1PXVA

The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
183
Chain Sequence
GHHHHHHEFDQVQYENTLKNFKIREQQFDNSWAAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Staphostatin-Staphopain Complex: A FORWARD BINDING INHIBITOR IN COMPLEX WITH ITS TARGET CYSTEINE PROTEASE.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords cysteine protease
total genus 53
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pxvA00
1CTEA 2ARYA 2R9NA 2XU4A 1GMYA 1K3BB 3RVXA 4AXLA 3RVWA 4OEMA 2H7JA 1PPOA 2B1NA 4DMYA 3N4CA 2HH5A 4AXMA 3P5XA 3PBHA 4PP1A 5K16A 4RY2A 3I06A 2PREA 1EWOA 1S4VA 3N3KA 5EGWA 2P0RA 2HHNA 2YJBA 2FO5A 1CB5A 1AYVA 1KHQA 2PADA 1CJLA 4X6IA 5F02A 1KXRA 5CHVA 1M6DA 2XU1A 1DEUA 1QMYA 3KW9A 1ME4A 2FUDA 3PW3A 3V6EA 1MEGA 3CH3X 3H89A 4N79A 3S3QA 2E01A 4DMXA 3KSEA 3E1ZB 2XU5A 3KKUA 4K7CA 1PIPA 4FJCA 4QRXA 3IV2A 1U5IA 2HXZA 5J94A 1MIRA 2R9CA 1PADA 2DJGB 4I05A 3KWZA 1AU2A 2PNSA 1CQDA 2DC6A 1NB3A 1CSBB 1EWMA 3D6SA 3MORA 2O6XA 3LXSA 1U9XA 3OVZA 3CBKA 4X6JA 2Y6EA 3BPMA 2G8JA 4N4ZA 2NQDB 2AS8A 4FK5A 4N8WA 4BPVA 1CS8A 4PI3A 1U9WA 4YYVA 2OP3A 3F75A 4FIPA 3KFQA 1PPDA 3HHAA 1NPZA 1ZIVA 3WXGA 2IBIA 2R9MA 2G8EA 3RVVA 1AIMA 2AVWA 1NB5A 1BGOA 3LFYA 2HD5A 4PADA 4P6EA 1AU3A 4X6HA 4CDCB 3BC3A 1X9YA 3HHIA 1NL6A 3BOWA 4XR7A 1F2AA 3BCNA 1KFXL 1NLJA 1PCIA 2YJ8A 2YJCA 2AUZA 1F2CA 3KX1A 2PBHA 3PDFA 2F7DA 2XU3A 4MZSA 2DCDA 2GHUA 4YV8A 2OZ2A 1IWDA 1PPPA 2FRQA 2AIMA 4CZWA 9PAPA 5JH3A 1BY8A 1KHPA 3P5WA 2R9FA 4G54A 3H6SA 3HWNA 3C9EA 3WXEA 1PE6A 1YALA 3IEJA 1AECA 5A24A 1F2BA 2DJFB 4W5BA 2DC7A 2DZYA 1DF0A 5FPWA 1MS6A 1YT7A 2NQGA 3B79A 3USVA 3IUTA 3OISA 1ICFA 3H7DA 3QJ3A 4ZUXU 4W5CA 4BSQA 1CV8A 2R9OA 4MSXA 2DCCA 5CVNB 5EF4A 2BDLA 4I07A 3KWBX 2VHFA 1QOLA 1PPNA 2GFOA 1AU4A 1THEA 1VSNA 3AI8A 2DC8A 2ACTA 4MZOA 3K8UA 1TU6A 3F5VA 4CDEB 1CVZA 3HD3A 3GCBA 4Q8HA 1EWPA 3M99A 2JQGR 3O0UA 1Q6KA 2FQ9A 2Y5BA 1PXVA 1U9VA 4W4UA 4YYWA 3K24A 3CH2X 2FRAA 2BDZA 4YYSA 1EWLA 2YJ2A 5CHTA 1ITOA 1YK7A 3IHPA 3O1GA 1YVBA 4WA6A 1F29A 3OVXA 3S3RA 2VHSA 1VJVA 2DCAA 1JQPA 1SNKA 2JQFR 5JA7A 3MTNA 3NHEA 4PP2E 4QBBA 1EF7A 2G7YA 4CDDB 7PCKA 2P86A 1Y08A 3QT4A 4KLBA 4QRVA 3H8BA 4QH6A 6PADA 1YK8A 4OELA 1AYWA 4P6GA 3IMAA 1QXPA 2AU1A 3P5UA 5CVMA 4HWYA 1MHWA 4BS6A 2FT2A 2NQIA 2DCBA 1GLOA 1ZCMA 2DC9A 2DZZA 2IPPB 1ME3A 3OF9A 5PADA 1SP4B 1NQCA 3CBJA 3OF8A 1QDQA 1PBHA 3TNXA 2G6DA 3N3GA 2FYEA 1O0EA 1GECE 3BWKA 3H8CA 3K9MA 1KFUL 2B1MA 3MHHA 2ATOA 1POPA 2AUXA 1ATKA 1A6RA 2AYNA 2E03A 4YVAA 1CPJA 4BS5A 4YYQA 4I04A 2E02A 3U8EA 2OULA 1GCBA 2CB5A 1XKGA 4CDFB 1AYUA 5CVOB 1STFE 3BPFA 4YYRA 3DF0A 2WBFX 1AU0A 3I3TA 1BP4A 3V6CA 1TL9A 2C0YA 4BQVA 1FH0A 3P5VA 4QRGA 4XUIA 2CIOA 2YJ9A 3IOQA 1Y4HA 1MDWA 3MHSA 2R6NA 3WXFA 2F1GA 2NQAA 2AYOA 4YYUA 1U9QX 3QSDA 3PNRA 2FTDA 8PCHA 2E00A 3ERVA 3ZUAA 1HUCB 1BQIA 2P7UA 1MEMA 4Q8GA 1TLOA
chains in the Genus database with same CATH superfamily
1CTEA 2ARYA 2R9NA 2XU4A 1GMYA 1K3BB 3RVXA 3W31A 4AXLA 3RVWA 4XZXA 4OEMA 2H7JA 1PPOA 2B1NA 4DMYA 3N4CA 2HH5A 4AXMA 3P5XA 3PBHA 4PP1A 5K16A 4A5UA 4RY2A 3I06A 2PREA 1EWOA 1S4VA 3N3KA 5EGWA 3OQCA 2P0RA 2HHNA 2YJBA 2FO5A 1CB5A 1AYVA 1KHQA 2PADA 1CJLA 4X6IA 5F02A 1KXRA 5CHVA 1M6DA 2XU1A 1DEUA 1QMYA 3KW9A 1ME4A 2FUDA 3PW3A 1MEGA 3CH3X 4N79A 3H89A 3V6EA 3S3QA 2E01A 4DMXA 3KSEA 3E1ZB 2XU5A 3KKUA 1YZBA 4K7CA 1PIPA 4FJCA 4QRXA 3RNVA 3IV2A 1U5IA 1UKFA 2HXZA 5J94A 1MIRA 2R9CA 1PADA 1DKIA 2DJGB 4I05A 4IUMA 3E9SA 5JZEA 3KWZA 1AU2A 2PNSA 1CQDA 4R3DA 3B21A 2DC6A 1NB3A 4M0WA 1CSBB 1EWMA 3D6SA 4HXDB 3MORA 4RNAA 2O6XA 3LXSA 1U9XA 3OVZA 3CBKA 4X6JA 2Y6EA 2HWKA 3BPMA 4BOUA 2G8JA 4N4ZA 2NQDB 2AS8A 2J7QC 4FK5A 2BU3A 4N8WA 4BPVA 1CS8A 4PI3A 1U9WA 2BTWA 3W30A 4YYVA 2OP3A 3F75A 4FIPA 3KFQA 1PPDA 3HHAA 1NPZA 1ZIVA 3WXGA 2IBIA 2R9MA 2G8EA 4IP3A 3RVVA 1AIMA 2Z84A 2AVWA 1NB5A 1BGOA 3LFYA 4OVZA 2HD5A 4PADA 4P6EA 1AU3A 4X6HA 4CDCB 3BC3A 3TRKA 1X9YA 3HHIA 1NL6A 3BOWA 4XR7A 4D8EA 1F2AA 3BCNA 1KFXL 1NLJA 1PCIA 2YJ8A 3PHXA 2YJCA 4WURA 2AUZA 1F2CA 3KX1A 2PBHA 3PDFA 2F7DA 2XU3A 4ZTBA 4MZSA 2DCDA 2GHUA 4YV8A 2OZ2A 1IWDA 1PPPA 2FRQA 2AIMA 4CZWA 9PAPA 5JH3A 1BY8A 1KHPA 3P5WA 2R9FA 4G54A 3H6SA 3HWNA 3C9EA 3WXEA 1PE6A 1YALA 3IEJA 1AECA 5A24A 4RF1A 1F2BA 2DJFB 3IFUA 4W5BA 2DC7A 2DZYA 1PVJA 1DF0A 5FPWA 1MS6A 1YT7A 2NQGA 3B79A 5E6JA 3USVA 3IUTA 3OISA 3C0RA 1ICFA 3H7DA 3QJ3A 4ZUXU 4W5CA 4BSQA 1CV8A 2R9OA 4MSXA 2DCCA 5CVNB 5EF4A 2BDLA 4I07A 3KWBX 4BOPA 2VHFA 3ZNHA 2FE8A 1QOLA 1PPNA 2GFOA 4REZA 1AU4A 1THEA 1VSNA 3AI8A 2DC8A 2ACTA 4MZOA 3K8UA 1TU6A 3F5VA 4CDEB 1CVZA 3HD3A 3GCBA 4Q8HA 1EWPA 3M99A 2JQGR 3O0UA 1Q6KA 2FQ9A 2Y5BA 1PXVA 1U9VA 4W4UA 4YYWA 3K24A 3CH2X 2FRAA 2BDZA 4YYSA 1EWLA 2YJ2A 5CHTA 1ITOA 1YK7A 3IHPA 3O1GA 1YVBA 4WA6A 1F29A 3OVXA 3S3RA 2VHSA 1VJVA 2DCAA 1JQPA 1SNKA 2J7QA 5EZSA 2JQFR 5JA7A 3MTNA 3NHEA 4PP2E 4QBBA 1EF7A 3MTVA 2G7YA 4CDDB 7PCKA 2P86A 1Y08A 4GUAA 3QT4A 2JRIA 4KLBA 4QRVA 3H8BA 4QH6A 5KO3A 6PADA 1YK8A 4OELA 3BB7A 2DOSA 1AYWA 4RKXA 4P6GA 3PRMA 3IMAA 3PHUA 1QXPA 3PRPA 2AU1A 2UZJA 3P5UA 4D8IA 5CVMA 4HWYA 1MHWA 4BS6A 2FT2A 2NQIA 2DCBA 1GLOA 1ZCMA 2DC9A 2DZZA 2IPPB 1ME3A 3OF9A 5PADA 3MJ5A 1SP4B 3TMPA 1NQCA 3CBJA 3OF8A 1QDQA 1PBHA 3TNXA 2G6DA 2JTCA 4OW0A 3N3GA 2FYEA 1O0EA 1GECE 3BWKA 3H8CA 3PSEA 3K9MA 1KFUL 2B1MA 3MHHA 2ATOA 1POPA 2AUXA 1ATKA 1A6RA 2AYNA 2E03A 4YVAA 4BOSA 1CPJA 4BS5A 4BOZA 5EZQA 4YYQA 3MP2A 4I04A 2E02A 3U8EA 2OULA 1GCBA 2CB5A 1XKGA 4CDFB 1AYUA 5CVOB 1STFE 3BPFA 4YYRA 3DF0A 2WBFX 1AU0A 3I3TA 1BP4A 3V6CA 1TL9A 2C0YA 3O65A 4BQVA 4MM3B 1FH0A 3P5VA 4QRGA 4P16A 4XUIA 2CIOA 4RF0A 3PHWA 4BOQA 3PT2A 2YJ9A 4D8BA 2BTWB 1Y4HA 3IOQA 1MDWA 2AGAA 4OVZB 3MHSA 3BY4A 2R6NA 3WXFA 2F1GA 2NQAA 2AYOA 4YYUA 1U9QX 3QSDA 3PNRA 3BBAA 2FTDA 8PCHA 4PT5A 2E00A 3ERVA 3ZUAA 1HUCB 1BQIA 2P7UA 1MEMA 4Q8GA 1TLOA 4MI7A
chains in the Genus database with same CATH topology
1CTEA 2ARYA 2R9NA 2XU4A 1GMYA 1K3BB 3RVXA 4AXLA 3RVWA 4OEMA 2H7JA 1PPOA 2B1NA 4DMYA 3N4CA 2HH5A 4AXMA 1W6FA 3P5XA 3PBHA 4PP1A 5K16A 4RY2A 3I06A 2PREA 1EWOA 1S4VA 3N3KA 5EGWA 2P0RA 2HHNA 2YJBA 2FO5A 1CB5A 1AYVA 1KHQA 4NV7A 2PADA 1CJLA 4X6IA 5F02A 1KXRA 5CHVA 1M6DA 2XU1A 1DEUA 1QMYA 3KW9A 1ME4A 2FUDA 3PW3A 1MEGA 3CH3X 4N79A 3H89A 3V6EA 3S3QA 4C5PA 2E01A 4DMXA 3KSEA 3E1ZB 2XU5A 3KKUA 4K7CA 1PIPA 4FJCA 4QRXA 3IV2A 1U5IA 2HXZA 5J94A 1MIRA 2R9CA 1PADA 2DJGB 4I05A 3KWZA 1AU2A 2PNSA 1CQDA 2DC6A 1NB3A 1CSBB 1EWMA 3D6SA 3MORA 1W4TA 2O6XA 3LXSA 1U9XA 3OVZA 3CBKA 4X6JA 2Y6EA 3BPMA 2G8JA 4N4ZA 2NQDB 2AS8A 4FK5A 4N8WA 4BPVA 1CS8A 4PI3A 1U9WA 4YYVA 2OP3A 3F75A 4FIPA 3KFQA 1PPDA 3HHAA 1NPZA 1ZIVA 3WXGA 2IBIA 4GUZA 2R9MA 2G8EA 3RVVA 3LTWA 1AIMA 2AVWA 1NB5A 1BGOA 3LFYA 2HD5A 4PADA 4P6EA 1AU3A 4X6HA 4CDCB 3BC3A 1X9YA 3HHIA 1NL6A 4NV8A 3BOWA 4XR7A 2VFBA 1F2AA 3BCNA 1KFXL 1NLJA 1PCIA 2YJ8A 2YJCA 2AUZA 1F2CA 3KX1A 2PBHA 3PDFA 2F7DA 1W5RA 2XU3A 4MZSA 2DCDA 2GHUA 4YV8A 2OZ2A 1IWDA 1PPPA 2FRQA 2AIMA 4CZWA 9PAPA 5JH3A 1BY8A 1KHPA 1GX3A 3P5WA 2R9FA 4G54A 3H6SA 3HWNA 3C9EA 3WXEA 1PE6A 1YALA 3IEJA 1AECA 3D9WA 5A24A 1F2BA 2DJFB 4W5BA 2DC7A 2DZYA 1DF0A 5FPWA 1MS6A 1YT7A 2NQGA 3B79A 3USVA 3IUTA 3OISA 1ICFA 3H7DA 3QJ3A 4ZUXU 4W5CA 4BSQA 1CV8A 2R9OA 4MSXA 2DCCA 5CVNB 5EF4A 2BDLA 4I07A 3KWBX 2VHFA 1QOLA 1PPNA 2GFOA 1AU4A 1THEA 1VSNA 3AI8A 2DC8A 2ACTA 4MZOA 3K8UA 1TU6A 3F5VA 4CDEB 1CVZA 3HD3A 3GCBA 4Q8HA 1EWPA 3M99A 2JQGR 3O0UA 1Q6KA 2FQ9A 2Y5BA 1PXVA 1U9VA 1E2TA 4W4UA 4YYWA 3K24A 3CH2X 2FRAA 2BDZA 4B55A 4YYSA 1EWLA 2YJ2A 5CHTA 1ITOA 1YK7A 3IHPA 3O1GA 1YVBA 4WA6A 1F29A 3OVXA 3S3RA 2VHSA 1VJVA 2DCAA 1JQPA 1SNKA 2JQFR 5JA7A 3MTNA 3NHEA 4PP2E 4QBBA 1EF7A 2G7YA 4CDDB 7PCKA 2P86A 1Y08A 3QT4A 4KLBA 4QRVA 3H8BA 4QH6A 6PADA 1YK8A 4OELA 1AYWA 4P6GA 4BGFA 3IMAA 1QXPA 2AU1A 3P5UA 2VFCA 5CVMA 4HWYA 1MHWA 4BS6A 2FT2A 2NQIA 2DCBA 1GLOA 1ZCMA 2DC9A 2DZZA 2IPPB 1ME3A 3OF9A 5PADA 1SP4B 1NQCA 3CBJA 3OF8A 1QDQA 1PBHA 3TNXA 2G6DA 3N3GA 2FYEA 1O0EA 1GECE 3BWKA 3H8CA 3K9MA 1KFUL 2B1MA 3MHHA 2ATOA 1POPA 2AUXA 1ATKA 1A6RA 2AYNA 2E03A 4YVAA 1CPJA 4BS5A 4YYQA 4I04A 2E02A 3U8EA 2OULA 1GCBA 2CB5A 1XKGA 4CDFB 1AYUA 5CVOB 1STFE 3BPFA 4YYRA 3DF0A 2WBFX 1AU0A 3I3TA 1BP4A 3V6CA 1TL9A 2C0YA 4BQVA 1FH0A 3P5VA 4QRGA 2BSZA 4XUIA 2CIOA 2YJ9A 3IOQA 1Y4HA 1MDWA 3MHSA 2R6NA 3WXFA 2F1GA 2NQAA 2AYOA 4YYUA 1U9QX 3QSDA 3PNRA 2FTDA 8PCHA 2E00A 3ERVA 3ZUAA 1HUCB 1BQIA 2P7UA 1MEMA 4Q8GA 1TLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTE A;  2ARY A;  2R9N A;  2XU4 A;  1GMY A;  1K3B B;  3RVX A;  4AXL A;  3RVW A;  4OEM A;  2H7J A;  1PPO A;  2B1N A;  4DMY A;  3N4C A;  2HH5 A;  4AXM A;  3P5X A;  3PBH A;  4PP1 A;  5K16 A;  4RY2 A;  3I06 A;  2PRE A;  1EWO A;  1S4V A;  3N3K A;  5EGW A;  2P0R A;  2HHN A;  2YJB A;  2FO5 A;  1CB5 A;  1AYV A;  1KHQ A;  2PAD A;  1CJL A;  4X6I A;  5F02 A;  1KXR A;  5CHV A;  1M6D A;  2XU1 A;  1DEU A;  1QMY A;  3KW9 A;  1ME4 A;  2FUD A;  3PW3 A;  3V6E A;  1MEG A;  3CH3 X;  3H89 A;  4N79 A;  3S3Q A;  2E01 A;  4DMX A;  3KSE A;  3E1Z B;  2XU5 A;  3KKU A;  4K7C A;  1PIP A;  4FJC A;  4QRX A;  3IV2 A;  1U5I A;  2HXZ A;  5J94 A;  1MIR A;  2R9C A;  1PAD A;  2DJG B;  4I05 A;  3KWZ A;  1AU2 A;  2PNS A;  1CQD A;  2DC6 A;  1NB3 A;  1CSB B;  1EWM A;  3D6S A;  3MOR A;  2O6X A;  3LXS A;  1U9X A;  3OVZ A;  3CBK A;  4X6J A;  2Y6E A;  3BPM A;  2G8J A;  4N4Z A;  2NQD B;  2AS8 A;  4FK5 A;  4N8W A;  4BPV A;  1CS8 A;  4PI3 A;  1U9W A;  4YYV A;  2OP3 A;  3F75 A;  4FIP A;  3KFQ A;  1PPD A;  3HHA A;  1NPZ A;  1ZIV A;  3WXG A;  2IBI A;  2R9M A;  2G8E A;  3RVV A;  1AIM A;  2AVW A;  1NB5 A;  1BGO A;  3LFY A;  2HD5 A;  4PAD A;  4P6E A;  1AU3 A;  4X6H A;  4CDC B;  3BC3 A;  1X9Y A;  3HHI A;  1NL6 A;  3BOW A;  4XR7 A;  1F2A A;  3BCN A;  1KFX L;  1NLJ A;  1PCI A;  2YJ8 A;  2YJC A;  2AUZ A;  1F2C A;  3KX1 A;  2PBH A;  3PDF A;  2F7D A;  2XU3 A;  4MZS A;  2DCD A;  2GHU A;  4YV8 A;  2OZ2 A;  1IWD A;  1PPP A;  2FRQ A;  2AIM A;  4CZW A;  9PAP A;  5JH3 A;  1BY8 A;  1KHP A;  3P5W A;  2R9F A;  4G54 A;  3H6S A;  3HWN A;  3C9E A;  3WXE A;  1PE6 A;  1YAL A;  3IEJ A;  1AEC A;  5A24 A;  1F2B A;  2DJF B;  4W5B A;  2DC7 A;  2DZY A;  1DF0 A;  5FPW A;  1MS6 A;  1YT7 A;  2NQG A;  3B79 A;  3USV A;  3IUT A;  3OIS A;  1ICF A;  3H7D A;  3QJ3 A;  4ZUX U;  4W5C A;  4BSQ A;  1CV8 A;  2R9O A;  4MSX A;  2DCC A;  5CVN B;  5EF4 A;  2BDL A;  4I07 A;  3KWB X;  2VHF A;  1QOL A;  1PPN A;  2GFO A;  1AU4 A;  1THE A;  1VSN A;  3AI8 A;  2DC8 A;  2ACT A;  4MZO A;  3K8U A;  1TU6 A;  3F5V A;  4CDE B;  1CVZ A;  3HD3 A;  3GCB A;  4Q8H A;  1EWP A;  3M99 A;  2JQG R;  3O0U A;  1Q6K A;  2FQ9 A;  2Y5B A;  1PXV A;  1U9V A;  4W4U A;  4YYW A;  3K24 A;  3CH2 X;  2FRA A;  2BDZ A;  4YYS A;  1EWL A;  2YJ2 A;  5CHT A;  1ITO A;  1YK7 A;  3IHP A;  3O1G A;  1YVB A;  4WA6 A;  1F29 A;  3OVX A;  3S3R A;  2VHS A;  1VJV A;  2DCA A;  1JQP A;  1SNK A;  2JQF R;  5JA7 A;  3MTN A;  3NHE A;  4PP2 E;  4QBB A;  1EF7 A;  2G7Y A;  4CDD B;  7PCK A;  2P86 A;  1Y08 A;  3QT4 A;  4KLB A;  4QRV A;  3H8B A;  4QH6 A;  6PAD A;  1YK8 A;  4OEL A;  1AYW A;  4P6G A;  3IMA A;  1QXP A;  2AU1 A;  3P5U A;  5CVM A;  4HWY A;  1MHW A;  4BS6 A;  2FT2 A;  2NQI A;  2DCB A;  1GLO A;  1ZCM A;  2DC9 A;  2DZZ A;  2IPP B;  1ME3 A;  3OF9 A;  5PAD A;  1SP4 B;  1NQC A;  3CBJ A;  3OF8 A;  1QDQ A;  1PBH A;  3TNX A;  2G6D A;  3N3G A;  2FYE A;  1O0E A;  1GEC E;  3BWK A;  3H8C A;  3K9M A;  1KFU L;  2B1M A;  3MHH A;  2ATO A;  1POP A;  2AUX A;  1ATK A;  1A6R A;  2AYN A;  2E03 A;  4YVA A;  1CPJ A;  4BS5 A;  4YYQ A;  4I04 A;  2E02 A;  3U8E A;  2OUL A;  1GCB A;  2CB5 A;  1XKG A;  4CDF B;  1AYU A;  5CVO B;  1STF E;  3BPF A;  4YYR A;  3DF0 A;  2WBF X;  1AU0 A;  3I3T A;  1BP4 A;  3V6C A;  1TL9 A;  2C0Y A;  4BQV A;  1FH0 A;  3P5V A;  4QRG A;  4XUI A;  2CIO A;  2YJ9 A;  3IOQ A;  1Y4H A;  1MDW A;  3MHS A;  2R6N A;  3WXF A;  2F1G A;  2NQA A;  2AYO A;  4YYU A;  1U9Q X;  3QSD A;  3PNR A;  2FTD A;  8PCH A;  2E00 A;  3ERV A;  3ZUA A;  1HUC B;  1BQI A;  2P7U A;  1MEM A;  4Q8G A;  1TLO A; 
#chains in the Genus database with same CATH topology
 1CTE A;  2ARY A;  2R9N A;  2XU4 A;  1GMY A;  1K3B B;  3RVX A;  3W31 A;  4AXL A;  3RVW A;  4XZX A;  4OEM A;  2H7J A;  1PPO A;  2B1N A;  4DMY A;  3N4C A;  2HH5 A;  4AXM A;  3P5X A;  3PBH A;  4PP1 A;  5K16 A;  4A5U A;  4RY2 A;  3I06 A;  2PRE A;  1EWO A;  1S4V A;  3N3K A;  5EGW A;  3OQC A;  2P0R A;  2HHN A;  2YJB A;  2FO5 A;  1CB5 A;  1AYV A;  1KHQ A;  2PAD A;  1CJL A;  4X6I A;  5F02 A;  1KXR A;  5CHV A;  1M6D A;  2XU1 A;  1DEU A;  1QMY A;  3KW9 A;  1ME4 A;  2FUD A;  3PW3 A;  1MEG A;  3CH3 X;  4N79 A;  3H89 A;  3V6E A;  3S3Q A;  2E01 A;  4DMX A;  3KSE A;  3E1Z B;  2XU5 A;  3KKU A;  1YZB A;  4K7C A;  1PIP A;  4FJC A;  4QRX A;  3RNV A;  3IV2 A;  1U5I A;  1UKF A;  2HXZ A;  5J94 A;  1MIR A;  2R9C A;  1PAD A;  1DKI A;  2DJG B;  4I05 A;  4IUM A;  3E9S A;  5JZE A;  3KWZ A;  1AU2 A;  2PNS A;  1CQD A;  4R3D A;  3B21 A;  2DC6 A;  1NB3 A;  4M0W A;  1CSB B;  1EWM A;  3D6S A;  4HXD B;  3MOR A;  4RNA A;  2O6X A;  3LXS A;  1U9X A;  3OVZ A;  3CBK A;  4X6J A;  2Y6E A;  2HWK A;  3BPM A;  4BOU A;  2G8J A;  4N4Z A;  2NQD B;  2AS8 A;  2J7Q C;  4FK5 A;  2BU3 A;  4N8W A;  4BPV A;  1CS8 A;  4PI3 A;  1U9W A;  2BTW A;  3W30 A;  4YYV A;  2OP3 A;  3F75 A;  4FIP A;  3KFQ A;  1PPD A;  3HHA A;  1NPZ A;  1ZIV A;  3WXG A;  2IBI A;  2R9M A;  2G8E A;  4IP3 A;  3RVV A;  1AIM A;  2Z84 A;  2AVW A;  1NB5 A;  1BGO A;  3LFY A;  4OVZ A;  2HD5 A;  4PAD A;  4P6E A;  1AU3 A;  4X6H A;  4CDC B;  3BC3 A;  3TRK A;  1X9Y A;  3HHI A;  1NL6 A;  3BOW A;  4XR7 A;  4D8E A;  1F2A A;  3BCN A;  1KFX L;  1NLJ A;  1PCI A;  2YJ8 A;  3PHX A;  2YJC A;  4WUR A;  2AUZ A;  1F2C A;  3KX1 A;  2PBH A;  3PDF A;  2F7D A;  2XU3 A;  4ZTB A;  4MZS A;  2DCD A;  2GHU A;  4YV8 A;  2OZ2 A;  1IWD A;  1PPP A;  2FRQ A;  2AIM A;  4CZW A;  9PAP A;  5JH3 A;  1BY8 A;  1KHP A;  3P5W A;  2R9F A;  4G54 A;  3H6S A;  3HWN A;  3C9E A;  3WXE A;  1PE6 A;  1YAL A;  3IEJ A;  1AEC A;  5A24 A;  4RF1 A;  1F2B A;  2DJF B;  3IFU A;  4W5B A;  2DC7 A;  2DZY A;  1PVJ A;  1DF0 A;  5FPW A;  1MS6 A;  1YT7 A;  2NQG A;  3B79 A;  5E6J A;  3USV A;  3IUT A;  3OIS A;  3C0R A;  1ICF A;  3H7D A;  3QJ3 A;  4ZUX U;  4W5C A;  4BSQ A;  1CV8 A;  2R9O A;  4MSX A;  2DCC A;  5CVN B;  5EF4 A;  2BDL A;  4I07 A;  3KWB X;  4BOP A;  2VHF A;  3ZNH A;  2FE8 A;  1QOL A;  1PPN A;  2GFO A;  4REZ A;  1AU4 A;  1THE A;  1VSN A;  3AI8 A;  2DC8 A;  2ACT A;  4MZO A;  3K8U A;  1TU6 A;  3F5V A;  4CDE B;  1CVZ A;  3HD3 A;  3GCB A;  4Q8H A;  1EWP A;  3M99 A;  2JQG R;  3O0U A;  1Q6K A;  2FQ9 A;  2Y5B A;  1PXV A;  1U9V A;  4W4U A;  4YYW A;  3K24 A;  3CH2 X;  2FRA A;  2BDZ A;  4YYS A;  1EWL A;  2YJ2 A;  5CHT A;  1ITO A;  1YK7 A;  3IHP A;  3O1G A;  1YVB A;  4WA6 A;  1F29 A;  3OVX A;  3S3R A;  2VHS A;  1VJV A;  2DCA A;  1JQP A;  1SNK A;  2J7Q A;  5EZS A;  2JQF R;  5JA7 A;  3MTN A;  3NHE A;  4PP2 E;  4QBB A;  1EF7 A;  3MTV A;  2G7Y A;  4CDD B;  7PCK A;  2P86 A;  1Y08 A;  4GUA A;  3QT4 A;  2JRI A;  4KLB A;  4QRV A;  3H8B A;  4QH6 A;  5KO3 A;  6PAD A;  1YK8 A;  4OEL A;  3BB7 A;  2DOS A;  1AYW A;  4RKX A;  4P6G A;  3PRM A;  3IMA A;  3PHU A;  1QXP A;  3PRP A;  2AU1 A;  2UZJ A;  3P5U A;  4D8I A;  5CVM A;  4HWY A;  1MHW A;  4BS6 A;  2FT2 A;  2NQI A;  2DCB A;  1GLO A;  1ZCM A;  2DC9 A;  2DZZ A;  2IPP B;  1ME3 A;  3OF9 A;  5PAD A;  3MJ5 A;  1SP4 B;  3TMP A;  1NQC A;  3CBJ A;  3OF8 A;  1QDQ A;  1PBH A;  3TNX A;  2G6D A;  2JTC A;  4OW0 A;  3N3G A;  2FYE A;  1O0E A;  1GEC E;  3BWK A;  3H8C A;  3PSE A;  3K9M A;  1KFU L;  2B1M A;  3MHH A;  2ATO A;  1POP A;  2AUX A;  1ATK A;  1A6R A;  2AYN A;  2E03 A;  4YVA A;  4BOS A;  1CPJ A;  4BS5 A;  4BOZ A;  5EZQ A;  4YYQ A;  3MP2 A;  4I04 A;  2E02 A;  3U8E A;  2OUL A;  1GCB A;  2CB5 A;  1XKG A;  4CDF B;  1AYU A;  5CVO B;  1STF E;  3BPF A;  4YYR A;  3DF0 A;  2WBF X;  1AU0 A;  3I3T A;  1BP4 A;  3V6C A;  1TL9 A;  2C0Y A;  3O65 A;  4BQV A;  4MM3 B;  1FH0 A;  3P5V A;  4QRG A;  4P16 A;  4XUI A;  2CIO A;  4RF0 A;  3PHW A;  4BOQ A;  3PT2 A;  2YJ9 A;  4D8B A;  2BTW B;  1Y4H A;  3IOQ A;  1MDW A;  2AGA A;  4OVZ B;  3MHS A;  3BY4 A;  2R6N A;  3WXF A;  2F1G A;  2NQA A;  2AYO A;  4YYU A;  1U9Q X;  3QSD A;  3PNR A;  3BBA A;  2FTD A;  8PCH A;  4PT5 A;  2E00 A;  3ERV A;  3ZUA A;  1HUC B;  1BQI A;  2P7U A;  1MEM A;  4Q8G A;  1TLO A;  4MI7 A; 
#chains in the Genus database with same CATH homology
 1CTE A;  2ARY A;  2R9N A;  2XU4 A;  1GMY A;  1K3B B;  3RVX A;  4AXL A;  3RVW A;  4OEM A;  2H7J A;  1PPO A;  2B1N A;  4DMY A;  3N4C A;  2HH5 A;  4AXM A;  1W6F A;  3P5X A;  3PBH A;  4PP1 A;  5K16 A;  4RY2 A;  3I06 A;  2PRE A;  1EWO A;  1S4V A;  3N3K A;  5EGW A;  2P0R A;  2HHN A;  2YJB A;  2FO5 A;  1CB5 A;  1AYV A;  1KHQ A;  4NV7 A;  2PAD A;  1CJL A;  4X6I A;  5F02 A;  1KXR A;  5CHV A;  1M6D A;  2XU1 A;  1DEU A;  1QMY A;  3KW9 A;  1ME4 A;  2FUD A;  3PW3 A;  1MEG A;  3CH3 X;  4N79 A;  3H89 A;  3V6E A;  3S3Q A;  4C5P A;  2E01 A;  4DMX A;  3KSE A;  3E1Z B;  2XU5 A;  3KKU A;  4K7C A;  1PIP A;  4FJC A;  4QRX A;  3IV2 A;  1U5I A;  2HXZ A;  5J94 A;  1MIR A;  2R9C A;  1PAD A;  2DJG B;  4I05 A;  3KWZ A;  1AU2 A;  2PNS A;  1CQD A;  2DC6 A;  1NB3 A;  1CSB B;  1EWM A;  3D6S A;  3MOR A;  1W4T A;  2O6X A;  3LXS A;  1U9X A;  3OVZ A;  3CBK A;  4X6J A;  2Y6E A;  3BPM A;  2G8J A;  4N4Z A;  2NQD B;  2AS8 A;  4FK5 A;  4N8W A;  4BPV A;  1CS8 A;  4PI3 A;  1U9W A;  4YYV A;  2OP3 A;  3F75 A;  4FIP A;  3KFQ A;  1PPD A;  3HHA A;  1NPZ A;  1ZIV A;  3WXG A;  2IBI A;  4GUZ A;  2R9M A;  2G8E A;  3RVV A;  3LTW A;  1AIM A;  2AVW A;  1NB5 A;  1BGO A;  3LFY A;  2HD5 A;  4PAD A;  4P6E A;  1AU3 A;  4X6H A;  4CDC B;  3BC3 A;  1X9Y A;  3HHI A;  1NL6 A;  4NV8 A;  3BOW A;  4XR7 A;  2VFB A;  1F2A A;  3BCN A;  1KFX L;  1NLJ A;  1PCI A;  2YJ8 A;  2YJC A;  2AUZ A;  1F2C A;  3KX1 A;  2PBH A;  3PDF A;  2F7D A;  1W5R A;  2XU3 A;  4MZS A;  2DCD A;  2GHU A;  4YV8 A;  2OZ2 A;  1IWD A;  1PPP A;  2FRQ A;  2AIM A;  4CZW A;  9PAP A;  5JH3 A;  1BY8 A;  1KHP A;  1GX3 A;  3P5W A;  2R9F A;  4G54 A;  3H6S A;  3HWN A;  3C9E A;  3WXE A;  1PE6 A;  1YAL A;  3IEJ A;  1AEC A;  3D9W A;  5A24 A;  1F2B A;  2DJF B;  4W5B A;  2DC7 A;  2DZY A;  1DF0 A;  5FPW A;  1MS6 A;  1YT7 A;  2NQG A;  3B79 A;  3USV A;  3IUT A;  3OIS A;  1ICF A;  3H7D A;  3QJ3 A;  4ZUX U;  4W5C A;  4BSQ A;  1CV8 A;  2R9O A;  4MSX A;  2DCC A;  5CVN B;  5EF4 A;  2BDL A;  4I07 A;  3KWB X;  2VHF A;  1QOL A;  1PPN A;  2GFO A;  1AU4 A;  1THE A;  1VSN A;  3AI8 A;  2DC8 A;  2ACT A;  4MZO A;  3K8U A;  1TU6 A;  3F5V A;  4CDE B;  1CVZ A;  3HD3 A;  3GCB A;  4Q8H A;  1EWP A;  3M99 A;  2JQG R;  3O0U A;  1Q6K A;  2FQ9 A;  2Y5B A;  1PXV A;  1U9V A;  1E2T A;  4W4U A;  4YYW A;  3K24 A;  3CH2 X;  2FRA A;  2BDZ A;  4B55 A;  4YYS A;  1EWL A;  2YJ2 A;  5CHT A;  1ITO A;  1YK7 A;  3IHP A;  3O1G A;  1YVB A;  4WA6 A;  1F29 A;  3OVX A;  3S3R A;  2VHS A;  1VJV A;  2DCA A;  1JQP A;  1SNK A;  2JQF R;  5JA7 A;  3MTN A;  3NHE A;  4PP2 E;  4QBB A;  1EF7 A;  2G7Y A;  4CDD B;  7PCK A;  2P86 A;  1Y08 A;  3QT4 A;  4KLB A;  4QRV A;  3H8B A;  4QH6 A;  6PAD A;  1YK8 A;  4OEL A;  1AYW A;  4P6G A;  4BGF A;  3IMA A;  1QXP A;  2AU1 A;  3P5U A;  2VFC A;  5CVM A;  4HWY A;  1MHW A;  4BS6 A;  2FT2 A;  2NQI A;  2DCB A;  1GLO A;  1ZCM A;  2DC9 A;  2DZZ A;  2IPP B;  1ME3 A;  3OF9 A;  5PAD A;  1SP4 B;  1NQC A;  3CBJ A;  3OF8 A;  1QDQ A;  1PBH A;  3TNX A;  2G6D A;  3N3G A;  2FYE A;  1O0E A;  1GEC E;  3BWK A;  3H8C A;  3K9M A;  1KFU L;  2B1M A;  3MHH A;  2ATO A;  1POP A;  2AUX A;  1ATK A;  1A6R A;  2AYN A;  2E03 A;  4YVA A;  1CPJ A;  4BS5 A;  4YYQ A;  4I04 A;  2E02 A;  3U8E A;  2OUL A;  1GCB A;  2CB5 A;  1XKG A;  4CDF B;  1AYU A;  5CVO B;  1STF E;  3BPF A;  4YYR A;  3DF0 A;  2WBF X;  1AU0 A;  3I3T A;  1BP4 A;  3V6C A;  1TL9 A;  2C0Y A;  4BQV A;  1FH0 A;  3P5V A;  4QRG A;  2BSZ A;  4XUI A;  2CIO A;  2YJ9 A;  3IOQ A;  1Y4H A;  1MDW A;  3MHS A;  2R6N A;  3WXF A;  2F1G A;  2NQA A;  2AYO A;  4YYU A;  1U9Q X;  3QSD A;  3PNR A;  2FTD A;  8PCH A;  2E00 A;  3ERV A;  3ZUA A;  1HUC B;  1BQI A;  2P7U A;  1MEM A;  4Q8G A;  1TLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...