1PXVA

The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
183
Chain Sequence
GHHHHHHEFDQVQYENTLKNFKIREQQFDNSWAAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Staphostatin-Staphopain Complex: A FORWARD BINDING INHIBITOR IN COMPLEX WITH ITS TARGET CYSTEINE PROTEASE.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords cysteine protease
total genus 53
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pxvA00
2FQ9A 4BS6A 1QMYA 2IPPB 3LFYA 1M6DA 5PADA 4AXMA 2AVWA 4W5BA 3CH2X 3P5XA 3USVA 1Y4HA 1EWLA 2PNSA 4QH6A 4OELA 2PADA 1TLOA 4DMYA 1AECA 1AYWA 2GFOA 3CBJA 4YYWA 1NB5A 3PNRA 8PCHA 5CHTA 1XKGA 1QOLA 1BY8A 5K16A 1ITOA 7PCKA 1QXPA 2XU4A 3CBKA 2FRAA 2DZZA 4G54A 4X6IA 1GLOA 2DZYA 4X6HA 3H89A 3D6SA 1MEGA 2YJBA 3IHPA 2CB5A 1EWOA 2FTDA 4QBBA 1ZIVA 3QT4A 3IOQA 4YV8A 1EWPA 2R9NA 4MZOA 3MHSA 3MHHA 2NQGA 2HHNA 4I04A 1ME3A 1ATKA 3RVVA 2DC8A 3WXEA 2FT2A 4N4ZA 4N8WA 3N4CA 3KSEA 4PP2E 2DCDA 2B1NA 1ZCMA 3E1ZB 2P0RA 3C9EA 2G8JA 2E01A 2PREA 5A24A 2R6NA 2CIOA 4ZUXU 3K8UA 1GCBA 2IBIA 1JQPA 1STFE 3O0UA 3TNXA 2O6XA 3BPMA 3BPFA 1KFUL 2HH5A 2OZ2A 4PI3A 1MS6A 1YALA 2G7YA 1MHWA 4FIPA 2XU3A 3ERVA 1PPDA 5CHVA 2Y5BA 2VHSA 2P7UA 3HD3A 3M99A 1PPPA 3K9MA 4QRXA 1F2CA 2FYEA 1PBHA 1CB5A 4XR7A 1AU0A 2YJCA 2R9MA 2AUZA 2F7DA 3P5UA 1U9VA 1Q6KA 4W4UA 1YK7A 4YYQA 1AYUA 1AU3A 1F2AA 2DCAA 2HD5A 4CZWA 2E00A 3I3TA 1CJLA 2HXZA 2VHFA 2YJ2A 4OEMA 3OVXA 2DCCA 2DC6A 2F1GA 1CSBB 3U8EA 1FH0A 2B1MA 1TL9A 2AS8A 1KXRA 1CV8A 2FRQA 4PADA 1YT7A 2DC9A 4MZSA 3HHAA 4QRVA 2R9FA 1ME4A 6PADA 1NPZA 4WA6A 1SNKA 2AUXA 3KKUA 3WXFA 4CDFB 3N3GA 1NLJA 1MDWA 3RVXA 2AYNA 1VSNA 3BC3A 1A6RA 1AYVA 1X9YA 1PCIA 1AU2A 2C0YA 3IEJA 4YYSA 4I07A 4P6EA 3H6SA 3PW3A 1NL6A 1F29A 2H7JA 3PBHA 3KWBX 4HWYA 3KWZA 4KLBA 3GCBA 1YVBA 3OF8A 3S3QA 2AU1A 3DF0A 2FUDA 3QSDA 4CDEB 2NQDB 4BQVA 2R9CA 3F5VA 4X6JA 2OULA 1NQCA 3QJ3A 3ZUAA 1CVZA 1U9XA 4BPVA 1AIMA 4FJCA 3WXGA 5JH3A 3HWNA 3OVZA 4FK5A 1CQDA 2YJ9A 1PIPA 2YJ8A 4YVAA 3I06A 2G8EA 1QDQA 1CTEA 4YYVA 1DEUA 3OF9A 1U9QX 1PADA 4CDDB 3B79A 4AXLA 1GMYA 3S3RA 2AYOA 5EF4A 2ARYA 1SP4B 2G6DA 2OP3A 2JQFR 1POPA 3BOWA 1YK8A 3HHIA 1MIRA 1K3BB 4Q8GA 3IUTA 3PDFA 3KFQA 4K7CA 2XU1A 5CVOB 2BDZA 2AIMA 3IV2A 1F2BA 2ATOA 2DJFB 1PPNA 3RVWA 3BWKA 3K24A 1KHPA 3CH3X 3OISA 3AI8A 5CVNB 2Y6EA 1BP4A 3H7DA 1Y08A 1IWDA 2NQAA 5J94A 1GECE 5CVMA 2WBFX 4Q8HA 2XU5A 4PP1A 1CPJA 1KFXL 4W5CA 4XUIA 1EF7A 3LXSA 4MSXA 3KW9A 1TU6A 4CDCB 1CS8A 4QRGA 1AU4A 4I05A 5JA7A 9PAPA 4N79A 3MORA 3H8BA 2DC7A 1BGOA 2DJGB 5F02A 1HUCB 2FO5A 1PPOA 3IMAA 4RY2A 1PE6A 2NQIA 4P6GA 1ICFA 4BS5A 1THEA 4YYRA 3P5WA 1O0EA 2ACTA 3KX1A 1U9WA 1EWMA 3H8CA 2E02A 2PBHA 1KHQA 4YYUA 1DF0A 3MTNA 1S4VA 3NHEA 4BSQA 2BDLA 1BQIA 3F75A 5FPWA 1VJVA 3N3KA 1NB3A 3O1GA 2R9OA 1MEMA 1U5IA 2GHUA 3P5VA 2DCBA 3BCNA 2E03A 3V6EA 4DMXA 3V6CA 2JQGR 5EGWA 1PXVA 2P86A
chains in the Genus database with same CATH superfamily
2FQ9A 4BS6A 1QMYA 2IPPB 5JZEA 3LFYA 3MJ5A 1M6DA 5PADA 4AXMA 2AVWA 4W5BA 3CH2X 3P5XA 5E6JA 3USVA 1Y4HA 1EWLA 2HWKA 2PNSA 4OELA 4QH6A 2PADA 1TLOA 4DMYA 2J7QA 1AECA 4BOSA 1AYWA 2GFOA 3CBJA 4YYWA 1NB5A 3PNRA 8PCHA 5CHTA 1XKGA 1QOLA 1BY8A 5K16A 1ITOA 3PHXA 7PCKA 1QXPA 2XU4A 3CBKA 2FRAA 4WURA 2DZZA 4D8IA 4G54A 4X6IA 1GLOA 2DZYA 4X6HA 3H89A 3O65A 3D6SA 1MEGA 2YJBA 3IHPA 4OW0A 2CB5A 3OQCA 1EWOA 1YZBA 2FTDA 4QBBA 1ZIVA 2UZJA 3QT4A 3IOQA 4A5UA 1EWPA 4YV8A 2R9NA 4MZOA 3MHSA 3MHHA 2NQGA 2HHNA 4HXDB 4GUAA 4I04A 1ME3A 1ATKA 3RVVA 2DC8A 3WXEA 2FT2A 4N4ZA 4N8WA 3N4CA 5EZQA 4REZA 4BOZA 3KSEA 4PP2E 2DCDA 2B1NA 1ZCMA 4IUMA 3E1ZB 2P0RA 3C9EA 2G8JA 2E01A 2PREA 5A24A 2R6NA 2CIOA 4ZUXU 3K8UA 1GCBA 2IBIA 1JQPA 1STFE 3O0UA 3TNXA 2O6XA 3BPMA 3E9SA 3BPFA 1KFUL 2HH5A 2Z84A 4MM3B 2BU3A 4BOUA 2OZ2A 4PI3A 1MS6A 4MI7A 1YALA 2G7YA 1MHWA 4FIPA 2XU3A 3ERVA 1PPDA 4OVZB 3PHWA 5CHVA 2Y5BA 2VHSA 2P7UA 3HD3A 3M99A 1PPPA 3K9MA 4QRXA 1F2CA 2JTCA 2FYEA 3PT2A 4RF1A 1PBHA 1CB5A 4XR7A 1AU0A 2YJCA 2R9MA 2AUZA 2F7DA 3P5UA 1U9VA 1Q6KA 4W4UA 1YK7A 4YYQA 1AYUA 1AU3A 3PRMA 1F2AA 2DCAA 2HD5A 4CZWA 2E00A 3I3TA 1CJLA 2HXZA 2VHFA 2YJ2A 4OEMA 4XZXA 3OVXA 2DCCA 2DC6A 2F1GA 2BTWA 1CSBB 3U8EA 1FH0A 2B1MA 1TL9A 2AS8A 1KXRA 1CV8A 2FRQA 4PADA 1YT7A 3C0RA 2JRIA 2DOSA 2DC9A 4MZSA 3HHAA 4QRVA 2R9FA 1ME4A 6PADA 1NPZA 4WA6A 1SNKA 2AUXA 3KKUA 3WXFA 4CDFB 3N3GA 1NLJA 1MDWA 3RVXA 2AYNA 1VSNA 3BC3A 1PVJA 1A6RA 2AGAA 1AYVA 1X9YA 1PCIA 5EZSA 3BB7A 1AU2A 4R3DA 2C0YA 3IEJA 4RNAA 4YYSA 4I07A 4P6EA 4IP3A 3H6SA 3PW3A 1NL6A 1F29A 2H7JA 3PBHA 3KWBX 1DKIA 4HWYA 3KWZA 4KLBA 3GCBA 1YVBA 3OF8A 3S3QA 4D8EA 2AU1A 3DF0A 4P16A 2FUDA 3QSDA 3TRKA 4CDEB 2NQDB 4BQVA 2R9CA 3F5VA 4X6JA 2OULA 2J7QC 1NQCA 3IFUA 3QJ3A 3ZUAA 1CVZA 1U9XA 4BPVA 1AIMA 4FJCA 3MTVA 3WXGA 5JH3A 3PSEA 3HWNA 3W31A 3PRPA 3OVZA 4FK5A 1CQDA 2YJ9A 1PIPA 2YJ8A 4YVAA 3I06A 2G8EA 1QDQA 1CTEA 4YYVA 1DEUA 3OF9A 1U9QX 1PADA 3B21A 4CDDB 3B79A 4AXLA 1GMYA 3S3RA 2AYOA 5EF4A 3RNVA 4ZTBA 2ARYA 1SP4B 2FE8A 2G6DA 2OP3A 2JQFR 1POPA 4D8BA 2BTWB 3BOWA 1YK8A 3HHIA 1MIRA 1K3BB 4Q8GA 4RKXA 3IUTA 3PDFA 4BOQA 3KFQA 3BBAA 4K7CA 4M0WA 2XU1A 3ZNHA 5CVOB 2BDZA 2AIMA 3IV2A 1F2BA 2ATOA 2DJFB 1PPNA 3RVWA 3BWKA 3K24A 1KHPA 3TMPA 3CH3X 3OISA 3AI8A 5CVNB 2Y6EA 1BP4A 3H7DA 1UKFA 4OVZA 4RF0A 1Y08A 1IWDA 2NQAA 5J94A 1GECE 5CVMA 2WBFX 4Q8HA 2XU5A 4PP1A 1CPJA 1KFXL 4W5CA 4XUIA 1EF7A 3LXSA 4MSXA 3KW9A 1TU6A 4CDCB 1CS8A 4QRGA 1AU4A 4I05A 5JA7A 9PAPA 4N79A 3MORA 3H8BA 2DC7A 1BGOA 2DJGB 5F02A 1HUCB 2FO5A 4BOPA 3PHUA 1PPOA 3IMAA 4RY2A 1PE6A 2NQIA 4PT5A 4P6GA 1ICFA 4BS5A 1THEA 4YYRA 3P5WA 5KO3A 1O0EA 2ACTA 3KX1A 1U9WA 3BY4A 1EWMA 3H8CA 3W30A 2E02A 2PBHA 1KHQA 4YYUA 1DF0A 3MTNA 1S4VA 3NHEA 4BSQA 2BDLA 1BQIA 3F75A 5FPWA 1VJVA 3N3KA 1NB3A 3O1GA 2R9OA 3MP2A 1MEMA 1U5IA 2GHUA 3P5VA 2DCBA 3BCNA 2E03A 3V6EA 4DMXA 3V6CA 2JQGR 5EGWA 1PXVA 2P86A
chains in the Genus database with same CATH topology
2FQ9A 4BS6A 1QMYA 2IPPB 3LFYA 1M6DA 5PADA 4AXMA 2AVWA 4W5BA 3CH2X 3P5XA 3USVA 1Y4HA 1EWLA 2PNSA 4QH6A 4OELA 4BGFA 2PADA 1TLOA 4DMYA 1AECA 1AYWA 2GFOA 3CBJA 4YYWA 1NB5A 3PNRA 8PCHA 5CHTA 1XKGA 1QOLA 1BY8A 5K16A 1ITOA 7PCKA 1QXPA 2XU4A 3CBKA 2FRAA 2DZZA 4G54A 4X6IA 1GLOA 2DZYA 4X6HA 3H89A 3D6SA 1MEGA 2YJBA 3IHPA 2CB5A 1EWOA 1W4TA 2FTDA 4QBBA 1ZIVA 1GX3A 3QT4A 4NV7A 3IOQA 4YV8A 1EWPA 2R9NA 4MZOA 3MHSA 3MHHA 2NQGA 2HHNA 2VFBA 4I04A 1ME3A 1ATKA 3RVVA 2DC8A 3WXEA 2FT2A 4N4ZA 4N8WA 3N4CA 3KSEA 4PP2E 2DCDA 2B1NA 1ZCMA 3E1ZB 2P0RA 3C9EA 2G8JA 2E01A 2PREA 5A24A 2R6NA 2CIOA 4ZUXU 3K8UA 1GCBA 2IBIA 1JQPA 1STFE 3O0UA 3TNXA 2O6XA 3BPMA 3BPFA 1KFUL 2HH5A 2OZ2A 4PI3A 1MS6A 1YALA 2G7YA 1MHWA 4FIPA 2XU3A 3ERVA 3D9WA 1PPDA 5CHVA 2Y5BA 2VHSA 2P7UA 3HD3A 3M99A 1PPPA 3K9MA 4QRXA 1F2CA 2FYEA 1PBHA 1CB5A 4XR7A 1AU0A 2YJCA 2R9MA 2AUZA 2F7DA 3P5UA 1U9VA 1Q6KA 4W4UA 1YK7A 4YYQA 1AYUA 1AU3A 1F2AA 2DCAA 2HD5A 4CZWA 2E00A 3I3TA 1CJLA 2HXZA 2VHFA 2YJ2A 4OEMA 3OVXA 2DCCA 2DC6A 2F1GA 1CSBB 3U8EA 1FH0A 2B1MA 1TL9A 2AS8A 1KXRA 1CV8A 2FRQA 4GUZA 4PADA 1YT7A 2DC9A 4MZSA 3HHAA 4QRVA 2R9FA 1ME4A 6PADA 1NPZA 4WA6A 1SNKA 2AUXA 3KKUA 3WXFA 4CDFB 3N3GA 1NLJA 1MDWA 3RVXA 2AYNA 1VSNA 3BC3A 1A6RA 1AYVA 1X9YA 1PCIA 1AU2A 2C0YA 3IEJA 4YYSA 4I07A 4P6EA 3H6SA 3PW3A 1NL6A 1F29A 2H7JA 3PBHA 3KWBX 4HWYA 3KWZA 4KLBA 3GCBA 1YVBA 3OF8A 3S3QA 2AU1A 3DF0A 2FUDA 3QSDA 4CDEB 2NQDB 4BQVA 2R9CA 3F5VA 4X6JA 2OULA 1NQCA 3QJ3A 3ZUAA 1CVZA 1U9XA 4BPVA 1AIMA 4FJCA 3WXGA 5JH3A 3HWNA 3OVZA 4FK5A 4NV8A 1CQDA 2YJ9A 1PIPA 2YJ8A 4YVAA 3I06A 2G8EA 1QDQA 1CTEA 4YYVA 1DEUA 3OF9A 1U9QX 1W5RA 1PADA 4CDDB 3B79A 4AXLA 1GMYA 3S3RA 2AYOA 5EF4A 2ARYA 1SP4B 4B55A 2G6DA 2OP3A 2JQFR 1POPA 1W6FA 3BOWA 1YK8A 3HHIA 1MIRA 1K3BB 4Q8GA 3IUTA 3PDFA 3KFQA 4K7CA 2XU1A 4C5PA 5CVOB 2BDZA 2VFCA 2AIMA 3IV2A 1F2BA 2ATOA 2DJFB 1PPNA 3RVWA 3BWKA 3K24A 1KHPA 3CH3X 3OISA 3AI8A 5CVNB 2Y6EA 1BP4A 3H7DA 1Y08A 1IWDA 2NQAA 5J94A 1GECE 5CVMA 2WBFX 4Q8HA 2XU5A 4PP1A 1CPJA 1KFXL 4W5CA 4XUIA 1EF7A 3LXSA 4MSXA 3KW9A 1TU6A 4CDCB 1CS8A 4QRGA 3LTWA 1AU4A 4I05A 5JA7A 9PAPA 4N79A 3MORA 3H8BA 2DC7A 1BGOA 2DJGB 5F02A 1HUCB 2FO5A 1PPOA 3IMAA 4RY2A 1PE6A 2NQIA 4P6GA 1ICFA 4BS5A 1THEA 4YYRA 3P5WA 1O0EA 2ACTA 3KX1A 1U9WA 1EWMA 3H8CA 2E02A 2PBHA 2BSZA 1KHQA 4YYUA 1DF0A 3MTNA 1S4VA 3NHEA 4BSQA 2BDLA 1E2TA 1BQIA 3F75A 5FPWA 1VJVA 3N3KA 1NB3A 3O1GA 2R9OA 1MEMA 1U5IA 2GHUA 3P5VA 2DCBA 3BCNA 2E03A 3V6EA 4DMXA 3V6CA 2JQGR 5EGWA 1PXVA 2P86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ9 A;  4BS6 A;  1QMY A;  2IPP B;  3LFY A;  1M6D A;  5PAD A;  4AXM A;  2AVW A;  4W5B A;  3CH2 X;  3P5X A;  3USV A;  1Y4H A;  1EWL A;  2PNS A;  4QH6 A;  4OEL A;  2PAD A;  1TLO A;  4DMY A;  1AEC A;  1AYW A;  2GFO A;  3CBJ A;  4YYW A;  1NB5 A;  3PNR A;  8PCH A;  5CHT A;  1XKG A;  1QOL A;  1BY8 A;  5K16 A;  1ITO A;  7PCK A;  1QXP A;  2XU4 A;  3CBK A;  2FRA A;  2DZZ A;  4G54 A;  4X6I A;  1GLO A;  2DZY A;  4X6H A;  3H89 A;  3D6S A;  1MEG A;  2YJB A;  3IHP A;  2CB5 A;  1EWO A;  2FTD A;  4QBB A;  1ZIV A;  3QT4 A;  3IOQ A;  4YV8 A;  1EWP A;  2R9N A;  4MZO A;  3MHS A;  3MHH A;  2NQG A;  2HHN A;  4I04 A;  1ME3 A;  1ATK A;  3RVV A;  2DC8 A;  3WXE A;  2FT2 A;  4N4Z A;  4N8W A;  3N4C A;  3KSE A;  4PP2 E;  2DCD A;  2B1N A;  1ZCM A;  3E1Z B;  2P0R A;  3C9E A;  2G8J A;  2E01 A;  2PRE A;  5A24 A;  2R6N A;  2CIO A;  4ZUX U;  3K8U A;  1GCB A;  2IBI A;  1JQP A;  1STF E;  3O0U A;  3TNX A;  2O6X A;  3BPM A;  3BPF A;  1KFU L;  2HH5 A;  2OZ2 A;  4PI3 A;  1MS6 A;  1YAL A;  2G7Y A;  1MHW A;  4FIP A;  2XU3 A;  3ERV A;  1PPD A;  5CHV A;  2Y5B A;  2VHS A;  2P7U A;  3HD3 A;  3M99 A;  1PPP A;  3K9M A;  4QRX A;  1F2C A;  2FYE A;  1PBH A;  1CB5 A;  4XR7 A;  1AU0 A;  2YJC A;  2R9M A;  2AUZ A;  2F7D A;  3P5U A;  1U9V A;  1Q6K A;  4W4U A;  1YK7 A;  4YYQ A;  1AYU A;  1AU3 A;  1F2A A;  2DCA A;  2HD5 A;  4CZW A;  2E00 A;  3I3T A;  1CJL A;  2HXZ A;  2VHF A;  2YJ2 A;  4OEM A;  3OVX A;  2DCC A;  2DC6 A;  2F1G A;  1CSB B;  3U8E A;  1FH0 A;  2B1M A;  1TL9 A;  2AS8 A;  1KXR A;  1CV8 A;  2FRQ A;  4PAD A;  1YT7 A;  2DC9 A;  4MZS A;  3HHA A;  4QRV A;  2R9F A;  1ME4 A;  6PAD A;  1NPZ A;  4WA6 A;  1SNK A;  2AUX A;  3KKU A;  3WXF A;  4CDF B;  3N3G A;  1NLJ A;  1MDW A;  3RVX A;  2AYN A;  1VSN A;  3BC3 A;  1A6R A;  1AYV A;  1X9Y A;  1PCI A;  1AU2 A;  2C0Y A;  3IEJ A;  4YYS A;  4I07 A;  4P6E A;  3H6S A;  3PW3 A;  1NL6 A;  1F29 A;  2H7J A;  3PBH A;  3KWB X;  4HWY A;  3KWZ A;  4KLB A;  3GCB A;  1YVB A;  3OF8 A;  3S3Q A;  2AU1 A;  3DF0 A;  2FUD A;  3QSD A;  4CDE B;  2NQD B;  4BQV A;  2R9C A;  3F5V A;  4X6J A;  2OUL A;  1NQC A;  3QJ3 A;  3ZUA A;  1CVZ A;  1U9X A;  4BPV A;  1AIM A;  4FJC A;  3WXG A;  5JH3 A;  3HWN A;  3OVZ A;  4FK5 A;  1CQD A;  2YJ9 A;  1PIP A;  2YJ8 A;  4YVA A;  3I06 A;  2G8E A;  1QDQ A;  1CTE A;  4YYV A;  1DEU A;  3OF9 A;  1U9Q X;  1PAD A;  4CDD B;  3B79 A;  4AXL A;  1GMY A;  3S3R A;  2AYO A;  5EF4 A;  2ARY A;  1SP4 B;  2G6D A;  2OP3 A;  2JQF R;  1POP A;  3BOW A;  1YK8 A;  3HHI A;  1MIR A;  1K3B B;  4Q8G A;  3IUT A;  3PDF A;  3KFQ A;  4K7C A;  2XU1 A;  5CVO B;  2BDZ A;  2AIM A;  3IV2 A;  1F2B A;  2ATO A;  2DJF B;  1PPN A;  3RVW A;  3BWK A;  3K24 A;  1KHP A;  3CH3 X;  3OIS A;  3AI8 A;  5CVN B;  2Y6E A;  1BP4 A;  3H7D A;  1Y08 A;  1IWD A;  2NQA A;  5J94 A;  1GEC E;  5CVM A;  2WBF X;  4Q8H A;  2XU5 A;  4PP1 A;  1CPJ A;  1KFX L;  4W5C A;  4XUI A;  1EF7 A;  3LXS A;  4MSX A;  3KW9 A;  1TU6 A;  4CDC B;  1CS8 A;  4QRG A;  1AU4 A;  4I05 A;  5JA7 A;  9PAP A;  4N79 A;  3MOR A;  3H8B A;  2DC7 A;  1BGO A;  2DJG B;  5F02 A;  1HUC B;  2FO5 A;  1PPO A;  3IMA A;  4RY2 A;  1PE6 A;  2NQI A;  4P6G A;  1ICF A;  4BS5 A;  1THE A;  4YYR A;  3P5W A;  1O0E A;  2ACT A;  3KX1 A;  1U9W A;  1EWM A;  3H8C A;  2E02 A;  2PBH A;  1KHQ A;  4YYU A;  1DF0 A;  3MTN A;  1S4V A;  3NHE A;  4BSQ A;  2BDL A;  1BQI A;  3F75 A;  5FPW A;  1VJV A;  3N3K A;  1NB3 A;  3O1G A;  2R9O A;  1MEM A;  1U5I A;  2GHU A;  3P5V A;  2DCB A;  3BCN A;  2E03 A;  3V6E A;  4DMX A;  3V6C A;  2JQG R;  5EGW A;  1PXV A;  2P86 A; 
#chains in the Genus database with same CATH topology
 2FQ9 A;  4BS6 A;  1QMY A;  2IPP B;  5JZE A;  3LFY A;  3MJ5 A;  1M6D A;  5PAD A;  4AXM A;  2AVW A;  4W5B A;  3CH2 X;  3P5X A;  5E6J A;  3USV A;  1Y4H A;  1EWL A;  2HWK A;  2PNS A;  4OEL A;  4QH6 A;  2PAD A;  1TLO A;  4DMY A;  2J7Q A;  1AEC A;  4BOS A;  1AYW A;  2GFO A;  3CBJ A;  4YYW A;  1NB5 A;  3PNR A;  8PCH A;  5CHT A;  1XKG A;  1QOL A;  1BY8 A;  5K16 A;  1ITO A;  3PHX A;  7PCK A;  1QXP A;  2XU4 A;  3CBK A;  2FRA A;  4WUR A;  2DZZ A;  4D8I A;  4G54 A;  4X6I A;  1GLO A;  2DZY A;  4X6H A;  3H89 A;  3O65 A;  3D6S A;  1MEG A;  2YJB A;  3IHP A;  4OW0 A;  2CB5 A;  3OQC A;  1EWO A;  1YZB A;  2FTD A;  4QBB A;  1ZIV A;  2UZJ A;  3QT4 A;  3IOQ A;  4A5U A;  1EWP A;  4YV8 A;  2R9N A;  4MZO A;  3MHS A;  3MHH A;  2NQG A;  2HHN A;  4HXD B;  4GUA A;  4I04 A;  1ME3 A;  1ATK A;  3RVV A;  2DC8 A;  3WXE A;  2FT2 A;  4N4Z A;  4N8W A;  3N4C A;  5EZQ A;  4REZ A;  4BOZ A;  3KSE A;  4PP2 E;  2DCD A;  2B1N A;  1ZCM A;  4IUM A;  3E1Z B;  2P0R A;  3C9E A;  2G8J A;  2E01 A;  2PRE A;  5A24 A;  2R6N A;  2CIO A;  4ZUX U;  3K8U A;  1GCB A;  2IBI A;  1JQP A;  1STF E;  3O0U A;  3TNX A;  2O6X A;  3BPM A;  3E9S A;  3BPF A;  1KFU L;  2HH5 A;  2Z84 A;  4MM3 B;  2BU3 A;  4BOU A;  2OZ2 A;  4PI3 A;  1MS6 A;  4MI7 A;  1YAL A;  2G7Y A;  1MHW A;  4FIP A;  2XU3 A;  3ERV A;  1PPD A;  4OVZ B;  3PHW A;  5CHV A;  2Y5B A;  2VHS A;  2P7U A;  3HD3 A;  3M99 A;  1PPP A;  3K9M A;  4QRX A;  1F2C A;  2JTC A;  2FYE A;  3PT2 A;  4RF1 A;  1PBH A;  1CB5 A;  4XR7 A;  1AU0 A;  2YJC A;  2R9M A;  2AUZ A;  2F7D A;  3P5U A;  1U9V A;  1Q6K A;  4W4U A;  1YK7 A;  4YYQ A;  1AYU A;  1AU3 A;  3PRM A;  1F2A A;  2DCA A;  2HD5 A;  4CZW A;  2E00 A;  3I3T A;  1CJL A;  2HXZ A;  2VHF A;  2YJ2 A;  4OEM A;  4XZX A;  3OVX A;  2DCC A;  2DC6 A;  2F1G A;  2BTW A;  1CSB B;  3U8E A;  1FH0 A;  2B1M A;  1TL9 A;  2AS8 A;  1KXR A;  1CV8 A;  2FRQ A;  4PAD A;  1YT7 A;  3C0R A;  2JRI A;  2DOS A;  2DC9 A;  4MZS A;  3HHA A;  4QRV A;  2R9F A;  1ME4 A;  6PAD A;  1NPZ A;  4WA6 A;  1SNK A;  2AUX A;  3KKU A;  3WXF A;  4CDF B;  3N3G A;  1NLJ A;  1MDW A;  3RVX A;  2AYN A;  1VSN A;  3BC3 A;  1PVJ A;  1A6R A;  2AGA A;  1AYV A;  1X9Y A;  1PCI A;  5EZS A;  3BB7 A;  1AU2 A;  4R3D A;  2C0Y A;  3IEJ A;  4RNA A;  4YYS A;  4I07 A;  4P6E A;  4IP3 A;  3H6S A;  3PW3 A;  1NL6 A;  1F29 A;  2H7J A;  3PBH A;  3KWB X;  1DKI A;  4HWY A;  3KWZ A;  4KLB A;  3GCB A;  1YVB A;  3OF8 A;  3S3Q A;  4D8E A;  2AU1 A;  3DF0 A;  4P16 A;  2FUD A;  3QSD A;  3TRK A;  4CDE B;  2NQD B;  4BQV A;  2R9C A;  3F5V A;  4X6J A;  2OUL A;  2J7Q C;  1NQC A;  3IFU A;  3QJ3 A;  3ZUA A;  1CVZ A;  1U9X A;  4BPV A;  1AIM A;  4FJC A;  3MTV A;  3WXG A;  5JH3 A;  3PSE A;  3HWN A;  3W31 A;  3PRP A;  3OVZ A;  4FK5 A;  1CQD A;  2YJ9 A;  1PIP A;  2YJ8 A;  4YVA A;  3I06 A;  2G8E A;  1QDQ A;  1CTE A;  4YYV A;  1DEU A;  3OF9 A;  1U9Q X;  1PAD A;  3B21 A;  4CDD B;  3B79 A;  4AXL A;  1GMY A;  3S3R A;  2AYO A;  5EF4 A;  3RNV A;  4ZTB A;  2ARY A;  1SP4 B;  2FE8 A;  2G6D A;  2OP3 A;  2JQF R;  1POP A;  4D8B A;  2BTW B;  3BOW A;  1YK8 A;  3HHI A;  1MIR A;  1K3B B;  4Q8G A;  4RKX A;  3IUT A;  3PDF A;  4BOQ A;  3KFQ A;  3BBA A;  4K7C A;  4M0W A;  2XU1 A;  3ZNH A;  5CVO B;  2BDZ A;  2AIM A;  3IV2 A;  1F2B A;  2ATO A;  2DJF B;  1PPN A;  3RVW A;  3BWK A;  3K24 A;  1KHP A;  3TMP A;  3CH3 X;  3OIS A;  3AI8 A;  5CVN B;  2Y6E A;  1BP4 A;  3H7D A;  1UKF A;  4OVZ A;  4RF0 A;  1Y08 A;  1IWD A;  2NQA A;  5J94 A;  1GEC E;  5CVM A;  2WBF X;  4Q8H A;  2XU5 A;  4PP1 A;  1CPJ A;  1KFX L;  4W5C A;  4XUI A;  1EF7 A;  3LXS A;  4MSX A;  3KW9 A;  1TU6 A;  4CDC B;  1CS8 A;  4QRG A;  1AU4 A;  4I05 A;  5JA7 A;  9PAP A;  4N79 A;  3MOR A;  3H8B A;  2DC7 A;  1BGO A;  2DJG B;  5F02 A;  1HUC B;  2FO5 A;  4BOP A;  3PHU A;  1PPO A;  3IMA A;  4RY2 A;  1PE6 A;  2NQI A;  4PT5 A;  4P6G A;  1ICF A;  4BS5 A;  1THE A;  4YYR A;  3P5W A;  5KO3 A;  1O0E A;  2ACT A;  3KX1 A;  1U9W A;  3BY4 A;  1EWM A;  3H8C A;  3W30 A;  2E02 A;  2PBH A;  1KHQ A;  4YYU A;  1DF0 A;  3MTN A;  1S4V A;  3NHE A;  4BSQ A;  2BDL A;  1BQI A;  3F75 A;  5FPW A;  1VJV A;  3N3K A;  1NB3 A;  3O1G A;  2R9O A;  3MP2 A;  1MEM A;  1U5I A;  2GHU A;  3P5V A;  2DCB A;  3BCN A;  2E03 A;  3V6E A;  4DMX A;  3V6C A;  2JQG R;  5EGW A;  1PXV A;  2P86 A; 
#chains in the Genus database with same CATH homology
 2FQ9 A;  4BS6 A;  1QMY A;  2IPP B;  3LFY A;  1M6D A;  5PAD A;  4AXM A;  2AVW A;  4W5B A;  3CH2 X;  3P5X A;  3USV A;  1Y4H A;  1EWL A;  2PNS A;  4QH6 A;  4OEL A;  4BGF A;  2PAD A;  1TLO A;  4DMY A;  1AEC A;  1AYW A;  2GFO A;  3CBJ A;  4YYW A;  1NB5 A;  3PNR A;  8PCH A;  5CHT A;  1XKG A;  1QOL A;  1BY8 A;  5K16 A;  1ITO A;  7PCK A;  1QXP A;  2XU4 A;  3CBK A;  2FRA A;  2DZZ A;  4G54 A;  4X6I A;  1GLO A;  2DZY A;  4X6H A;  3H89 A;  3D6S A;  1MEG A;  2YJB A;  3IHP A;  2CB5 A;  1EWO A;  1W4T A;  2FTD A;  4QBB A;  1ZIV A;  1GX3 A;  3QT4 A;  4NV7 A;  3IOQ A;  4YV8 A;  1EWP A;  2R9N A;  4MZO A;  3MHS A;  3MHH A;  2NQG A;  2HHN A;  2VFB A;  4I04 A;  1ME3 A;  1ATK A;  3RVV A;  2DC8 A;  3WXE A;  2FT2 A;  4N4Z A;  4N8W A;  3N4C A;  3KSE A;  4PP2 E;  2DCD A;  2B1N A;  1ZCM A;  3E1Z B;  2P0R A;  3C9E A;  2G8J A;  2E01 A;  2PRE A;  5A24 A;  2R6N A;  2CIO A;  4ZUX U;  3K8U A;  1GCB A;  2IBI A;  1JQP A;  1STF E;  3O0U A;  3TNX A;  2O6X A;  3BPM A;  3BPF A;  1KFU L;  2HH5 A;  2OZ2 A;  4PI3 A;  1MS6 A;  1YAL A;  2G7Y A;  1MHW A;  4FIP A;  2XU3 A;  3ERV A;  3D9W A;  1PPD A;  5CHV A;  2Y5B A;  2VHS A;  2P7U A;  3HD3 A;  3M99 A;  1PPP A;  3K9M A;  4QRX A;  1F2C A;  2FYE A;  1PBH A;  1CB5 A;  4XR7 A;  1AU0 A;  2YJC A;  2R9M A;  2AUZ A;  2F7D A;  3P5U A;  1U9V A;  1Q6K A;  4W4U A;  1YK7 A;  4YYQ A;  1AYU A;  1AU3 A;  1F2A A;  2DCA A;  2HD5 A;  4CZW A;  2E00 A;  3I3T A;  1CJL A;  2HXZ A;  2VHF A;  2YJ2 A;  4OEM A;  3OVX A;  2DCC A;  2DC6 A;  2F1G A;  1CSB B;  3U8E A;  1FH0 A;  2B1M A;  1TL9 A;  2AS8 A;  1KXR A;  1CV8 A;  2FRQ A;  4GUZ A;  4PAD A;  1YT7 A;  2DC9 A;  4MZS A;  3HHA A;  4QRV A;  2R9F A;  1ME4 A;  6PAD A;  1NPZ A;  4WA6 A;  1SNK A;  2AUX A;  3KKU A;  3WXF A;  4CDF B;  3N3G A;  1NLJ A;  1MDW A;  3RVX A;  2AYN A;  1VSN A;  3BC3 A;  1A6R A;  1AYV A;  1X9Y A;  1PCI A;  1AU2 A;  2C0Y A;  3IEJ A;  4YYS A;  4I07 A;  4P6E A;  3H6S A;  3PW3 A;  1NL6 A;  1F29 A;  2H7J A;  3PBH A;  3KWB X;  4HWY A;  3KWZ A;  4KLB A;  3GCB A;  1YVB A;  3OF8 A;  3S3Q A;  2AU1 A;  3DF0 A;  2FUD A;  3QSD A;  4CDE B;  2NQD B;  4BQV A;  2R9C A;  3F5V A;  4X6J A;  2OUL A;  1NQC A;  3QJ3 A;  3ZUA A;  1CVZ A;  1U9X A;  4BPV A;  1AIM A;  4FJC A;  3WXG A;  5JH3 A;  3HWN A;  3OVZ A;  4FK5 A;  4NV8 A;  1CQD A;  2YJ9 A;  1PIP A;  2YJ8 A;  4YVA A;  3I06 A;  2G8E A;  1QDQ A;  1CTE A;  4YYV A;  1DEU A;  3OF9 A;  1U9Q X;  1W5R A;  1PAD A;  4CDD B;  3B79 A;  4AXL A;  1GMY A;  3S3R A;  2AYO A;  5EF4 A;  2ARY A;  1SP4 B;  4B55 A;  2G6D A;  2OP3 A;  2JQF R;  1POP A;  1W6F A;  3BOW A;  1YK8 A;  3HHI A;  1MIR A;  1K3B B;  4Q8G A;  3IUT A;  3PDF A;  3KFQ A;  4K7C A;  2XU1 A;  4C5P A;  5CVO B;  2BDZ A;  2VFC A;  2AIM A;  3IV2 A;  1F2B A;  2ATO A;  2DJF B;  1PPN A;  3RVW A;  3BWK A;  3K24 A;  1KHP A;  3CH3 X;  3OIS A;  3AI8 A;  5CVN B;  2Y6E A;  1BP4 A;  3H7D A;  1Y08 A;  1IWD A;  2NQA A;  5J94 A;  1GEC E;  5CVM A;  2WBF X;  4Q8H A;  2XU5 A;  4PP1 A;  1CPJ A;  1KFX L;  4W5C A;  4XUI A;  1EF7 A;  3LXS A;  4MSX A;  3KW9 A;  1TU6 A;  4CDC B;  1CS8 A;  4QRG A;  3LTW A;  1AU4 A;  4I05 A;  5JA7 A;  9PAP A;  4N79 A;  3MOR A;  3H8B A;  2DC7 A;  1BGO A;  2DJG B;  5F02 A;  1HUC B;  2FO5 A;  1PPO A;  3IMA A;  4RY2 A;  1PE6 A;  2NQI A;  4P6G A;  1ICF A;  4BS5 A;  1THE A;  4YYR A;  3P5W A;  1O0E A;  2ACT A;  3KX1 A;  1U9W A;  1EWM A;  3H8C A;  2E02 A;  2PBH A;  2BSZ A;  1KHQ A;  4YYU A;  1DF0 A;  3MTN A;  1S4V A;  3NHE A;  4BSQ A;  2BDL A;  1E2T A;  1BQI A;  3F75 A;  5FPW A;  1VJV A;  3N3K A;  1NB3 A;  3O1G A;  2R9O A;  1MEM A;  1U5I A;  2GHU A;  3P5V A;  2DCB A;  3BCN A;  2E03 A;  3V6E A;  4DMX A;  3V6C A;  2JQG R;  5EGW A;  1PXV A;  2P86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...