1PXVA

The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
183
Chain Sequence
GHHHHHHEFDQVQYENTLKNFKIREQQFDNSWAAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords cysteine protease
publication title The Staphostatin-Staphopain Complex: A FORWARD BINDING INHIBITOR IN COMPLEX WITH ITS TARGET CYSTEINE PROTEASE.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 53
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pxvA00
2R9NA 1GLOA 2JQFR 1TL9A 3N4CA 2VHFA 2PNSA 1STFE 3I3TA 3BWKA 1EF7A 3OISA 2AS8A 2E00A 2ACTA 2F1GA 2P86A 1MHWA 4KLBA 2BDZA 1BP4A 1AYWA 3QSDA 2DJFB 1NB3A 3QJ3A 5PADA 4MSXA 4YYWA 1M6DA 2ARYA 1KFXL 2CIOA 3O1GA 4YYRA 2DCDA 3H89A 4X6JA 3IEJA 1A6RA 4W5CA 6PADA 3CH2X 1GCBA 2IPPB 5CVMA 3I06A 4CDFB 3QT4A 2OZ2A 3F5VA 3PNRA 2NQIA 4RY2A 1CPJA 2E02A 1JQPA 2DC7A 9PAPA 1PBHA 1NPZA 5EGWA 2FRQA 1U9VA 3H8CA 1CQDA 3F75A 2PBHA 2G7YA 1POPA 2DZYA 2G8JA 2VHSA 1CJLA 5CVNB 1PPDA 4QRVA 1ME4A 3BPMA 3V6EA 1O0EA 2B1NA 1PPNA 3M99A 2AIMA 3IUTA 3D6SA 4DMXA 3KKUA 1EWLA 1NLJA 2OULA 2YJ8A 1VJVA 4BS6A 1NQCA 3MORA 4G54A 1AYUA 2NQAA 1CB5A 4DMYA 3BC3A 3USVA 2DJGB 4PADA 4X6HA 3RVXA 4K7CA 3LFYA 2NQDB 2R9MA 1ICFA 1QXPA 3KWBX 1QDQA 2IBIA 2FUDA 3OF9A 1PCIA 4YYVA 2FTDA 4FK5A 2CB5A 1BGOA 2DC9A 4QH6A 3WXGA 1U5IA 1DF0A 3DF0A 2FYEA 2FRAA 2JQGR 1BQIA 1PADA 2GFOA 2C0YA 1MIRA 2Y5BA 2HXZA 1IWDA 1GECE 2AVWA 3OF8A 1EWMA 1KHPA 2DC8A 1DEUA 1ATKA 4BSQA 3B79A 3TNXA 3O0UA 3U8EA 1U9QX 1YALA 3IHPA 2AUXA 2PREA 3ERVA 3AI8A 1TU6A 2DZZA 1F2AA 2BDLA 3LXSA 3IV2A 4YYUA 1AU4A 3CH3X 2P7UA 1YK8A 4X6IA 4N8WA 4QBBA 4W4UA 1CV8A 1GMYA 5FPWA 4CDDB 2DCBA 2WBFX 3N3KA 3K8UA 3P5XA 1YK7A 5J94A 1AYVA 2FO5A 2E01A 1ZIVA 2GHUA 1AU3A 3P5VA 4YV8A 3K9MA 3P5WA 2G8EA 2H7JA 3CBKA 2DCCA 2HHNA 1XKGA 2AYOA 1X9YA 4BPVA 3HWNA 1MEMA 3P5UA 2OP3A 4BQVA 1PIPA 1AU2A 4YYSA 1K3BB 1Q6KA 4QRXA 1ITOA 3PW3A 2DCAA 1SP4B 5JH3A 4WA6A 2AU1A 4PP1A 4Q8HA 3S3QA 1MDWA 2DC6A 3E1ZB 3GCBA 1AECA 4AXMA 3KFQA 3PDFA 1CS8A 2P0RA 4BS5A 2AUZA 3KX1A 3N3GA 4XUIA 4CDEB 4Q8GA 1YT7A 3MHHA 2B1MA 5K16A 1MS6A 3H8BA 1FH0A 2R9FA 3CBJA 1CVZA 3BPFA 1NL6A 4FJCA 1PPOA 5A24A 1YVBA 4FIPA 1PXVA 4P6GA 3NHEA 1F2CA 4W5BA 1ZCMA 2E03A 4ZUXU 1BY8A 2XU4A 1CSBB 2FT2A 3H7DA 3MHSA 1S4VA 3C9EA 1QMYA 1CTEA 1MEGA 1AIMA 2XU5A 3BCNA 2FQ9A 3WXFA 3IOQA 1U9XA 1Y08A 2G6DA 5EF4A 1KFUL 8PCHA 3V6CA 2PADA 2R9OA 3PBHA 4P6EA 2YJBA 2HD5A 1KHQA 4N4ZA 4AXLA 4OELA 2YJCA 1HUCB 1PPPA 4MZSA 3RVVA 2R6NA 1KXRA 3KWZA 3OVXA 4I04A 1AU0A 3RVWA 2ATOA 1F29A 1ME3A 5CVOB 3KSEA 5F02A 1PE6A 4QRGA 2O6XA 2Y6EA 4XR7A 3BOWA 1Y4HA 5JA7A 4CDCB 1F2BA 3WXEA 3OVZA 3ZUAA 3IMAA 1TLOA 2XU3A 2F7DA 1NB5A 5CHTA 4YVAA 2NQGA 4PP2E 7PCKA 1EWOA 4PI3A 1U9WA 1EWPA 1VSNA 5CHVA 4MZOA 1THEA 1QOLA 2YJ9A 4N79A 4HWYA 3S3RA 2R9CA 2HH5A 3K24A 2XU1A 4I05A 3MTNA 3HHAA 4I07A 3KW9A 1SNKA 3HHIA 4YYQA 3HD3A 2AYNA 4CZWA 4OEMA 3H6SA 2YJ2A
chains in the Genus database with same CATH superfamily
2R9NA 1GLOA 2JQFR 1TL9A 3N4CA 2VHFA 2PNSA 1STFE 2BU3A 1DKIA 3I3TA 3BWKA 1EF7A 3OISA 2AS8A 2E00A 2ACTA 2F1GA 2P86A 1MHWA 4KLBA 2BTWA 2BDZA 1BP4A 1AYWA 2J7QC 3QSDA 2DJFB 1NB3A 3QJ3A 5PADA 3B21A 4MSXA 4YYWA 1M6DA 2ARYA 1KFXL 2CIOA 3O1GA 4YYRA 2DCDA 3H89A 4X6JA 3IEJA 1A6RA 2FE8A 4W5CA 6PADA 3CH2X 5KO3A 4OVZB 1GCBA 2IPPB 5CVMA 4MI7A 3I06A 3PHUA 4CDFB 3QT4A 2OZ2A 3C0RA 2JRIA 3PRMA 3F5VA 3PNRA 4A5UA 2NQIA 4RY2A 1CPJA 2E02A 1JQPA 2DC7A 9PAPA 1PBHA 1NPZA 4BOQA 5EGWA 2FRQA 1U9VA 3H8CA 4RKXA 1CQDA 3F75A 2PBHA 2G7YA 1POPA 2DZYA 2G8JA 2VHSA 1CJLA 1YZBA 5CVNB 1PPDA 4QRVA 1ME4A 3BPMA 3V6EA 1O0EA 4OW0A 2B1NA 1PPNA 3M99A 2AIMA 3IUTA 3D6SA 4DMXA 4D8BA 3KKUA 1EWLA 1NLJA 2OULA 2YJ8A 1VJVA 4BS6A 1UKFA 1NQCA 2J7QA 3MORA 4G54A 1AYUA 2NQAA 1CB5A 4DMYA 3BC3A 3USVA 5EZSA 2DJGB 4PADA 4X6HA 3RVXA 4K7CA 3LFYA 2NQDB 3PT2A 2R9MA 1ICFA 4BOUA 1QXPA 3KWBX 1QDQA 2IBIA 2FUDA 3OF9A 1PCIA 4YYVA 2FTDA 4FK5A 2CB5A 1BGOA 3MTVA 2DC9A 4QH6A 3WXGA 1U5IA 1DF0A 3DF0A 2FYEA 2FRAA 2JQGR 1BQIA 1PADA 4RNAA 2GFOA 2C0YA 1MIRA 2Y5BA 2HXZA 4GUAA 1IWDA 1GECE 2AVWA 3OF8A 3W31A 3OQCA 1EWMA 1KHPA 2DC8A 1DEUA 1ATKA 3PHWA 4BSQA 3B79A 3MP2A 3TNXA 3O0UA 3U8EA 1U9QX 1YALA 3IHPA 2AUXA 2PREA 3ERVA 4R3DA 4D8EA 3AI8A 1TU6A 2DZZA 1F2AA 3BBAA 2BDLA 5E6JA 4M0WA 3LXSA 3IV2A 4RF1A 4YYUA 1AU4A 3CH3X 2P7UA 1YK8A 4X6IA 4N8WA 4QBBA 4W4UA 1CV8A 2JTCA 1GMYA 5FPWA 2HWKA 4CDDB 2DCBA 3BB7A 2WBFX 3N3KA 3K8UA 3P5XA 1YK7A 5J94A 1AYVA 2FO5A 2E01A 1ZIVA 4MM3B 2GHUA 1AU3A 3P5VA 4YV8A 4XZXA 3K9MA 3P5WA 2G8EA 2H7JA 3CBKA 2DCCA 2HHNA 1PVJA 1XKGA 2AYOA 1X9YA 4BPVA 4IUMA 3HWNA 3MJ5A 1MEMA 3P5UA 2OP3A 4BQVA 4BOPA 1PIPA 1AU2A 4YYSA 1K3BB 1Q6KA 1ITOA 3PW3A 4QRXA 2DCAA 3E9SA 3TMPA 1SP4B 5JH3A 4WA6A 2AU1A 4PP1A 4Q8HA 3S3QA 1MDWA 2DC6A 4BOSA 3W30A 3E1ZB 3GCBA 1AECA 4AXMA 3KFQA 3PDFA 3PRPA 1CS8A 4OVZA 2P0RA 4BS5A 2AUZA 3KX1A 3N3GA 2Z84A 4XUIA 4CDEB 4Q8GA 1YT7A 3MHHA 2B1MA 5K16A 4BOZA 1MS6A 3H8BA 1FH0A 2R9FA 2AGAA 3CBJA 1CVZA 4D8IA 3BPFA 1NL6A 4FJCA 1PPOA 5EZQA 5A24A 4ZTBA 1YVBA 3PHXA 4FIPA 1PXVA 3RNVA 4P6GA 3NHEA 1F2CA 4W5BA 1ZCMA 2E03A 4ZUXU 4PT5A 1BY8A 2XU4A 1CSBB 2FT2A 3H7DA 3MHSA 1S4VA 3C9EA 1QMYA 1CTEA 1MEGA 1AIMA 2XU5A 3BCNA 2FQ9A 4REZA 3WXFA 3IOQA 1U9XA 1Y08A 2G6DA 5EF4A 1KFUL 4WURA 8PCHA 3V6CA 2PADA 2R9OA 3PBHA 4P6EA 2YJBA 2HD5A 1KHQA 4N4ZA 4AXLA 4OELA 3ZNHA 2YJCA 1HUCB 1PPPA 4MZSA 4HXDB 3RVVA 2R6NA 1KXRA 3KWZA 3OVXA 4I04A 4IP3A 1AU0A 3PSEA 3RVWA 2ATOA 2BTWB 1F29A 1ME3A 5CVOB 3KSEA 2DOSA 5F02A 1PE6A 4QRGA 2O6XA 2Y6EA 4XR7A 3BOWA 1Y4HA 5JA7A 4CDCB 1F2BA 4RF0A 3WXEA 2UZJA 3OVZA 3ZUAA 3IMAA 1TLOA 2XU3A 2F7DA 1NB5A 5CHTA 4YVAA 5JZEA 2NQGA 4PP2E 7PCKA 1EWOA 3IFUA 4PI3A 1U9WA 1EWPA 1VSNA 5CHVA 4MZOA 1THEA 1QOLA 2YJ9A 3BY4A 4N79A 4HWYA 3O65A 3S3RA 2R9CA 2HH5A 3K24A 2XU1A 4I05A 3TRKA 3MTNA 3HHAA 4I07A 4P16A 3KW9A 1SNKA 3HHIA 4YYQA 3HD3A 2AYNA 4CZWA 4OEMA 3H6SA 2YJ2A
chains in the Genus database with same CATH topology
2R9NA 1GLOA 2JQFR 1TL9A 3N4CA 2VHFA 2PNSA 1STFE 3I3TA 3BWKA 1EF7A 3OISA 2AS8A 2E00A 2ACTA 2F1GA 1W4TA 2P86A 1MHWA 4KLBA 2BDZA 1BP4A 1AYWA 4GUZA 3QSDA 2DJFB 1NB3A 3QJ3A 5PADA 4MSXA 4YYWA 1M6DA 2ARYA 1KFXL 2CIOA 3O1GA 4YYRA 2DCDA 3H89A 4X6JA 3IEJA 1A6RA 4W5CA 6PADA 3CH2X 1GCBA 2IPPB 5CVMA 3I06A 4CDFB 3QT4A 2OZ2A 3F5VA 3PNRA 2NQIA 4RY2A 1CPJA 2E02A 1JQPA 2DC7A 9PAPA 1PBHA 1NPZA 5EGWA 2FRQA 1U9VA 3H8CA 1CQDA 3F75A 2PBHA 2G7YA 1POPA 2DZYA 4B55A 2G8JA 2VHSA 1CJLA 5CVNB 1PPDA 4QRVA 1ME4A 3BPMA 3V6EA 1O0EA 3D9WA 1W5RA 2B1NA 1PPNA 3M99A 2AIMA 3IUTA 3D6SA 4DMXA 3KKUA 1EWLA 1GX3A 1NLJA 2OULA 2YJ8A 1VJVA 4BS6A 1NQCA 3MORA 4G54A 1AYUA 2NQAA 1CB5A 4DMYA 3BC3A 3USVA 2DJGB 4PADA 4X6HA 3RVXA 4K7CA 3LFYA 2NQDB 2R9MA 1ICFA 1QXPA 3KWBX 1QDQA 2IBIA 2FUDA 3OF9A 1PCIA 4YYVA 2FTDA 4FK5A 2CB5A 1BGOA 2DC9A 4QH6A 3WXGA 1U5IA 1DF0A 3DF0A 2FYEA 2FRAA 2JQGR 1BQIA 1PADA 2GFOA 2C0YA 1MIRA 2Y5BA 2HXZA 1IWDA 1GECE 2AVWA 3OF8A 1EWMA 1KHPA 2DC8A 1DEUA 1ATKA 4BSQA 3B79A 3TNXA 3O0UA 3U8EA 1U9QX 1YALA 3IHPA 2AUXA 2PREA 3ERVA 3AI8A 1TU6A 2DZZA 1F2AA 2BDLA 3LXSA 3IV2A 4YYUA 3LTWA 4BGFA 4NV7A 1AU4A 3CH3X 2P7UA 1YK8A 4X6IA 4N8WA 4QBBA 4W4UA 1CV8A 1GMYA 5FPWA 4CDDB 2DCBA 2WBFX 3N3KA 3K8UA 3P5XA 1YK7A 5J94A 1AYVA 2FO5A 1E2TA 2E01A 1ZIVA 2GHUA 1AU3A 3P5VA 4YV8A 3K9MA 3P5WA 2G8EA 2H7JA 3CBKA 2DCCA 2HHNA 2VFBA 1XKGA 2AYOA 1X9YA 4BPVA 3HWNA 1MEMA 4NV8A 3P5UA 2OP3A 4BQVA 1PIPA 1AU2A 4YYSA 1K3BB 1Q6KA 1ITOA 3PW3A 4QRXA 2DCAA 1SP4B 5JH3A 4WA6A 2AU1A 4PP1A 4Q8HA 3S3QA 1MDWA 2DC6A 3E1ZB 3GCBA 1AECA 4AXMA 3KFQA 4C5PA 3PDFA 1CS8A 2P0RA 4BS5A 2AUZA 3KX1A 3N3GA 4XUIA 4CDEB 4Q8GA 1YT7A 3MHHA 2B1MA 5K16A 1MS6A 3H8BA 1FH0A 2R9FA 3CBJA 1CVZA 3BPFA 1W6FA 1NL6A 4FJCA 1PPOA 5A24A 1YVBA 4FIPA 1PXVA 4P6GA 3NHEA 1F2CA 4W5BA 1ZCMA 2E03A 4ZUXU 1BY8A 2XU4A 1CSBB 2FT2A 3H7DA 3MHSA 1S4VA 3C9EA 1QMYA 1CTEA 1MEGA 1AIMA 2XU5A 3BCNA 2FQ9A 3WXFA 3IOQA 1U9XA 1Y08A 2G6DA 5EF4A 1KFUL 8PCHA 3V6CA 2PADA 2R9OA 3PBHA 4P6EA 2YJBA 2HD5A 1KHQA 4N4ZA 4AXLA 4OELA 2YJCA 1HUCB 1PPPA 4MZSA 3RVVA 2R6NA 1KXRA 3KWZA 3OVXA 4I04A 1AU0A 3RVWA 2ATOA 1F29A 1ME3A 5CVOB 3KSEA 5F02A 1PE6A 2BSZA 4QRGA 2O6XA 2Y6EA 4XR7A 3BOWA 1Y4HA 5JA7A 4CDCB 1F2BA 3WXEA 3OVZA 3ZUAA 3IMAA 1TLOA 2XU3A 2F7DA 1NB5A 5CHTA 4YVAA 2NQGA 4PP2E 7PCKA 1EWOA 4PI3A 1U9WA 1EWPA 1VSNA 5CHVA 4MZOA 1THEA 1QOLA 2YJ9A 4N79A 4HWYA 3S3RA 3K24A 2HH5A 2R9CA 2XU1A 4I05A 3MTNA 3HHAA 4I07A 3KW9A 1SNKA 3HHIA 4YYQA 3HD3A 2AYNA 4CZWA 4OEMA 2VFCA 3H6SA 2YJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9N A;  1GLO A;  2JQF R;  1TL9 A;  3N4C A;  2VHF A;  2PNS A;  1STF E;  3I3T A;  3BWK A;  1EF7 A;  3OIS A;  2AS8 A;  2E00 A;  2ACT A;  2F1G A;  2P86 A;  1MHW A;  4KLB A;  2BDZ A;  1BP4 A;  1AYW A;  3QSD A;  2DJF B;  1NB3 A;  3QJ3 A;  5PAD A;  4MSX A;  4YYW A;  1M6D A;  2ARY A;  1KFX L;  2CIO A;  3O1G A;  4YYR A;  2DCD A;  3H89 A;  4X6J A;  3IEJ A;  1A6R A;  4W5C A;  6PAD A;  3CH2 X;  1GCB A;  2IPP B;  5CVM A;  3I06 A;  4CDF B;  3QT4 A;  2OZ2 A;  3F5V A;  3PNR A;  2NQI A;  4RY2 A;  1CPJ A;  2E02 A;  1JQP A;  2DC7 A;  9PAP A;  1PBH A;  1NPZ A;  5EGW A;  2FRQ A;  1U9V A;  3H8C A;  1CQD A;  3F75 A;  2PBH A;  2G7Y A;  1POP A;  2DZY A;  2G8J A;  2VHS A;  1CJL A;  5CVN B;  1PPD A;  4QRV A;  1ME4 A;  3BPM A;  3V6E A;  1O0E A;  2B1N A;  1PPN A;  3M99 A;  2AIM A;  3IUT A;  3D6S A;  4DMX A;  3KKU A;  1EWL A;  1NLJ A;  2OUL A;  2YJ8 A;  1VJV A;  4BS6 A;  1NQC A;  3MOR A;  4G54 A;  1AYU A;  2NQA A;  1CB5 A;  4DMY A;  3BC3 A;  3USV A;  2DJG B;  4PAD A;  4X6H A;  3RVX A;  4K7C A;  3LFY A;  2NQD B;  2R9M A;  1ICF A;  1QXP A;  3KWB X;  1QDQ A;  2IBI A;  2FUD A;  3OF9 A;  1PCI A;  4YYV A;  2FTD A;  4FK5 A;  2CB5 A;  1BGO A;  2DC9 A;  4QH6 A;  3WXG A;  1U5I A;  1DF0 A;  3DF0 A;  2FYE A;  2FRA A;  2JQG R;  1BQI A;  1PAD A;  2GFO A;  2C0Y A;  1MIR A;  2Y5B A;  2HXZ A;  1IWD A;  1GEC E;  2AVW A;  3OF8 A;  1EWM A;  1KHP A;  2DC8 A;  1DEU A;  1ATK A;  4BSQ A;  3B79 A;  3TNX A;  3O0U A;  3U8E A;  1U9Q X;  1YAL A;  3IHP A;  2AUX A;  2PRE A;  3ERV A;  3AI8 A;  1TU6 A;  2DZZ A;  1F2A A;  2BDL A;  3LXS A;  3IV2 A;  4YYU A;  1AU4 A;  3CH3 X;  2P7U A;  1YK8 A;  4X6I A;  4N8W A;  4QBB A;  4W4U A;  1CV8 A;  1GMY A;  5FPW A;  4CDD B;  2DCB A;  2WBF X;  3N3K A;  3K8U A;  3P5X A;  1YK7 A;  5J94 A;  1AYV A;  2FO5 A;  2E01 A;  1ZIV A;  2GHU A;  1AU3 A;  3P5V A;  4YV8 A;  3K9M A;  3P5W A;  2G8E A;  2H7J A;  3CBK A;  2DCC A;  2HHN A;  1XKG A;  2AYO A;  1X9Y A;  4BPV A;  3HWN A;  1MEM A;  3P5U A;  2OP3 A;  4BQV A;  1PIP A;  1AU2 A;  4YYS A;  1K3B B;  1Q6K A;  4QRX A;  1ITO A;  3PW3 A;  2DCA A;  1SP4 B;  5JH3 A;  4WA6 A;  2AU1 A;  4PP1 A;  4Q8H A;  3S3Q A;  1MDW A;  2DC6 A;  3E1Z B;  3GCB A;  1AEC A;  4AXM A;  3KFQ A;  3PDF A;  1CS8 A;  2P0R A;  4BS5 A;  2AUZ A;  3KX1 A;  3N3G A;  4XUI A;  4CDE B;  4Q8G A;  1YT7 A;  3MHH A;  2B1M A;  5K16 A;  1MS6 A;  3H8B A;  1FH0 A;  2R9F A;  3CBJ A;  1CVZ A;  3BPF A;  1NL6 A;  4FJC A;  1PPO A;  5A24 A;  1YVB A;  4FIP A;  1PXV A;  4P6G A;  3NHE A;  1F2C A;  4W5B A;  1ZCM A;  2E03 A;  4ZUX U;  1BY8 A;  2XU4 A;  1CSB B;  2FT2 A;  3H7D A;  3MHS A;  1S4V A;  3C9E A;  1QMY A;  1CTE A;  1MEG A;  1AIM A;  2XU5 A;  3BCN A;  2FQ9 A;  3WXF A;  3IOQ A;  1U9X A;  1Y08 A;  2G6D A;  5EF4 A;  1KFU L;  8PCH A;  3V6C A;  2PAD A;  2R9O A;  3PBH A;  4P6E A;  2YJB A;  2HD5 A;  1KHQ A;  4N4Z A;  4AXL A;  4OEL A;  2YJC A;  1HUC B;  1PPP A;  4MZS A;  3RVV A;  2R6N A;  1KXR A;  3KWZ A;  3OVX A;  4I04 A;  1AU0 A;  3RVW A;  2ATO A;  1F29 A;  1ME3 A;  5CVO B;  3KSE A;  5F02 A;  1PE6 A;  4QRG A;  2O6X A;  2Y6E A;  4XR7 A;  3BOW A;  1Y4H A;  5JA7 A;  4CDC B;  1F2B A;  3WXE A;  3OVZ A;  3ZUA A;  3IMA A;  1TLO A;  2XU3 A;  2F7D A;  1NB5 A;  5CHT A;  4YVA A;  2NQG A;  4PP2 E;  7PCK A;  1EWO A;  4PI3 A;  1U9W A;  1EWP A;  1VSN A;  5CHV A;  4MZO A;  1THE A;  1QOL A;  2YJ9 A;  4N79 A;  4HWY A;  3S3R A;  2R9C A;  2HH5 A;  3K24 A;  2XU1 A;  4I05 A;  3MTN A;  3HHA A;  4I07 A;  3KW9 A;  1SNK A;  3HHI A;  4YYQ A;  3HD3 A;  2AYN A;  4CZW A;  4OEM A;  3H6S A;  2YJ2 A; 
#chains in the Genus database with same CATH topology
 2R9N A;  1GLO A;  2JQF R;  1TL9 A;  3N4C A;  2VHF A;  2PNS A;  1STF E;  2BU3 A;  1DKI A;  3I3T A;  3BWK A;  1EF7 A;  3OIS A;  2AS8 A;  2E00 A;  2ACT A;  2F1G A;  2P86 A;  1MHW A;  4KLB A;  2BTW A;  2BDZ A;  1BP4 A;  1AYW A;  2J7Q C;  3QSD A;  2DJF B;  1NB3 A;  3QJ3 A;  5PAD A;  3B21 A;  4MSX A;  4YYW A;  1M6D A;  2ARY A;  1KFX L;  2CIO A;  3O1G A;  4YYR A;  2DCD A;  3H89 A;  4X6J A;  3IEJ A;  1A6R A;  2FE8 A;  4W5C A;  6PAD A;  3CH2 X;  5KO3 A;  4OVZ B;  1GCB A;  2IPP B;  5CVM A;  4MI7 A;  3I06 A;  3PHU A;  4CDF B;  3QT4 A;  2OZ2 A;  3C0R A;  2JRI A;  3PRM A;  3F5V A;  3PNR A;  4A5U A;  2NQI A;  4RY2 A;  1CPJ A;  2E02 A;  1JQP A;  2DC7 A;  9PAP A;  1PBH A;  1NPZ A;  4BOQ A;  5EGW A;  2FRQ A;  1U9V A;  3H8C A;  4RKX A;  1CQD A;  3F75 A;  2PBH A;  2G7Y A;  1POP A;  2DZY A;  2G8J A;  2VHS A;  1CJL A;  1YZB A;  5CVN B;  1PPD A;  4QRV A;  1ME4 A;  3BPM A;  3V6E A;  1O0E A;  4OW0 A;  2B1N A;  1PPN A;  3M99 A;  2AIM A;  3IUT A;  3D6S A;  4DMX A;  4D8B A;  3KKU A;  1EWL A;  1NLJ A;  2OUL A;  2YJ8 A;  1VJV A;  4BS6 A;  1UKF A;  1NQC A;  2J7Q A;  3MOR A;  4G54 A;  1AYU A;  2NQA A;  1CB5 A;  4DMY A;  3BC3 A;  3USV A;  5EZS A;  2DJG B;  4PAD A;  4X6H A;  3RVX A;  4K7C A;  3LFY A;  2NQD B;  3PT2 A;  2R9M A;  1ICF A;  4BOU A;  1QXP A;  3KWB X;  1QDQ A;  2IBI A;  2FUD A;  3OF9 A;  1PCI A;  4YYV A;  2FTD A;  4FK5 A;  2CB5 A;  1BGO A;  3MTV A;  2DC9 A;  4QH6 A;  3WXG A;  1U5I A;  1DF0 A;  3DF0 A;  2FYE A;  2FRA A;  2JQG R;  1BQI A;  1PAD A;  4RNA A;  2GFO A;  2C0Y A;  1MIR A;  2Y5B A;  2HXZ A;  4GUA A;  1IWD A;  1GEC E;  2AVW A;  3OF8 A;  3W31 A;  3OQC A;  1EWM A;  1KHP A;  2DC8 A;  1DEU A;  1ATK A;  3PHW A;  4BSQ A;  3B79 A;  3MP2 A;  3TNX A;  3O0U A;  3U8E A;  1U9Q X;  1YAL A;  3IHP A;  2AUX A;  2PRE A;  3ERV A;  4R3D A;  4D8E A;  3AI8 A;  1TU6 A;  2DZZ A;  1F2A A;  3BBA A;  2BDL A;  5E6J A;  4M0W A;  3LXS A;  3IV2 A;  4RF1 A;  4YYU A;  1AU4 A;  3CH3 X;  2P7U A;  1YK8 A;  4X6I A;  4N8W A;  4QBB A;  4W4U A;  1CV8 A;  2JTC A;  1GMY A;  5FPW A;  2HWK A;  4CDD B;  2DCB A;  3BB7 A;  2WBF X;  3N3K A;  3K8U A;  3P5X A;  1YK7 A;  5J94 A;  1AYV A;  2FO5 A;  2E01 A;  1ZIV A;  4MM3 B;  2GHU A;  1AU3 A;  3P5V A;  4YV8 A;  4XZX A;  3K9M A;  3P5W A;  2G8E A;  2H7J A;  3CBK A;  2DCC A;  2HHN A;  1PVJ A;  1XKG A;  2AYO A;  1X9Y A;  4BPV A;  4IUM A;  3HWN A;  3MJ5 A;  1MEM A;  3P5U A;  2OP3 A;  4BQV A;  4BOP A;  1PIP A;  1AU2 A;  4YYS A;  1K3B B;  1Q6K A;  1ITO A;  3PW3 A;  4QRX A;  2DCA A;  3E9S A;  3TMP A;  1SP4 B;  5JH3 A;  4WA6 A;  2AU1 A;  4PP1 A;  4Q8H A;  3S3Q A;  1MDW A;  2DC6 A;  4BOS A;  3W30 A;  3E1Z B;  3GCB A;  1AEC A;  4AXM A;  3KFQ A;  3PDF A;  3PRP A;  1CS8 A;  4OVZ A;  2P0R A;  4BS5 A;  2AUZ A;  3KX1 A;  3N3G A;  2Z84 A;  4XUI A;  4CDE B;  4Q8G A;  1YT7 A;  3MHH A;  2B1M A;  5K16 A;  4BOZ A;  1MS6 A;  3H8B A;  1FH0 A;  2R9F A;  2AGA A;  3CBJ A;  1CVZ A;  4D8I A;  3BPF A;  1NL6 A;  4FJC A;  1PPO A;  5EZQ A;  5A24 A;  4ZTB A;  1YVB A;  3PHX A;  4FIP A;  1PXV A;  3RNV A;  4P6G A;  3NHE A;  1F2C A;  4W5B A;  1ZCM A;  2E03 A;  4ZUX U;  4PT5 A;  1BY8 A;  2XU4 A;  1CSB B;  2FT2 A;  3H7D A;  3MHS A;  1S4V A;  3C9E A;  1QMY A;  1CTE A;  1MEG A;  1AIM A;  2XU5 A;  3BCN A;  2FQ9 A;  4REZ A;  3WXF A;  3IOQ A;  1U9X A;  1Y08 A;  2G6D A;  5EF4 A;  1KFU L;  4WUR A;  8PCH A;  3V6C A;  2PAD A;  2R9O A;  3PBH A;  4P6E A;  2YJB A;  2HD5 A;  1KHQ A;  4N4Z A;  4AXL A;  4OEL A;  3ZNH A;  2YJC A;  1HUC B;  1PPP A;  4MZS A;  4HXD B;  3RVV A;  2R6N A;  1KXR A;  3KWZ A;  3OVX A;  4I04 A;  4IP3 A;  1AU0 A;  3PSE A;  3RVW A;  2ATO A;  2BTW B;  1F29 A;  1ME3 A;  5CVO B;  3KSE A;  2DOS A;  5F02 A;  1PE6 A;  4QRG A;  2O6X A;  2Y6E A;  4XR7 A;  3BOW A;  1Y4H A;  5JA7 A;  4CDC B;  1F2B A;  4RF0 A;  3WXE A;  2UZJ A;  3OVZ A;  3ZUA A;  3IMA A;  1TLO A;  2XU3 A;  2F7D A;  1NB5 A;  5CHT A;  4YVA A;  5JZE A;  2NQG A;  4PP2 E;  7PCK A;  1EWO A;  3IFU A;  4PI3 A;  1U9W A;  1EWP A;  1VSN A;  5CHV A;  4MZO A;  1THE A;  1QOL A;  2YJ9 A;  3BY4 A;  4N79 A;  4HWY A;  3O65 A;  3S3R A;  2R9C A;  2HH5 A;  3K24 A;  2XU1 A;  4I05 A;  3TRK A;  3MTN A;  3HHA A;  4I07 A;  4P16 A;  3KW9 A;  1SNK A;  3HHI A;  4YYQ A;  3HD3 A;  2AYN A;  4CZW A;  4OEM A;  3H6S A;  2YJ2 A; 
#chains in the Genus database with same CATH homology
 2R9N A;  1GLO A;  2JQF R;  1TL9 A;  3N4C A;  2VHF A;  2PNS A;  1STF E;  3I3T A;  3BWK A;  1EF7 A;  3OIS A;  2AS8 A;  2E00 A;  2ACT A;  2F1G A;  1W4T A;  2P86 A;  1MHW A;  4KLB A;  2BDZ A;  1BP4 A;  1AYW A;  4GUZ A;  3QSD A;  2DJF B;  1NB3 A;  3QJ3 A;  5PAD A;  4MSX A;  4YYW A;  1M6D A;  2ARY A;  1KFX L;  2CIO A;  3O1G A;  4YYR A;  2DCD A;  3H89 A;  4X6J A;  3IEJ A;  1A6R A;  4W5C A;  6PAD A;  3CH2 X;  1GCB A;  2IPP B;  5CVM A;  3I06 A;  4CDF B;  3QT4 A;  2OZ2 A;  3F5V A;  3PNR A;  2NQI A;  4RY2 A;  1CPJ A;  2E02 A;  1JQP A;  2DC7 A;  9PAP A;  1PBH A;  1NPZ A;  5EGW A;  2FRQ A;  1U9V A;  3H8C A;  1CQD A;  3F75 A;  2PBH A;  2G7Y A;  1POP A;  2DZY A;  4B55 A;  2G8J A;  2VHS A;  1CJL A;  5CVN B;  1PPD A;  4QRV A;  1ME4 A;  3BPM A;  3V6E A;  1O0E A;  3D9W A;  1W5R A;  2B1N A;  1PPN A;  3M99 A;  2AIM A;  3IUT A;  3D6S A;  4DMX A;  3KKU A;  1EWL A;  1GX3 A;  1NLJ A;  2OUL A;  2YJ8 A;  1VJV A;  4BS6 A;  1NQC A;  3MOR A;  4G54 A;  1AYU A;  2NQA A;  1CB5 A;  4DMY A;  3BC3 A;  3USV A;  2DJG B;  4PAD A;  4X6H A;  3RVX A;  4K7C A;  3LFY A;  2NQD B;  2R9M A;  1ICF A;  1QXP A;  3KWB X;  1QDQ A;  2IBI A;  2FUD A;  3OF9 A;  1PCI A;  4YYV A;  2FTD A;  4FK5 A;  2CB5 A;  1BGO A;  2DC9 A;  4QH6 A;  3WXG A;  1U5I A;  1DF0 A;  3DF0 A;  2FYE A;  2FRA A;  2JQG R;  1BQI A;  1PAD A;  2GFO A;  2C0Y A;  1MIR A;  2Y5B A;  2HXZ A;  1IWD A;  1GEC E;  2AVW A;  3OF8 A;  1EWM A;  1KHP A;  2DC8 A;  1DEU A;  1ATK A;  4BSQ A;  3B79 A;  3TNX A;  3O0U A;  3U8E A;  1U9Q X;  1YAL A;  3IHP A;  2AUX A;  2PRE A;  3ERV A;  3AI8 A;  1TU6 A;  2DZZ A;  1F2A A;  2BDL A;  3LXS A;  3IV2 A;  4YYU A;  3LTW A;  4BGF A;  4NV7 A;  1AU4 A;  3CH3 X;  2P7U A;  1YK8 A;  4X6I A;  4N8W A;  4QBB A;  4W4U A;  1CV8 A;  1GMY A;  5FPW A;  4CDD B;  2DCB A;  2WBF X;  3N3K A;  3K8U A;  3P5X A;  1YK7 A;  5J94 A;  1AYV A;  2FO5 A;  1E2T A;  2E01 A;  1ZIV A;  2GHU A;  1AU3 A;  3P5V A;  4YV8 A;  3K9M A;  3P5W A;  2G8E A;  2H7J A;  3CBK A;  2DCC A;  2HHN A;  2VFB A;  1XKG A;  2AYO A;  1X9Y A;  4BPV A;  3HWN A;  1MEM A;  4NV8 A;  3P5U A;  2OP3 A;  4BQV A;  1PIP A;  1AU2 A;  4YYS A;  1K3B B;  1Q6K A;  1ITO A;  3PW3 A;  4QRX A;  2DCA A;  1SP4 B;  5JH3 A;  4WA6 A;  2AU1 A;  4PP1 A;  4Q8H A;  3S3Q A;  1MDW A;  2DC6 A;  3E1Z B;  3GCB A;  1AEC A;  4AXM A;  3KFQ A;  4C5P A;  3PDF A;  1CS8 A;  2P0R A;  4BS5 A;  2AUZ A;  3KX1 A;  3N3G A;  4XUI A;  4CDE B;  4Q8G A;  1YT7 A;  3MHH A;  2B1M A;  5K16 A;  1MS6 A;  3H8B A;  1FH0 A;  2R9F A;  3CBJ A;  1CVZ A;  3BPF A;  1W6F A;  1NL6 A;  4FJC A;  1PPO A;  5A24 A;  1YVB A;  4FIP A;  1PXV A;  4P6G A;  3NHE A;  1F2C A;  4W5B A;  1ZCM A;  2E03 A;  4ZUX U;  1BY8 A;  2XU4 A;  1CSB B;  2FT2 A;  3H7D A;  3MHS A;  1S4V A;  3C9E A;  1QMY A;  1CTE A;  1MEG A;  1AIM A;  2XU5 A;  3BCN A;  2FQ9 A;  3WXF A;  3IOQ A;  1U9X A;  1Y08 A;  2G6D A;  5EF4 A;  1KFU L;  8PCH A;  3V6C A;  2PAD A;  2R9O A;  3PBH A;  4P6E A;  2YJB A;  2HD5 A;  1KHQ A;  4N4Z A;  4AXL A;  4OEL A;  2YJC A;  1HUC B;  1PPP A;  4MZS A;  3RVV A;  2R6N A;  1KXR A;  3KWZ A;  3OVX A;  4I04 A;  1AU0 A;  3RVW A;  2ATO A;  1F29 A;  1ME3 A;  5CVO B;  3KSE A;  5F02 A;  1PE6 A;  2BSZ A;  4QRG A;  2O6X A;  2Y6E A;  4XR7 A;  3BOW A;  1Y4H A;  5JA7 A;  4CDC B;  1F2B A;  3WXE A;  3OVZ A;  3ZUA A;  3IMA A;  1TLO A;  2XU3 A;  2F7D A;  1NB5 A;  5CHT A;  4YVA A;  2NQG A;  4PP2 E;  7PCK A;  1EWO A;  4PI3 A;  1U9W A;  1EWP A;  1VSN A;  5CHV A;  4MZO A;  1THE A;  1QOL A;  2YJ9 A;  4N79 A;  4HWY A;  3S3R A;  3K24 A;  2HH5 A;  2R9C A;  2XU1 A;  4I05 A;  3MTN A;  3HHA A;  4I07 A;  3KW9 A;  1SNK A;  3HHI A;  4YYQ A;  3HD3 A;  2AYN A;  4CZW A;  4OEM A;  2VFC A;  3H6S A;  2YJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...