  1M6D A;  4Q8H A;  4WUR A;  4IP3 A;  3U8E A;  2DC9 A;  1UKF A;  4W4U A;  1U5I A;  5JA7 A;  1NQC A;  2FE8 A;  2FRA A;  3RVV A;  3H8B A;  3OIS A;  5K16 A;  5EF4 A;  1F29 A;  1BY8 A;  4W5B A;  3HWN A;  3PBH A;  3N3G A;  1F2A A;  3HHI A;  2AIM A;  2XU3 A;  1F2C A;  2CB5 A;  2JRI A;  3KFQ A;  4I07 A;  2FO5 A;  5EGW A; 
#chains in the Genus database with same CATH homology
 2ATO A;  1PIP A;  1PPO A;  1GLO A;  4QRX A;  4QH6 A;  3CBK A;  4CDD B;  4CZW A;  1AU0 A;  2GHU A;  3LTW A;  4YYQ A;  3TNX A;  3KKU A;  1JQP A;  1CB5 A;  2JQF R;  1POP A;  1W6F A;  3HD3 A;  2E03 A;  2NQA A;  4CDE B;  1AYW A;  2DZZ A;  2R6N A;  2FUD A;  1CS8 A;  1W5R A;  4P6E A;  2R9O A;  3WXF A;  1TL9 A;  2FRQ A;  1Q6K A;  3KWZ A;  2O6X A;  1Y4H A;  2JQG R;  2H7J A;  2HHN A;  1XKG A;  2XU4 A;  2AUZ A;  1STF E;  1NB5 A;  5JH3 A;  4FIP A;  1CQD A;  2DCA A;  4XUI A;  4RY2 A;  2ACT A;  3LFY A;  3ZUA A;  4CDC B;  5CVM A;  1MIR A;  4WA6 A;  4PP2 E;  1HUC B;  4PAD A;  2FTD A;  9PAP A;  3N3K A;  1TLO A;  6PAD A;  1GEC E;  1Y08 A;  4X6I A;  1BP4 A;  1QXP A;  4YYS A;  1E2T A;  1CTE A;  2PBH A;  2HXZ A;  2XU5 A;  1PPD A;  3PW3 A;  3F5V A;  1GCB A;  2DCB A;  4BS6 A;  3KWB X;  4QBB A;  4AXM A;  1CV8 A;  2OUL A;  1ITO A;  3WXE A;  2F1G A;  3N4C A;  1KFX L;  2HH5 A;  2G7Y A;  3KX1 A;  2YJ9 A;  4BGF A;  2DJF B;  2Y5B A;  1GMY A;  3OVX A;  1AYV A;  3PDF A;  3USV A;  4PI3 A;  1NL6 A;  4BPV A;  2ARY A;  1KHP A;  2VFB A;  4N8W A;  4NV8 A;  3QSD A;  4NV7 A;  1NLJ A;  4DMX A;  3K24 A;  4ZUX U;  4G54 A;  1YAL A;  4XR7 A;  3GCB A;  4MZS A;  3BPF A;  3OF8 A;  4BS5 A;  4BSQ A;  4MZO A;  1AEC A;  5CHV A;  1MDW A;  4CDF B;  3H8C A;  1PCI A;  1FH0 A;  3OVZ A;  1BQI A;  3H7D A;  4B55 A;  1KFU L;  2F7D A;  2B1N A;  1NB3 A;  3IOQ A;  2YJB A;  1AU3 A;  4AXL A;  4YYR A;  1TU6 A;  1MEG A;  4DMY A;  3QT4 A;  2FQ9 A;  3I3T A;  3O0U A;  2DJG B;  1S4V A;  1NPZ A;  3IMA A;  1ZCM A;  2DCD A;  4X6H A;  1EWL A;  2BDL A;  2R9F A;  1DEU A;  1CSB B;  1A6R A;  4YVA A;  5CVO B;  4W5C A;  2OP3 A;  2BDZ A;  5F02 A;  1SP4 B;  8PCH A;  2G6D A;  1PAD A;  3D6S A;  1CPJ A;  5A24 A;  1YVB A;  1EWM A;  2NQG A;  4GUZ A;  3S3R A;  2E01 A;  4YV8 A;  2BSZ A;  4YYV A;  3BC3 A;  2PAD A;  4YYU A;  1QOL A;  3MOR A;  2E00 A;  4HWY A;  5J94 A;  1BGO A;  1IWD A;  3K8U A;  2XU1 A;  4MSX A;  3P5W A;  3C9E A;  2AYO A;  2E02 A;  4I04 A;  4QRV A;  1EF7 A;  2HD5 A;  1MEM A;  1ME4 A;  4FJC A;  2R9N A;  2DCC A;  3I06 A;  3B79 A;  3CH2 X;  3CH3 X;  2YJ8 A;  3M99 A;  1YK7 A;  3K9M A;  2C0Y A;  3AI8 A;  3IHP A;  4Q8G A;  3WXG A;  1GX3 A;  1QDQ A;  3PNR A;  4K7C A;  2G8E A;  2DC7 A;  3BPM A;  3IEJ A;  1U9Q X;  3RVX A;  3V6E A;  4YYW A;  2YJ2 A;  2IPP B;  3ERV A;  4PP1 A;  3P5V A;  2P0R A;  3BOW A;  1ATK A;  2GFO A;  4X6J A;  3S3Q A;  4QRG A;  1ZIV A;  2NQD B;  7PCK A;  3H6S A;  3KW9 A;  1KXR A;  2AUX A;  1CVZ A;  2OZ2 A;  2NQI A;  3OF9 A;  5CHT A;  1U9X A;  1F2B A;  2FT2 A;  2DC8 A;  1AU4 A;  3QJ3 A;  2DZY A;  2VFC A;  1PE6 A;  3E1Z B;  5PAD A;  2CIO A;  2AU1 A;  2PNS A;  3H89 A;  1AYU A;  3D9W A;  3BWK A;  1PPP A;  1YT7 A;  4OEL A;  1U9W A;  3CBJ A;  1PXV A;  2VHS A;  1ICF A;  2FYE A;  3NHE A;  3F75 A;  1K3B B;  3DF0 A;  3MHH A;  5FPW A;  1PBH A;  2WBF X;  2VHF A;  1THE A;  4N79 A;  3V6C A;  2B1M A;  1ME3 A;  4OEM A;  1X9Y A;  4BQV A;  1SNK A;  1U9V A;  2R9C A;  3LXS A;  1PPN A;  3O1G A;  1CJL A;  3MTN A;  3MHS A;  2AYN A;  2AVW A;  2R9M A;  1QMY A;  2PRE A;  2YJC A;  1O0E A;  3BCN A;  1MS6 A;  2G8J A;  3IV2 A;  2P86 A;  4N4Z A;  4KLB A;  4FK5 A;  1MHW A;  1VJV A;  3KSE A;  2DC6 A;  2P7U A;  3RVW A;  3P5X A;  4C5P A;  3IUT A;  1VSN A;  2IBI A;  3HHA A;  1KHQ A;  1AIM A;  4P6G A;  4I05 A;  2Y6E A;  1EWP A;  1AU2 A;  3P5U A;  2AS8 A;  1YK8 A;  1DF0 A;  1EWO A;  5CVN B;  1M6D A;  4Q8H A;  3U8E A;  2DC9 A;  4W4U A;  1U5I A;  1W4T A;  5JA7 A;  1NQC A;  2FRA A;  3RVV A;  3H8B A;  3OIS A;  5K16 A;  5EF4 A;  1F29 A;  1BY8 A;  4W5B A;  3HWN A;  3PBH A;  3N3G A;  1F2A A;  3HHI A;  2AIM A;  2XU3 A;  1F2C A;  2CB5 A;  3KFQ A;  4I07 A;  2FO5 A;  5EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...