1PXVA

The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
183
Chain Sequence
b'GHHHHHHEFDQVQYENTLKNFKIREQQFDNSWAAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Staphostatin-Staphopain Complex: A FORWARD BINDING INHIBITOR IN COMPLEX WITH ITS TARGET CYSTEINE PROTEASE.
pubmed doi rcsb
molecule keywords cysteine protease
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 53
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pxvA00
4DMYA 3KKUA 3WXEA 4W5BA 4CZWA 5CVNB 1ATKA 1PPPA 2XU4A 4N8WA 3IMAA 3QJ3A 1QXPA 3P5VA 3CH2X 1Y08A 2DC6A 2AUXA 2G6DA 2WBFX 2CIOA 3KFQA 2YJCA 2YJ9A 3RVXA 3MHSA 4YYSA 1KHPA 2DCAA 2AU1A 1ZCMA 3K9MA 1CS8A 3ZUAA 2NQIA 1TU6A 2Y6EA 4QRVA 1PIPA 4I05A 1AECA 3S3QA 4YYUA 3OVZA 5FPWA 4MZOA 4G54A 4AXMA 3P5UA 1HUCB 1SP4B 9PAPA 1BP4A 3H7DA 3MHHA 2HH5A 1EF7A 3IEJA 1AU0A 1MIRA 2FRAA 3WXFA 2IPPB 2R6NA 1TL9A 3F5VA 8PCHA 1NB5A 2FYEA 3K24A 4N79A 1NLJA 3RVWA 3M99A 3P5XA 7PCKA 4PP1A 3I3TA 1KHQA 1GECE 4X6IA 2ARYA 3ERVA 2E03A 1AU3A 2G8JA 4MZSA 3BWKA 1NB3A 2FUDA 3IOQA 2PADA 5CVMA 4OELA 1THEA 1GLOA 3KSEA 2P86A 3LXSA 1GMYA 1A6RA 3N4CA 4YVAA 1BQIA 1AU2A 1YVBA 3U8EA 2NQGA 2G8EA 1M6DA 2HXZA 3BPFA 3CBJA 3PNRA 3HD3A 4BPVA 3OVXA 5CVOB 2AIMA 1CJLA 3O0UA 1YK7A 3LFYA 4ZUXU 4RY2A 2DC8A 4P6GA 1CQDA 4BS5A 2F7DA 3BC3A 2AUZA 2BDZA 4X6JA 4OEMA 1VSNA 4CDFB 6PADA 2DZYA 2B1NA 2R9FA 1F2CA 2O6XA 2XU5A 3PBHA 2AYNA 1IWDA 1YALA 1PXVA 1ME3A 3V6CA 3KWZA 1PCIA 3MORA 1F2BA 1PBHA 2B1MA 2ACTA 4YYWA 2PNSA 4YYQA 4P6EA 4CDDB 3KX1A 1ITOA 1CVZA 1EWOA 3H8BA 2F1GA 1F2AA 2DCBA 1K3BB 3K8UA 4Q8GA 1U5IA 3CBKA 4CDEB 2DZZA 1NPZA 3QSDA 1ICFA 3S3RA 3E1ZB 3QT4A 2YJBA 2VHFA 4QBBA 2DC9A 1ME4A 2FQ9A 3IV2A 1SNKA 1MDWA 4PP2E 5A24A 4W5CA 1O0EA 2P7UA 4N4ZA 1Y4HA 3WXGA 3CH3X 1AIMA 2YJ8A 3BCNA 1EWPA 1U9XA 3C9EA 2OZ2A 1MS6A 1AYWA 4HWYA 3TNXA 3HHAA 4Q8HA 5F02A 1PPOA 1U9QX 1BY8A 3O1GA 1KFUL 4YYVA 2E00A 2YJ2A 1XKGA 3KWBX 1KXRA 2Y5BA 2PREA 1CB5A 2FT2A 4FJCA 5J94A 3HHIA 4DMXA 2E01A 2HD5A 3N3GA 3PDFA 2H7JA 3H89A 3H8CA 5PADA 1AYUA 1S4VA 3HWNA 4I04A 3RVVA 1AU4A 1AYVA 5JH3A 5JA7A 2IBIA 3F75A 2PBHA 4K7CA 3BOWA 5EF4A 3B79A 1FH0A 2OULA 3N3KA 4QRXA 2FRQA 1MHWA 4FIPA 1U9VA 2P0RA 2R9MA 3OISA 1ZIVA 2R9NA 3I06A 1GCBA 1VJVA 3IHPA 1YT7A 1NL6A 1BGOA 1X9YA 4PI3A 3P5WA 1KFXL 1U9WA 2HHNA 1MEMA 4PADA 5EGWA 3OF8A 4CDCB 2NQAA 3USVA 1PADA 3V6EA 4BSQA 1CPJA 1F29A 4BS6A 2XU1A 1CV8A 1PPNA 1CTEA 3OF9A 4AXLA 3PW3A 2OP3A 2XU3A 1QOLA 1QDQA 2JQFR 1EWLA 1DF0A 2R9OA 4QRGA 1PPDA 4FK5A 2DC7A 2CB5A 2DJGB 4QH6A 3BPMA 3AI8A 4MSXA 4BQVA 5CHVA 2GFOA 2FTDA 2DCCA 4KLBA 1MEGA 2GHUA 4XR7A 3MTNA 2C0YA 1POPA 5K16A 1PE6A 4YV8A 1QMYA 3H6SA 3IUTA 2AS8A 1DEUA 2VHSA 4XUIA 1EWMA 3D6SA 2DCDA 2FO5A 2G7YA 2NQDB 3GCBA 2E02A 2R9CA 2JQGR 1NQCA 4YYRA 4X6HA 1STFE 1Q6KA 1TLOA 2AYOA 4W4UA 2BDLA 3KW9A 5CHTA 4WA6A 2ATOA 2AVWA 3DF0A 4I07A 2DJFB 1YK8A 1CSBB 1JQPA 3NHEA
chains in the Genus database with same CATH superfamily
4DMYA 3KKUA 3WXEA 4W5BA 4CZWA 5CVNB 1ATKA 1PPPA 2XU4A 4N8WA 3IMAA 3QJ3A 1QXPA 3P5VA 3CH2X 1Y08A 2DC6A 2AUXA 2G6DA 2WBFX 2CIOA 2BTWA 3KFQA 2YJCA 3PHWA 2YJ9A 3RVXA 4BOSA 3MHSA 4OVZB 4YYSA 1KHPA 2DCAA 2AU1A 1ZCMA 3K9MA 1CS8A 3ZUAA 2NQIA 1TU6A 5EZQA 2Y6EA 4QRVA 1PIPA 4I05A 1AECA 3S3QA 4YYUA 3OVZA 5FPWA 4MZOA 4G54A 4AXMA 4IP3A 3P5UA 1HUCB 3C0RA 1SP4B 2Z84A 9PAPA 5JZEA 1BP4A 3H7DA 3MHHA 2HH5A 1EF7A 5KO3A 3IEJA 1AU0A 1MIRA 2FRAA 3WXFA 2IPPB 1YZBA 2R6NA 1TL9A 3F5VA 8PCHA 1NB5A 2FYEA 3W30A 3K24A 4N79A 1NLJA 3RVWA 3M99A 4M0WA 3P5XA 7PCKA 4PP1A 3I3TA 1KHQA 1GECE 4X6IA 2ARYA 3ERVA 4MM3B 3MTVA 2AGAA 2E03A 1AU3A 2G8JA 4MZSA 3BWKA 1NB3A 2FUDA 3IOQA 2PADA 5EZSA 5CVMA 4OELA 1THEA 2BU3A 1GLOA 3KSEA 2P86A 3LXSA 1GMYA 1A6RA 3N4CA 4YVAA 1BQIA 1AU2A 1YVBA 3U8EA 2NQGA 2G8EA 1M6DA 2HXZA 3BPFA 3CBJA 3PNRA 3HD3A 4BPVA 3OQCA 3OVXA 5CVOB 2AIMA 3BY4A 2JTCA 2J7QC 1CJLA 3O0UA 1YK7A 3W31A 4BOZA 3LFYA 4ZUXU 4RY2A 2DC8A 4P6GA 1CQDA 4BS5A 2F7DA 3BC3A 2AUZA 2BDZA 4X6JA 4OEMA 1VSNA 4CDFB 6PADA 2DZYA 2B1NA 2UZJA 2R9FA 1F2CA 2O6XA 2XU5A 5E6JA 3PBHA 2AYNA 1IWDA 3MP2A 1UKFA 1YALA 3RNVA 3BB7A 1PXVA 2DOSA 1ME3A 3V6CA 3KWZA 4PT5A 1PCIA 3MORA 1F2BA 2J7QA 1PBHA 3PRPA 2B1MA 2ACTA 4YYWA 2PNSA 4YYQA 4P6EA 4CDDB 3KX1A 4ZTBA 1ITOA 1CVZA 1EWOA 3H8BA 2F1GA 4WURA 1F2AA 2DCBA 1K3BB 3K8UA 4Q8GA 1U5IA 4XZXA 3CBKA 2BTWB 4IUMA 4CDEB 2DZZA 1NPZA 3TMPA 3QSDA 1ICFA 3S3RA 3E1ZB 3QT4A 2YJBA 2VHFA 2DC9A 4QBBA 1ME4A 2FQ9A 3IV2A 3PRMA 1SNKA 1MDWA 4PP2E 3PSEA 5A24A 4W5CA 1O0EA 2P7UA 4N4ZA 1Y4HA 3WXGA 3CH3X 1AIMA 2YJ8A 3BCNA 1EWPA 1U9XA 3C9EA 2OZ2A 1MS6A 1AYWA 3O65A 4HWYA 3TNXA 3HHAA 4Q8HA 5F02A 1PPOA 1U9QX 1BY8A 3O1GA 4P16A 4D8BA 1KFUL 4YYVA 2E00A 2YJ2A 1XKGA 3KWBX 1KXRA 2Y5BA 2PREA 4REZA 1CB5A 2FT2A 4FJCA 5J94A 3HHIA 4DMXA 2E01A 2HD5A 4RKXA 3N3GA 4GUAA 3PDFA 3PT2A 2H7JA 3H89A 3H8CA 5PADA 1AYUA 1S4VA 3HWNA 4I04A 3RVVA 4MI7A 1AU4A 1AYVA 5JH3A 5JA7A 2IBIA 3F75A 4BOUA 2PBHA 4K7CA 2FE8A 3BOWA 5EF4A 3B79A 2JRIA 1FH0A 2OULA 3N3KA 4QRXA 2FRQA 1MHWA 4FIPA 1U9VA 2P0RA 2R9MA 3OISA 4RNAA 4D8IA 1ZIVA 2R9NA 3I06A 1GCBA 1VJVA 3IHPA 3ZNHA 1YT7A 1NL6A 1BGOA 1X9YA 4PI3A 3P5WA 1KFXL 1U9WA 2HHNA 1MEMA 4PADA 5EGWA 1PVJA 3OF8A 4CDCB 2NQAA 3USVA 1PADA 3V6EA 4BSQA 1CPJA 1F29A 4BS6A 2XU1A 1CV8A 1PPNA 1CTEA 3PHUA 3OF9A 4R3DA 4AXLA 3PW3A 2OP3A 4D8EA 2XU3A 1DKIA 1QOLA 1QDQA 2JQFR 1EWLA 3IFUA 1DF0A 2R9OA 4QRGA 1PPDA 3PHXA 2HWKA 4FK5A 2DC7A 2CB5A 4HXDB 2DJGB 4QH6A 4OW0A 3BPMA 4BOQA 3AI8A 4MSXA 4BQVA 5CHVA 2GFOA 2FTDA 2DCCA 4KLBA 1MEGA 3E9SA 2GHUA 4XR7A 3MTNA 2C0YA 1POPA 4RF1A 5K16A 1PE6A 4YV8A 1QMYA 3H6SA 3IUTA 2AS8A 1DEUA 2VHSA 4XUIA 1EWMA 3D6SA 2DCDA 2FO5A 2G7YA 2NQDB 3GCBA 4A5UA 2E02A 2R9CA 3BBAA 2JQGR 1NQCA 4YYRA 4X6HA 3B21A 1STFE 1Q6KA 1TLOA 2AYOA 4W4UA 2BDLA 3KW9A 4OVZA 5CHTA 4BOPA 4RF0A 4WA6A 2ATOA 2AVWA 3DF0A 4I07A 2DJFB 3MJ5A 3TRKA 1YK8A 1CSBB 1JQPA 3NHEA
chains in the Genus database with same CATH topology
4DMYA 3KKUA 3WXEA 4W5BA 4CZWA 5CVNB 1ATKA 1PPPA 2XU4A 4N8WA 3IMAA 3QJ3A 1QXPA 3P5VA 3CH2X 1Y08A 2DC6A 2AUXA 2G6DA 2WBFX 2CIOA 3KFQA 2BSZA 2YJCA 2YJ9A 3RVXA 3MHSA 4YYSA 1KHPA 2DCAA 2AU1A 1ZCMA 3K9MA 1CS8A 3ZUAA 2NQIA 1TU6A 2Y6EA 4QRVA 1PIPA 4NV7A 4I05A 1AECA 3S3QA 4YYUA 3OVZA 5FPWA 4MZOA 4G54A 4AXMA 3P5UA 1HUCB 1SP4B 9PAPA 1BP4A 3H7DA 3MHHA 2HH5A 1EF7A 3IEJA 1AU0A 1MIRA 2FRAA 3WXFA 2IPPB 2R6NA 1TL9A 3F5VA 8PCHA 1NB5A 2FYEA 3K24A 4N79A 1NLJA 3RVWA 3M99A 2VFBA 3P5XA 7PCKA 4PP1A 3I3TA 1KHQA 1GECE 4X6IA 2ARYA 3ERVA 2E03A 1AU3A 2G8JA 4MZSA 3BWKA 1NB3A 2FUDA 3IOQA 2PADA 4C5PA 5CVMA 4OELA 1THEA 1GLOA 3KSEA 2P86A 3LXSA 1GMYA 1A6RA 3N4CA 4YVAA 1BQIA 1AU2A 1YVBA 3U8EA 1W6FA 2NQGA 2G8EA 1M6DA 2HXZA 1W5RA 3BPFA 3CBJA 3PNRA 3HD3A 4BPVA 3OVXA 5CVOB 2AIMA 1CJLA 3O0UA 1YK7A 3LFYA 4ZUXU 4RY2A 2DC8A 4BGFA 4P6GA 1CQDA 4BS5A 2F7DA 3BC3A 2AUZA 2BDZA 4X6JA 4OEMA 1VSNA 4CDFB 6PADA 2DZYA 2B1NA 2R9FA 1F2CA 2O6XA 2XU5A 3PBHA 2AYNA 1IWDA 1YALA 1PXVA 1ME3A 3V6CA 3KWZA 1PCIA 3MORA 1F2BA 1PBHA 2B1MA 2ACTA 1W4TA 4YYWA 2PNSA 4GUZA 4YYQA 4P6EA 4CDDB 3KX1A 1ITOA 1CVZA 1EWOA 3H8BA 2F1GA 1F2AA 2DCBA 1K3BB 3K8UA 4Q8GA 1U5IA 3CBKA 4CDEB 2DZZA 1NPZA 3QSDA 1ICFA 3S3RA 3E1ZB 3QT4A 2YJBA 2VHFA 2DC9A 4QBBA 1ME4A 1GX3A 2FQ9A 3IV2A 1SNKA 1MDWA 4PP2E 4NV8A 5A24A 4W5CA 1O0EA 2P7UA 4N4ZA 1Y4HA 3WXGA 3CH3X 1AIMA 2YJ8A 3BCNA 1EWPA 1U9XA 3C9EA 2OZ2A 1MS6A 1AYWA 4HWYA 3TNXA 3HHAA 4Q8HA 5F02A 1PPOA 1U9QX 1BY8A 3O1GA 1KFUL 4YYVA 2E00A 2YJ2A 1XKGA 3KWBX 1KXRA 2Y5BA 2PREA 1CB5A 2FT2A 4FJCA 5J94A 3HHIA 4DMXA 2E01A 2HD5A 3N3GA 3PDFA 2H7JA 3H89A 3H8CA 5PADA 1AYUA 1S4VA 3HWNA 4I04A 3RVVA 1AU4A 1AYVA 5JH3A 5JA7A 2IBIA 3F75A 2PBHA 4K7CA 3BOWA 5EF4A 3B79A 1FH0A 2OULA 3N3KA 4QRXA 4B55A 2FRQA 1MHWA 4FIPA 1U9VA 2P0RA 2R9MA 3OISA 1ZIVA 2R9NA 3I06A 1GCBA 1VJVA 3IHPA 1YT7A 1NL6A 1BGOA 1X9YA 4PI3A 3P5WA 1KFXL 1U9WA 2HHNA 1MEMA 4PADA 5EGWA 3OF8A 4CDCB 2NQAA 3USVA 1PADA 3V6EA 4BSQA 1CPJA 1F29A 4BS6A 2XU1A 1CV8A 1PPNA 3LTWA 1CTEA 3OF9A 4AXLA 3PW3A 2OP3A 2XU3A 1QOLA 1QDQA 2JQFR 1EWLA 1DF0A 2R9OA 4QRGA 1PPDA 4FK5A 2DC7A 2CB5A 2DJGB 4QH6A 3BPMA 3AI8A 4MSXA 4BQVA 5CHVA 2GFOA 2FTDA 2DCCA 4KLBA 1MEGA 2GHUA 4XR7A 3MTNA 2C0YA 1POPA 5K16A 1PE6A 4YV8A 1QMYA 3H6SA 3IUTA 2AS8A 1DEUA 2VFCA 2VHSA 3D9WA 4XUIA 1EWMA 3D6SA 2DCDA 2FO5A 2G7YA 2NQDB 1E2TA 3GCBA 2E02A 2R9CA 2JQGR 1NQCA 4YYRA 4X6HA 1STFE 1Q6KA 1TLOA 2AYOA 4W4UA 2BDLA 3KW9A 5CHTA 4WA6A 2ATOA 2AVWA 3DF0A 4I07A 2DJFB 1YK8A 1CSBB 1JQPA 3NHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMY A;  3KKU A;  3WXE A;  4W5B A;  4CZW A;  5CVN B;  1ATK A;  1PPP A;  2XU4 A;  4N8W A;  3IMA A;  3QJ3 A;  1QXP A;  3P5V A;  3CH2 X;  1Y08 A;  2DC6 A;  2AUX A;  2G6D A;  2WBF X;  2CIO A;  3KFQ A;  2YJC A;  2YJ9 A;  3RVX A;  3MHS A;  4YYS A;  1KHP A;  2DCA A;  2AU1 A;  1ZCM A;  3K9M A;  1CS8 A;  3ZUA A;  2NQI A;  1TU6 A;  2Y6E A;  4QRV A;  1PIP A;  4I05 A;  1AEC A;  3S3Q A;  4YYU A;  3OVZ A;  5FPW A;  4MZO A;  4G54 A;  4AXM A;  3P5U A;  1HUC B;  1SP4 B;  9PAP A;  1BP4 A;  3H7D A;  3MHH A;  2HH5 A;  1EF7 A;  3IEJ A;  1AU0 A;  1MIR A;  2FRA A;  3WXF A;  2IPP B;  2R6N A;  1TL9 A;  3F5V A;  8PCH A;  1NB5 A;  2FYE A;  3K24 A;  4N79 A;  1NLJ A;  3RVW A;  3M99 A;  3P5X A;  7PCK A;  4PP1 A;  3I3T A;  1KHQ A;  1GEC E;  4X6I A;  2ARY A;  3ERV A;  2E03 A;  1AU3 A;  2G8J A;  4MZS A;  3BWK A;  1NB3 A;  2FUD A;  3IOQ A;  2PAD A;  5CVM A;  4OEL A;  1THE A;  1GLO A;  3KSE A;  2P86 A;  3LXS A;  1GMY A;  1A6R A;  3N4C A;  4YVA A;  1BQI A;  1AU2 A;  1YVB A;  3U8E A;  2NQG A;  2G8E A;  1M6D A;  2HXZ A;  3BPF A;  3CBJ A;  3PNR A;  3HD3 A;  4BPV A;  3OVX A;  5CVO B;  2AIM A;  1CJL A;  3O0U A;  1YK7 A;  3LFY A;  4ZUX U;  4RY2 A;  2DC8 A;  4P6G A;  1CQD A;  4BS5 A;  2F7D A;  3BC3 A;  2AUZ A;  2BDZ A;  4X6J A;  4OEM A;  1VSN A;  4CDF B;  6PAD A;  2DZY A;  2B1N A;  2R9F A;  1F2C A;  2O6X A;  2XU5 A;  3PBH A;  2AYN A;  1IWD A;  1YAL A;  1PXV A;  1ME3 A;  3V6C A;  3KWZ A;  1PCI A;  3MOR A;  1F2B A;  1PBH A;  2B1M A;  2ACT A;  4YYW A;  2PNS A;  4YYQ A;  4P6E A;  4CDD B;  3KX1 A;  1ITO A;  1CVZ A;  1EWO A;  3H8B A;  2F1G A;  1F2A A;  2DCB A;  1K3B B;  3K8U A;  4Q8G A;  1U5I A;  3CBK A;  4CDE B;  2DZZ A;  1NPZ A;  3QSD A;  1ICF A;  3S3R A;  3E1Z B;  3QT4 A;  2YJB A;  2VHF A;  4QBB A;  2DC9 A;  1ME4 A;  2FQ9 A;  3IV2 A;  1SNK A;  1MDW A;  4PP2 E;  5A24 A;  4W5C A;  1O0E A;  2P7U A;  4N4Z A;  1Y4H A;  3WXG A;  3CH3 X;  1AIM A;  2YJ8 A;  3BCN A;  1EWP A;  1U9X A;  3C9E A;  2OZ2 A;  1MS6 A;  1AYW A;  4HWY A;  3TNX A;  3HHA A;  4Q8H A;  5F02 A;  1PPO A;  1U9Q X;  1BY8 A;  3O1G A;  1KFU L;  4YYV A;  2E00 A;  2YJ2 A;  1XKG A;  3KWB X;  1KXR A;  2Y5B A;  2PRE A;  1CB5 A;  2FT2 A;  4FJC A;  5J94 A;  3HHI A;  4DMX A;  2E01 A;  2HD5 A;  3N3G A;  3PDF A;  2H7J A;  3H89 A;  3H8C A;  5PAD A;  1AYU A;  1S4V A;  3HWN A;  4I04 A;  3RVV A;  1AU4 A;  1AYV A;  5JH3 A;  5JA7 A;  2IBI A;  3F75 A;  2PBH A;  4K7C A;  3BOW A;  5EF4 A;  3B79 A;  1FH0 A;  2OUL A;  3N3K A;  4QRX A;  2FRQ A;  1MHW A;  4FIP A;  1U9V A;  2P0R A;  2R9M A;  3OIS A;  1ZIV A;  2R9N A;  3I06 A;  1GCB A;  1VJV A;  3IHP A;  1YT7 A;  1NL6 A;  1BGO A;  1X9Y A;  4PI3 A;  3P5W A;  1KFX L;  1U9W A;  2HHN A;  1MEM A;  4PAD A;  5EGW A;  3OF8 A;  4CDC B;  2NQA A;  3USV A;  1PAD A;  3V6E A;  4BSQ A;  1CPJ A;  1F29 A;  4BS6 A;  2XU1 A;  1CV8 A;  1PPN A;  1CTE A;  3OF9 A;  4AXL A;  3PW3 A;  2OP3 A;  2XU3 A;  1QOL A;  1QDQ A;  2JQF R;  1EWL A;  1DF0 A;  2R9O A;  4QRG A;  1PPD A;  4FK5 A;  2DC7 A;  2CB5 A;  2DJG B;  4QH6 A;  3BPM A;  3AI8 A;  4MSX A;  4BQV A;  5CHV A;  2GFO A;  2FTD A;  2DCC A;  4KLB A;  1MEG A;  2GHU A;  4XR7 A;  3MTN A;  2C0Y A;  1POP A;  5K16 A;  1PE6 A;  4YV8 A;  1QMY A;  3H6S A;  3IUT A;  2AS8 A;  1DEU A;  2VHS A;  4XUI A;  1EWM A;  3D6S A;  2DCD A;  2FO5 A;  2G7Y A;  2NQD B;  3GCB A;  2E02 A;  2R9C A;  2JQG R;  1NQC A;  4YYR A;  4X6H A;  1STF E;  1Q6K A;  1TLO A;  2AYO A;  4W4U A;  2BDL A;  3KW9 A;  5CHT A;  4WA6 A;  2ATO A;  2AVW A;  3DF0 A;  4I07 A;  2DJF B;  1YK8 A;  1CSB B;  1JQP A;  3NHE A; 
#chains in the Genus database with same CATH topology
 4DMY A;  3KKU A;  3WXE A;  4W5B A;  4CZW A;  5CVN B;  1ATK A;  1PPP A;  2XU4 A;  4N8W A;  3IMA A;  3QJ3 A;  1QXP A;  3P5V A;  3CH2 X;  1Y08 A;  2DC6 A;  2AUX A;  2G6D A;  2WBF X;  2CIO A;  2BTW A;  3KFQ A;  2YJC A;  3PHW A;  2YJ9 A;  3RVX A;  4BOS A;  3MHS A;  4OVZ B;  4YYS A;  1KHP A;  2DCA A;  2AU1 A;  1ZCM A;  3K9M A;  1CS8 A;  3ZUA A;  2NQI A;  1TU6 A;  5EZQ A;  2Y6E A;  4QRV A;  1PIP A;  4I05 A;  1AEC A;  3S3Q A;  4YYU A;  3OVZ A;  5FPW A;  4MZO A;  4G54 A;  4AXM A;  4IP3 A;  3P5U A;  1HUC B;  3C0R A;  1SP4 B;  2Z84 A;  9PAP A;  5JZE A;  1BP4 A;  3H7D A;  3MHH A;  2HH5 A;  1EF7 A;  5KO3 A;  3IEJ A;  1AU0 A;  1MIR A;  2FRA A;  3WXF A;  2IPP B;  1YZB A;  2R6N A;  1TL9 A;  3F5V A;  8PCH A;  1NB5 A;  2FYE A;  3W30 A;  3K24 A;  4N79 A;  1NLJ A;  3RVW A;  3M99 A;  4M0W A;  3P5X A;  7PCK A;  4PP1 A;  3I3T A;  1KHQ A;  1GEC E;  4X6I A;  2ARY A;  3ERV A;  4MM3 B;  3MTV A;  2AGA A;  2E03 A;  1AU3 A;  2G8J A;  4MZS A;  3BWK A;  1NB3 A;  2FUD A;  3IOQ A;  2PAD A;  5EZS A;  5CVM A;  4OEL A;  1THE A;  2BU3 A;  1GLO A;  3KSE A;  2P86 A;  3LXS A;  1GMY A;  1A6R A;  3N4C A;  4YVA A;  1BQI A;  1AU2 A;  1YVB A;  3U8E A;  2NQG A;  2G8E A;  1M6D A;  2HXZ A;  3BPF A;  3CBJ A;  3PNR A;  3HD3 A;  4BPV A;  3OQC A;  3OVX A;  5CVO B;  2AIM A;  3BY4 A;  2JTC A;  2J7Q C;  1CJL A;  3O0U A;  1YK7 A;  3W31 A;  4BOZ A;  3LFY A;  4ZUX U;  4RY2 A;  2DC8 A;  4P6G A;  1CQD A;  4BS5 A;  2F7D A;  3BC3 A;  2AUZ A;  2BDZ A;  4X6J A;  4OEM A;  1VSN A;  4CDF B;  6PAD A;  2DZY A;  2B1N A;  2UZJ A;  2R9F A;  1F2C A;  2O6X A;  2XU5 A;  5E6J A;  3PBH A;  2AYN A;  1IWD A;  3MP2 A;  1UKF A;  1YAL A;  3RNV A;  3BB7 A;  1PXV A;  2DOS A;  1ME3 A;  3V6C A;  3KWZ A;  4PT5 A;  1PCI A;  3MOR A;  1F2B A;  2J7Q A;  1PBH A;  3PRP A;  2B1M A;  2ACT A;  4YYW A;  2PNS A;  4YYQ A;  4P6E A;  4CDD B;  3KX1 A;  4ZTB A;  1ITO A;  1CVZ A;  1EWO A;  3H8B A;  2F1G A;  4WUR A;  1F2A A;  2DCB A;  1K3B B;  3K8U A;  4Q8G A;  1U5I A;  4XZX A;  3CBK A;  2BTW B;  4IUM A;  4CDE B;  2DZZ A;  1NPZ A;  3TMP A;  3QSD A;  1ICF A;  3S3R A;  3E1Z B;  3QT4 A;  2YJB A;  2VHF A;  2DC9 A;  4QBB A;  1ME4 A;  2FQ9 A;  3IV2 A;  3PRM A;  1SNK A;  1MDW A;  4PP2 E;  3PSE A;  5A24 A;  4W5C A;  1O0E A;  2P7U A;  4N4Z A;  1Y4H A;  3WXG A;  3CH3 X;  1AIM A;  2YJ8 A;  3BCN A;  1EWP A;  1U9X A;  3C9E A;  2OZ2 A;  1MS6 A;  1AYW A;  3O65 A;  4HWY A;  3TNX A;  3HHA A;  4Q8H A;  5F02 A;  1PPO A;  1U9Q X;  1BY8 A;  3O1G A;  4P16 A;  4D8B A;  1KFU L;  4YYV A;  2E00 A;  2YJ2 A;  1XKG A;  3KWB X;  1KXR A;  2Y5B A;  2PRE A;  4REZ A;  1CB5 A;  2FT2 A;  4FJC A;  5J94 A;  3HHI A;  4DMX A;  2E01 A;  2HD5 A;  4RKX A;  3N3G A;  4GUA A;  3PDF A;  3PT2 A;  2H7J A;  3H89 A;  3H8C A;  5PAD A;  1AYU A;  1S4V A;  3HWN A;  4I04 A;  3RVV A;  4MI7 A;  1AU4 A;  1AYV A;  5JH3 A;  5JA7 A;  2IBI A;  3F75 A;  4BOU A;  2PBH A;  4K7C A;  2FE8 A;  3BOW A;  5EF4 A;  3B79 A;  2JRI A;  1FH0 A;  2OUL A;  3N3K A;  4QRX A;  2FRQ A;  1MHW A;  4FIP A;  1U9V A;  2P0R A;  2R9M A;  3OIS A;  4RNA A;  4D8I A;  1ZIV A;  2R9N A;  3I06 A;  1GCB A;  1VJV A;  3IHP A;  3ZNH A;  1YT7 A;  1NL6 A;  1BGO A;  1X9Y A;  4PI3 A;  3P5W A;  1KFX L;  1U9W A;  2HHN A;  1MEM A;  4PAD A;  5EGW A;  1PVJ A;  3OF8 A;  4CDC B;  2NQA A;  3USV A;  1PAD A;  3V6E A;  4BSQ A;  1CPJ A;  1F29 A;  4BS6 A;  2XU1 A;  1CV8 A;  1PPN A;  1CTE A;  3PHU A;  3OF9 A;  4R3D A;  4AXL A;  3PW3 A;  2OP3 A;  4D8E A;  2XU3 A;  1DKI A;  1QOL A;  1QDQ A;  2JQF R;  1EWL A;  3IFU A;  1DF0 A;  2R9O A;  4QRG A;  1PPD A;  3PHX A;  2HWK A;  4FK5 A;  2DC7 A;  2CB5 A;  4HXD B;  2DJG B;  4QH6 A;  4OW0 A;  3BPM A;  4BOQ A;  3AI8 A;  4MSX A;  4BQV A;  5CHV A;  2GFO A;  2FTD A;  2DCC A;  4KLB A;  1MEG A;  3E9S A;  2GHU A;  4XR7 A;  3MTN A;  2C0Y A;  1POP A;  4RF1 A;  5K16 A;  1PE6 A;  4YV8 A;  1QMY A;  3H6S A;  3IUT A;  2AS8 A;  1DEU A;  2VHS A;  4XUI A;  1EWM A;  3D6S A;  2DCD A;  2FO5 A;  2G7Y A;  2NQD B;  3GCB A;  4A5U A;  2E02 A;  2R9C A;  3BBA A;  2JQG R;  1NQC A;  4YYR A;  4X6H A;  3B21 A;  1STF E;  1Q6K A;  1TLO A;  2AYO A;  4W4U A;  2BDL A;  3KW9 A;  4OVZ A;  5CHT A;  4BOP A;  4RF0 A;  4WA6 A;  2ATO A;  2AVW A;  3DF0 A;  4I07 A;  2DJF B;  3MJ5 A;  3TRK A;  1YK8 A;  1CSB B;  1JQP A;  3NHE A; 
#chains in the Genus database with same CATH homology
 4DMY A;  3KKU A;  3WXE A;  4W5B A;  4CZW A;  5CVN B;  1ATK A;  1PPP A;  2XU4 A;  4N8W A;  3IMA A;  3QJ3 A;  1QXP A;  3P5V A;  3CH2 X;  1Y08 A;  2DC6 A;  2AUX A;  2G6D A;  2WBF X;  2CIO A;  3KFQ A;  2BSZ A;  2YJC A;  2YJ9 A;  3RVX A;  3MHS A;  4YYS A;  1KHP A;  2DCA A;  2AU1 A;  1ZCM A;  3K9M A;  1CS8 A;  3ZUA A;  2NQI A;  1TU6 A;  2Y6E A;  4QRV A;  1PIP A;  4NV7 A;  4I05 A;  1AEC A;  3S3Q A;  4YYU A;  3OVZ A;  5FPW A;  4MZO A;  4G54 A;  4AXM A;  3P5U A;  1HUC B;  1SP4 B;  9PAP A;  1BP4 A;  3H7D A;  3MHH A;  2HH5 A;  1EF7 A;  3IEJ A;  1AU0 A;  1MIR A;  2FRA A;  3WXF A;  2IPP B;  2R6N A;  1TL9 A;  3F5V A;  8PCH A;  1NB5 A;  2FYE A;  3K24 A;  4N79 A;  1NLJ A;  3RVW A;  3M99 A;  2VFB A;  3P5X A;  7PCK A;  4PP1 A;  3I3T A;  1KHQ A;  1GEC E;  4X6I A;  2ARY A;  3ERV A;  2E03 A;  1AU3 A;  2G8J A;  4MZS A;  3BWK A;  1NB3 A;  2FUD A;  3IOQ A;  2PAD A;  4C5P A;  5CVM A;  4OEL A;  1THE A;  1GLO A;  3KSE A;  2P86 A;  3LXS A;  1GMY A;  1A6R A;  3N4C A;  4YVA A;  1BQI A;  1AU2 A;  1YVB A;  3U8E A;  1W6F A;  2NQG A;  2G8E A;  1M6D A;  2HXZ A;  1W5R A;  3BPF A;  3CBJ A;  3PNR A;  3HD3 A;  4BPV A;  3OVX A;  5CVO B;  2AIM A;  1CJL A;  3O0U A;  1YK7 A;  3LFY A;  4ZUX U;  4RY2 A;  2DC8 A;  4BGF A;  4P6G A;  1CQD A;  4BS5 A;  2F7D A;  3BC3 A;  2AUZ A;  2BDZ A;  4X6J A;  4OEM A;  1VSN A;  4CDF B;  6PAD A;  2DZY A;  2B1N A;  2R9F A;  1F2C A;  2O6X A;  2XU5 A;  3PBH A;  2AYN A;  1IWD A;  1YAL A;  1PXV A;  1ME3 A;  3V6C A;  3KWZ A;  1PCI A;  3MOR A;  1F2B A;  1PBH A;  2B1M A;  2ACT A;  1W4T A;  4YYW A;  2PNS A;  4GUZ A;  4YYQ A;  4P6E A;  4CDD B;  3KX1 A;  1ITO A;  1CVZ A;  1EWO A;  3H8B A;  2F1G A;  1F2A A;  2DCB A;  1K3B B;  3K8U A;  4Q8G A;  1U5I A;  3CBK A;  4CDE B;  2DZZ A;  1NPZ A;  3QSD A;  1ICF A;  3S3R A;  3E1Z B;  3QT4 A;  2YJB A;  2VHF A;  2DC9 A;  4QBB A;  1ME4 A;  1GX3 A;  2FQ9 A;  3IV2 A;  1SNK A;  1MDW A;  4PP2 E;  4NV8 A;  5A24 A;  4W5C A;  1O0E A;  2P7U A;  4N4Z A;  1Y4H A;  3WXG A;  3CH3 X;  1AIM A;  2YJ8 A;  3BCN A;  1EWP A;  1U9X A;  3C9E A;  2OZ2 A;  1MS6 A;  1AYW A;  4HWY A;  3TNX A;  3HHA A;  4Q8H A;  5F02 A;  1PPO A;  1U9Q X;  1BY8 A;  3O1G A;  1KFU L;  4YYV A;  2E00 A;  2YJ2 A;  1XKG A;  3KWB X;  1KXR A;  2Y5B A;  2PRE A;  1CB5 A;  2FT2 A;  4FJC A;  5J94 A;  3HHI A;  4DMX A;  2E01 A;  2HD5 A;  3N3G A;  3PDF A;  2H7J A;  3H89 A;  3H8C A;  5PAD A;  1AYU A;  1S4V A;  3HWN A;  4I04 A;  3RVV A;  1AU4 A;  1AYV A;  5JH3 A;  5JA7 A;  2IBI A;  3F75 A;  2PBH A;  4K7C A;  3BOW A;  5EF4 A;  3B79 A;  1FH0 A;  2OUL A;  3N3K A;  4QRX A;  4B55 A;  2FRQ A;  1MHW A;  4FIP A;  1U9V A;  2P0R A;  2R9M A;  3OIS A;  1ZIV A;  2R9N A;  3I06 A;  1GCB A;  1VJV A;  3IHP A;  1YT7 A;  1NL6 A;  1BGO A;  1X9Y A;  4PI3 A;  3P5W A;  1KFX L;  1U9W A;  2HHN A;  1MEM A;  4PAD A;  5EGW A;  3OF8 A;  4CDC B;  2NQA A;  3USV A;  1PAD A;  3V6E A;  4BSQ A;  1CPJ A;  1F29 A;  4BS6 A;  2XU1 A;  1CV8 A;  1PPN A;  3LTW A;  1CTE A;  3OF9 A;  4AXL A;  3PW3 A;  2OP3 A;  2XU3 A;  1QOL A;  1QDQ A;  2JQF R;  1EWL A;  1DF0 A;  2R9O A;  4QRG A;  1PPD A;  4FK5 A;  2DC7 A;  2CB5 A;  2DJG B;  4QH6 A;  3BPM A;  3AI8 A;  4MSX A;  4BQV A;  5CHV A;  2GFO A;  2FTD A;  2DCC A;  4KLB A;  1MEG A;  2GHU A;  4XR7 A;  3MTN A;  2C0Y A;  1POP A;  5K16 A;  1PE6 A;  4YV8 A;  1QMY A;  3H6S A;  3IUT A;  2AS8 A;  1DEU A;  2VFC A;  2VHS A;  3D9W A;  4XUI A;  1EWM A;  3D6S A;  2DCD A;  2FO5 A;  2G7Y A;  2NQD B;  1E2T A;  3GCB A;  2E02 A;  2R9C A;  2JQG R;  1NQC A;  4YYR A;  4X6H A;  1STF E;  1Q6K A;  1TLO A;  2AYO A;  4W4U A;  2BDL A;  3KW9 A;  5CHT A;  4WA6 A;  2ATO A;  2AVW A;  3DF0 A;  4I07 A;  2DJF B;  1YK8 A;  1CSB B;  1JQP A;  3NHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...