1PXVA

The staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
183
Chain Sequence
b'GHHHHHHEFDQVQYENTLKNFKIREQQFDNSWAAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cysteine protease
publication title The Staphostatin-Staphopain Complex: A FORWARD BINDING INHIBITOR IN COMPLEX WITH ITS TARGET CYSTEINE PROTEASE.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 53
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pxvA00
4QRXA 5CVNB 2YJ8A 3PNRA 2G8EA 1SP4B 4YYRA 5JA7A 2DCAA 3V6CA 2FQ9A 2DC7A 4QH6A 1CPJA 4QBBA 2DJFB 1EWPA 1KHQA 4MSXA 2R6NA 1KXRA 2PADA 4N4ZA 1AYWA 4OEMA 2AU1A 2C0YA 1GECE 1CB5A 4CZWA 2E00A 2G6DA 2R9NA 4AXMA 1ZIVA 2YJ9A 2JQFR 1U9VA 3WXGA 2GHUA 4N79A 2OULA 1EF7A 1ICFA 1NB3A 1VJVA 2XU3A 3KSEA 4X6IA 4BS5A 4AXLA 4I05A 5PADA 3K24A 4ZUXU 3MORA 2AYOA 2YJBA 1XKGA 5EF4A 1A6RA 3DF0A 9PAPA 3PW3A 2BDZA 1GLOA 3N3GA 2OP3A 3B79A 1BQIA 2E01A 2G7YA 1TLOA 3I06A 2NQDB 4PP2E 2ACTA 2DZZA 3CH2X 5CHTA 2O6XA 1PBHA 1PPNA 3I3TA 4Q8GA 3U8EA 4P6GA 2G8JA 3USVA 3CBKA 2DC9A 4K7CA 4YV8A 3GCBA 3PDFA 5JH3A 3KX1A 2F1GA 3CBJA 1MEGA 3RVWA 2XU5A 1O0EA 3OISA 7PCKA 2R9FA 5EGWA 3NHEA 1YVBA 4CDDB 4BPVA 1EWOA 3HHIA 3P5WA 4FJCA 4YYUA 1M6DA 2AS8A 2FRQA 3IUTA 1YK8A 2VHFA 4FIPA 4CDFB 2R9OA 2H7JA 3KKUA 3PBHA 4FK5A 4OELA 1EWLA 1K3BB 3HHAA 3H8BA 1PIPA 2NQAA 4MZSA 4CDEB 3D6SA 4KLBA 1NL6A 2DZYA 1U9QX 2R9MA 1PE6A 3CH3X 2Y5BA 1Q6KA 4PADA 2ATOA 3F5VA 4YYVA 2BDLA 3H89A 5CVMA 2YJCA 2AYNA 1TL9A 3C9EA 1S4VA 3WXEA 1ITOA 8PCHA 2HHNA 2FRAA 1MHWA 1YT7A 2DCDA 1HUCB 1KFXL 1NLJA 2XU4A 2FT2A 3BOWA 4BSQA 1Y08A 3M99A 4WA6A 1GCBA 5J94A 3MTNA 5CVOB 1ZCMA 3H8CA 2DJGB 4W5BA 1TU6A 3HD3A 5A24A 1AECA 2PBHA 3QSDA 1BP4A 3H7DA 2XU1A 1CQDA 2R9CA 2DCCA 3S3RA 3V6EA 1BY8A 2ARYA 1AU4A 2FUDA 1CVZA 1YK7A 4I04A 4DMXA 4Q8HA 3RVXA 2NQGA 1NPZA 1GMYA 1X9YA 3BC3A 1DEUA 3P5VA 1NQCA 3F75A 2NQIA 4YYQA 1CS8A 2AUXA 3K9MA 4QRGA 4QRVA 1CV8A 5F02A 1AYUA 2FO5A 2HD5A 3K8UA 2F7DA 4DMYA 1AU2A 2JQGR 1VSNA 1CJLA 1PPDA 1THEA 3BCNA 3QJ3A 4YVAA 4W5CA 2AVWA 3IV2A 4BS6A 2IPPB 1QMYA 1MDWA 4MZOA 1ME4A 4X6JA 2E03A 3IEJA 3OF8A 2B1MA 4YYWA 1PPPA 1AU3A 2WBFX 1ME3A 2P7UA 4P6EA 3P5XA 3KWZA 1PPOA 1BGOA 1F2AA 2CB5A 1U5IA 2DC6A 2PNSA 3N4CA 1CSBB 3KW9A 1PADA 1CTEA 2FYEA 3LFYA 5CHVA 1F2BA 2DCBA 3IOQA 1STFE 3O0UA 1U9WA 4X6HA 3TNXA 3ERVA 3KFQA 2GFOA 1NB5A 3E1ZB 4YYSA 2FTDA 2Y6EA 1SNKA 2CIOA 4CDCB 3WXFA 6PADA 3BPFA 1AU0A 3HWNA 1Y4HA 2P0RA 3ZUAA 3KWBX 3MHSA 2HXZA 4G54A 3OVZA 3P5UA 2AIMA 1PCIA 3RVVA 1EWMA 4N8WA 2OZ2A 1U9XA 1DF0A 4XUIA 1AYVA 2B1NA 3O1GA 4RY2A 1JQPA 2HH5A 2DC8A 1KFUL 1QXPA 1QOLA 1IWDA 2P86A 1F29A 2PREA 2AUZA 1MEMA 4PI3A 3N3KA 4BQVA 3QT4A 1POPA 3BWKA 4I07A 1ATKA 1F2CA 3S3QA 3LXSA 4W4UA 4PP1A 4XR7A 3OF9A 2IBIA 1MIRA 2E02A 3MHHA 1KHPA 1AIMA 3H6SA 3BPMA 3IHPA 1YALA 5FPWA 1QDQA 4HWYA 3OVXA 1FH0A 2YJ2A 3IMAA 1MS6A 5K16A 3AI8A 1PXVA 2VHSA
chains in the Genus database with same CATH superfamily
5E6JA 4QRXA 5CVNB 2YJ8A 3PNRA 2G8EA 1SP4B 4YYRA 5JA7A 4BOSA 2DCAA 3V6CA 2FQ9A 2DC7A 4QH6A 1CPJA 4QBBA 2DJFB 1EWPA 3PHXA 3B21A 1KHQA 4MSXA 4IUMA 2R6NA 1KXRA 2PADA 4N4ZA 1AYWA 4OEMA 2AU1A 2C0YA 1GECE 1CB5A 4CZWA 2BTWB 2E00A 2G6DA 2R9NA 4AXMA 1ZIVA 2YJ9A 2JQFR 1U9VA 3WXGA 2GHUA 4N79A 2OULA 1EF7A 4MM3B 1ICFA 1NB3A 1VJVA 2AGAA 2XU3A 3KSEA 4X6IA 4BS5A 4AXLA 3PT2A 4I05A 5PADA 3K24A 3PRPA 4ZUXU 2DOSA 3MORA 2AYOA 2YJBA 1XKGA 5EF4A 1A6RA 3DF0A 3OQCA 9PAPA 3PW3A 2BDZA 4RF1A 1GLOA 3N3GA 2OP3A 3B79A 2FE8A 1BQIA 2E01A 3PSEA 2G7YA 4OW0A 4D8BA 1TLOA 3I06A 2NQDB 4PP2E 3IFUA 2ACTA 2DZZA 3CH2X 3W30A 5CHTA 2O6XA 1PBHA 1PPNA 3I3TA 4Q8GA 3U8EA 4P6GA 2G8JA 2BU3A 3USVA 3CBKA 2DC9A 4K7CA 4YV8A 3GCBA 3PDFA 5JH3A 3KX1A 2F1GA 3CBJA 1MEGA 3RVWA 2XU5A 1O0EA 3OISA 4GUAA 3PRMA 7PCKA 2R9FA 5EGWA 3W31A 3NHEA 1YVBA 4CDDB 4BPVA 1EWOA 3HHIA 3P5WA 4FJCA 4YYUA 1M6DA 2AS8A 2FRQA 3IUTA 1YK8A 2VHFA 4FIPA 4CDFB 2R9OA 2H7JA 3KKUA 3PBHA 4ZTBA 4RNAA 4FK5A 4OELA 1EWLA 1K3BB 2BTWA 5EZSA 2JTCA 3HHAA 3H8BA 1PIPA 2NQAA 4MZSA 4CDEB 3D6SA 4KLBA 1NL6A 2DZYA 1U9QX 2R9MA 1PE6A 3CH3X 2Y5BA 1Q6KA 4PADA 2ATOA 3F5VA 4YYVA 2BDLA 3H89A 5CVMA 2UZJA 2YJCA 3PHUA 2HWKA 2AYNA 1TL9A 3C9EA 1S4VA 3WXEA 4OVZB 1ITOA 8PCHA 2HHNA 2FRAA 1MHWA 1YT7A 2DCDA 4D8EA 1HUCB 1KFXL 1NLJA 2XU4A 2FT2A 3BOWA 4BSQA 4BOQA 1Y08A 3M99A 4WA6A 1GCBA 3BY4A 5J94A 3MTNA 5CVOB 4A5UA 1ZCMA 3H8CA 2DJGB 4W5BA 1TU6A 3HD3A 5A24A 1AECA 5KO3A 1UKFA 2PBHA 3QSDA 1BP4A 3TRKA 3H7DA 2XU1A 1CQDA 2R9CA 2DCCA 4MI7A 3S3RA 3V6EA 1BY8A 4P16A 2ARYA 1AU4A 1YZBA 2FUDA 1CVZA 4RKXA 1YK7A 4I04A 4DMXA 4Q8HA 3RVXA 3BBAA 2NQGA 1NPZA 2JRIA 1GMYA 1X9YA 3BC3A 1DEUA 3P5VA 1NQCA 3C0RA 3F75A 2NQIA 4YYQA 1CS8A 2AUXA 3K9MA 4QRGA 4QRVA 2J7QC 1CV8A 5F02A 4BOZA 1AYUA 4BOPA 2FO5A 2HD5A 3MP2A 4IP3A 3K8UA 2F7DA 4DMYA 1AU2A 2JQGR 1VSNA 3PHWA 1CJLA 1PPDA 1THEA 3BCNA 1PVJA 4D8IA 3QJ3A 4YVAA 4REZA 4W5CA 2AVWA 4OVZA 4RF0A 3IV2A 4BS6A 2IPPB 1QMYA 1MDWA 4MZOA 1ME4A 4X6JA 2E03A 3IEJA 3OF8A 2B1MA 4YYWA 1PPPA 1AU3A 3TMPA 2WBFX 1ME3A 2P7UA 4P6EA 3P5XA 3MTVA 3KWZA 1PPOA 1BGOA 2PNSA 1F2AA 2CB5A 1U5IA 2DC6A 3N4CA 4PT5A 3O65A 4BOUA 1CSBB 4R3DA 3KW9A 1PADA 1CTEA 2FYEA 3LFYA 5CHVA 1F2BA 2DCBA 3IOQA 4HXDB 1STFE 3O0UA 1U9WA 4X6HA 3TNXA 3ERVA 3KFQA 2GFOA 1NB5A 3E1ZB 5JZEA 4YYSA 2FTDA 2Y6EA 4M0WA 1SNKA 2CIOA 4CDCB 3WXFA 6PADA 3BPFA 1AU0A 3BB7A 3RNVA 2J7QA 3HWNA 1Y4HA 2P0RA 3ZUAA 3KWBX 3MHSA 2HXZA 4G54A 1DKIA 3OVZA 3P5UA 2AIMA 1PCIA 3RVVA 1EWMA 4N8WA 2OZ2A 1U9XA 1DF0A 4XUIA 5EZQA 1AYVA 2B1NA 3O1GA 4RY2A 1JQPA 2HH5A 2DC8A 1KFUL 3MJ5A 1QXPA 1QOLA 1IWDA 2P86A 1F29A 2PREA 2AUZA 1MEMA 4PI3A 4XZXA 3N3KA 4BQVA 3QT4A 2Z84A 1POPA 3BWKA 4I07A 1ATKA 1F2CA 4WURA 3S3QA 3LXSA 4W4UA 3E9SA 4PP1A 4XR7A 3OF9A 2IBIA 3ZNHA 1MIRA 2E02A 3MHHA 1KHPA 1AIMA 3H6SA 3BPMA 3IHPA 1YALA 5FPWA 1QDQA 4HWYA 3OVXA 1FH0A 2YJ2A 3IMAA 1MS6A 5K16A 3AI8A 1PXVA 2VHSA
chains in the Genus database with same CATH topology
4QRXA 5CVNB 2YJ8A 3PNRA 2G8EA 1SP4B 2VFBA 4YYRA 5JA7A 2DCAA 3V6CA 2FQ9A 2DC7A 4QH6A 1CPJA 4QBBA 2DJFB 1EWPA 1KHQA 4MSXA 2R6NA 1KXRA 2PADA 4N4ZA 1AYWA 4NV7A 4OEMA 2AU1A 2C0YA 1GECE 1CB5A 4CZWA 2E00A 2G6DA 2R9NA 4AXMA 1GX3A 1ZIVA 2YJ9A 2JQFR 1U9VA 3WXGA 2GHUA 4N79A 2OULA 1EF7A 1ICFA 1NB3A 1VJVA 2XU3A 3KSEA 4X6IA 4BS5A 4AXLA 4I05A 5PADA 3K24A 4ZUXU 3MORA 2AYOA 2YJBA 1XKGA 5EF4A 1A6RA 3DF0A 4BGFA 9PAPA 3PW3A 2BDZA 1GLOA 3N3GA 4B55A 2VFCA 2OP3A 3B79A 1BQIA 2E01A 2G7YA 1TLOA 3I06A 2NQDB 4PP2E 2ACTA 2DZZA 3CH2X 5CHTA 2O6XA 1PBHA 1PPNA 3I3TA 4Q8GA 3U8EA 4P6GA 2G8JA 3USVA 3CBKA 2DC9A 4K7CA 4YV8A 3GCBA 3PDFA 5JH3A 3KX1A 2F1GA 3CBJA 1MEGA 3RVWA 2XU5A 1O0EA 3OISA 7PCKA 2R9FA 5EGWA 3NHEA 1YVBA 4CDDB 4BPVA 1EWOA 3HHIA 3P5WA 4FJCA 4YYUA 1W4TA 1M6DA 2AS8A 2FRQA 3IUTA 1YK8A 2VHFA 4FIPA 4CDFB 2R9OA 2H7JA 3KKUA 3PBHA 4FK5A 4OELA 1EWLA 1K3BB 3HHAA 3H8BA 1PIPA 2NQAA 4MZSA 4CDEB 3D6SA 4KLBA 1NL6A 2DZYA 1U9QX 2R9MA 1PE6A 3CH3X 2Y5BA 1Q6KA 4PADA 2ATOA 3F5VA 4YYVA 2BDLA 3H89A 5CVMA 2YJCA 2AYNA 3LTWA 1TL9A 3C9EA 1S4VA 3WXEA 1ITOA 8PCHA 2HHNA 2FRAA 1MHWA 1YT7A 2DCDA 3D9WA 1HUCB 1KFXL 1NLJA 2XU4A 2FT2A 3BOWA 4BSQA 1Y08A 3M99A 4WA6A 1GCBA 5J94A 3MTNA 5CVOB 1ZCMA 3H8CA 2DJGB 4W5BA 1TU6A 3HD3A 5A24A 1AECA 2PBHA 3QSDA 1BP4A 3H7DA 2XU1A 1CQDA 2R9CA 2DCCA 3S3RA 3V6EA 1BY8A 2ARYA 1AU4A 2FUDA 1CVZA 1YK7A 4I04A 4DMXA 4Q8HA 3RVXA 2NQGA 1NPZA 1GMYA 1X9YA 3BC3A 1DEUA 3P5VA 1NQCA 3F75A 2NQIA 4YYQA 1CS8A 2AUXA 3K9MA 4QRGA 4QRVA 1CV8A 5F02A 1AYUA 2FO5A 2HD5A 3K8UA 2F7DA 4DMYA 1AU2A 2JQGR 1VSNA 1CJLA 1PPDA 4NV8A 1THEA 3BCNA 3QJ3A 4YVAA 4W5CA 2AVWA 3IV2A 4BS6A 2IPPB 1QMYA 1MDWA 4MZOA 1ME4A 4X6JA 2E03A 3IEJA 3OF8A 2B1MA 4YYWA 1PPPA 1AU3A 2WBFX 1ME3A 2P7UA 4P6EA 3P5XA 3KWZA 1PPOA 1BGOA 1F2AA 2CB5A 1U5IA 2DC6A 2PNSA 3N4CA 1CSBB 3KW9A 4C5PA 1PADA 1CTEA 2FYEA 3LFYA 5CHVA 1F2BA 2DCBA 3IOQA 1STFE 4GUZA 3O0UA 1U9WA 4X6HA 3TNXA 3ERVA 3KFQA 2GFOA 1NB5A 3E1ZB 4YYSA 2FTDA 2Y6EA 1SNKA 2CIOA 4CDCB 3WXFA 6PADA 3BPFA 1AU0A 3HWNA 1Y4HA 2P0RA 3ZUAA 3KWBX 3MHSA 2HXZA 1W6FA 4G54A 3OVZA 3P5UA 2AIMA 1PCIA 3RVVA 1W5RA 1EWMA 4N8WA 2OZ2A 1U9XA 1DF0A 4XUIA 1AYVA 2B1NA 3O1GA 4RY2A 1JQPA 2HH5A 2DC8A 1KFUL 1QXPA 1QOLA 1IWDA 2P86A 1F29A 2PREA 2AUZA 1MEMA 4PI3A 3N3KA 4BQVA 3QT4A 1POPA 3BWKA 4I07A 1ATKA 1F2CA 1E2TA 3S3QA 3LXSA 4W4UA 4PP1A 4XR7A 3OF9A 2IBIA 1MIRA 2E02A 3MHHA 1KHPA 1AIMA 3H6SA 3BPMA 3IHPA 1YALA 5FPWA 1QDQA 4HWYA 3OVXA 1FH0A 2YJ2A 3IMAA 1MS6A 5K16A 3AI8A 1PXVA 2BSZA 2VHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRX A;  5CVN B;  2YJ8 A;  3PNR A;  2G8E A;  1SP4 B;  4YYR A;  5JA7 A;  2DCA A;  3V6C A;  2FQ9 A;  2DC7 A;  4QH6 A;  1CPJ A;  4QBB A;  2DJF B;  1EWP A;  1KHQ A;  4MSX A;  2R6N A;  1KXR A;  2PAD A;  4N4Z A;  1AYW A;  4OEM A;  2AU1 A;  2C0Y A;  1GEC E;  1CB5 A;  4CZW A;  2E00 A;  2G6D A;  2R9N A;  4AXM A;  1ZIV A;  2YJ9 A;  2JQF R;  1U9V A;  3WXG A;  2GHU A;  4N79 A;  2OUL A;  1EF7 A;  1ICF A;  1NB3 A;  1VJV A;  2XU3 A;  3KSE A;  4X6I A;  4BS5 A;  4AXL A;  4I05 A;  5PAD A;  3K24 A;  4ZUX U;  3MOR A;  2AYO A;  2YJB A;  1XKG A;  5EF4 A;  1A6R A;  3DF0 A;  9PAP A;  3PW3 A;  2BDZ A;  1GLO A;  3N3G A;  2OP3 A;  3B79 A;  1BQI A;  2E01 A;  2G7Y A;  1TLO A;  3I06 A;  2NQD B;  4PP2 E;  2ACT A;  2DZZ A;  3CH2 X;  5CHT A;  2O6X A;  1PBH A;  1PPN A;  3I3T A;  4Q8G A;  3U8E A;  4P6G A;  2G8J A;  3USV A;  3CBK A;  2DC9 A;  4K7C A;  4YV8 A;  3GCB A;  3PDF A;  5JH3 A;  3KX1 A;  2F1G A;  3CBJ A;  1MEG A;  3RVW A;  2XU5 A;  1O0E A;  3OIS A;  7PCK A;  2R9F A;  5EGW A;  3NHE A;  1YVB A;  4CDD B;  4BPV A;  1EWO A;  3HHI A;  3P5W A;  4FJC A;  4YYU A;  1M6D A;  2AS8 A;  2FRQ A;  3IUT A;  1YK8 A;  2VHF A;  4FIP A;  4CDF B;  2R9O A;  2H7J A;  3KKU A;  3PBH A;  4FK5 A;  4OEL A;  1EWL A;  1K3B B;  3HHA A;  3H8B A;  1PIP A;  2NQA A;  4MZS A;  4CDE B;  3D6S A;  4KLB A;  1NL6 A;  2DZY A;  1U9Q X;  2R9M A;  1PE6 A;  3CH3 X;  2Y5B A;  1Q6K A;  4PAD A;  2ATO A;  3F5V A;  4YYV A;  2BDL A;  3H89 A;  5CVM A;  2YJC A;  2AYN A;  1TL9 A;  3C9E A;  1S4V A;  3WXE A;  1ITO A;  8PCH A;  2HHN A;  2FRA A;  1MHW A;  1YT7 A;  2DCD A;  1HUC B;  1KFX L;  1NLJ A;  2XU4 A;  2FT2 A;  3BOW A;  4BSQ A;  1Y08 A;  3M99 A;  4WA6 A;  1GCB A;  5J94 A;  3MTN A;  5CVO B;  1ZCM A;  3H8C A;  2DJG B;  4W5B A;  1TU6 A;  3HD3 A;  5A24 A;  1AEC A;  2PBH A;  3QSD A;  1BP4 A;  3H7D A;  2XU1 A;  1CQD A;  2R9C A;  2DCC A;  3S3R A;  3V6E A;  1BY8 A;  2ARY A;  1AU4 A;  2FUD A;  1CVZ A;  1YK7 A;  4I04 A;  4DMX A;  4Q8H A;  3RVX A;  2NQG A;  1NPZ A;  1GMY A;  1X9Y A;  3BC3 A;  1DEU A;  3P5V A;  1NQC A;  3F75 A;  2NQI A;  4YYQ A;  1CS8 A;  2AUX A;  3K9M A;  4QRG A;  4QRV A;  1CV8 A;  5F02 A;  1AYU A;  2FO5 A;  2HD5 A;  3K8U A;  2F7D A;  4DMY A;  1AU2 A;  2JQG R;  1VSN A;  1CJL A;  1PPD A;  1THE A;  3BCN A;  3QJ3 A;  4YVA A;  4W5C A;  2AVW A;  3IV2 A;  4BS6 A;  2IPP B;  1QMY A;  1MDW A;  4MZO A;  1ME4 A;  4X6J A;  2E03 A;  3IEJ A;  3OF8 A;  2B1M A;  4YYW A;  1PPP A;  1AU3 A;  2WBF X;  1ME3 A;  2P7U A;  4P6E A;  3P5X A;  3KWZ A;  1PPO A;  1BGO A;  1F2A A;  2CB5 A;  1U5I A;  2DC6 A;  2PNS A;  3N4C A;  1CSB B;  3KW9 A;  1PAD A;  1CTE A;  2FYE A;  3LFY A;  5CHV A;  1F2B A;  2DCB A;  3IOQ A;  1STF E;  3O0U A;  1U9W A;  4X6H A;  3TNX A;  3ERV A;  3KFQ A;  2GFO A;  1NB5 A;  3E1Z B;  4YYS A;  2FTD A;  2Y6E A;  1SNK A;  2CIO A;  4CDC B;  3WXF A;  6PAD A;  3BPF A;  1AU0 A;  3HWN A;  1Y4H A;  2P0R A;  3ZUA A;  3KWB X;  3MHS A;  2HXZ A;  4G54 A;  3OVZ A;  3P5U A;  2AIM A;  1PCI A;  3RVV A;  1EWM A;  4N8W A;  2OZ2 A;  1U9X A;  1DF0 A;  4XUI A;  1AYV A;  2B1N A;  3O1G A;  4RY2 A;  1JQP A;  2HH5 A;  2DC8 A;  1KFU L;  1QXP A;  1QOL A;  1IWD A;  2P86 A;  1F29 A;  2PRE A;  2AUZ A;  1MEM A;  4PI3 A;  3N3K A;  4BQV A;  3QT4 A;  1POP A;  3BWK A;  4I07 A;  1ATK A;  1F2C A;  3S3Q A;  3LXS A;  4W4U A;  4PP1 A;  4XR7 A;  3OF9 A;  2IBI A;  1MIR A;  2E02 A;  3MHH A;  1KHP A;  1AIM A;  3H6S A;  3BPM A;  3IHP A;  1YAL A;  5FPW A;  1QDQ A;  4HWY A;  3OVX A;  1FH0 A;  2YJ2 A;  3IMA A;  1MS6 A;  5K16 A;  3AI8 A;  1PXV A;  2VHS A; 
#chains in the Genus database with same CATH topology
 5E6J A;  4QRX A;  5CVN B;  2YJ8 A;  3PNR A;  2G8E A;  1SP4 B;  4YYR A;  5JA7 A;  4BOS A;  2DCA A;  3V6C A;  2FQ9 A;  2DC7 A;  4QH6 A;  1CPJ A;  4QBB A;  2DJF B;  1EWP A;  3PHX A;  3B21 A;  1KHQ A;  4MSX A;  4IUM A;  2R6N A;  1KXR A;  2PAD A;  4N4Z A;  1AYW A;  4OEM A;  2AU1 A;  2C0Y A;  1GEC E;  1CB5 A;  4CZW A;  2BTW B;  2E00 A;  2G6D A;  2R9N A;  4AXM A;  1ZIV A;  2YJ9 A;  2JQF R;  1U9V A;  3WXG A;  2GHU A;  4N79 A;  2OUL A;  1EF7 A;  4MM3 B;  1ICF A;  1NB3 A;  1VJV A;  2AGA A;  2XU3 A;  3KSE A;  4X6I A;  4BS5 A;  4AXL A;  3PT2 A;  4I05 A;  5PAD A;  3K24 A;  3PRP A;  4ZUX U;  2DOS A;  3MOR A;  2AYO A;  2YJB A;  1XKG A;  5EF4 A;  1A6R A;  3DF0 A;  3OQC A;  9PAP A;  3PW3 A;  2BDZ A;  4RF1 A;  1GLO A;  3N3G A;  2OP3 A;  3B79 A;  2FE8 A;  1BQI A;  2E01 A;  3PSE A;  2G7Y A;  4OW0 A;  4D8B A;  1TLO A;  3I06 A;  2NQD B;  4PP2 E;  3IFU A;  2ACT A;  2DZZ A;  3CH2 X;  3W30 A;  5CHT A;  2O6X A;  1PBH A;  1PPN A;  3I3T A;  4Q8G A;  3U8E A;  4P6G A;  2G8J A;  2BU3 A;  3USV A;  3CBK A;  2DC9 A;  4K7C A;  4YV8 A;  3GCB A;  3PDF A;  5JH3 A;  3KX1 A;  2F1G A;  3CBJ A;  1MEG A;  3RVW A;  2XU5 A;  1O0E A;  3OIS A;  4GUA A;  3PRM A;  7PCK A;  2R9F A;  5EGW A;  3W31 A;  3NHE A;  1YVB A;  4CDD B;  4BPV A;  1EWO A;  3HHI A;  3P5W A;  4FJC A;  4YYU A;  1M6D A;  2AS8 A;  2FRQ A;  3IUT A;  1YK8 A;  2VHF A;  4FIP A;  4CDF B;  2R9O A;  2H7J A;  3KKU A;  3PBH A;  4ZTB A;  4RNA A;  4FK5 A;  4OEL A;  1EWL A;  1K3B B;  2BTW A;  5EZS A;  2JTC A;  3HHA A;  3H8B A;  1PIP A;  2NQA A;  4MZS A;  4CDE B;  3D6S A;  4KLB A;  1NL6 A;  2DZY A;  1U9Q X;  2R9M A;  1PE6 A;  3CH3 X;  2Y5B A;  1Q6K A;  4PAD A;  2ATO A;  3F5V A;  4YYV A;  2BDL A;  3H89 A;  5CVM A;  2UZJ A;  2YJC A;  3PHU A;  2HWK A;  2AYN A;  1TL9 A;  3C9E A;  1S4V A;  3WXE A;  4OVZ B;  1ITO A;  8PCH A;  2HHN A;  2FRA A;  1MHW A;  1YT7 A;  2DCD A;  4D8E A;  1HUC B;  1KFX L;  1NLJ A;  2XU4 A;  2FT2 A;  3BOW A;  4BSQ A;  4BOQ A;  1Y08 A;  3M99 A;  4WA6 A;  1GCB A;  3BY4 A;  5J94 A;  3MTN A;  5CVO B;  4A5U A;  1ZCM A;  3H8C A;  2DJG B;  4W5B A;  1TU6 A;  3HD3 A;  5A24 A;  1AEC A;  5KO3 A;  1UKF A;  2PBH A;  3QSD A;  1BP4 A;  3TRK A;  3H7D A;  2XU1 A;  1CQD A;  2R9C A;  2DCC A;  4MI7 A;  3S3R A;  3V6E A;  1BY8 A;  4P16 A;  2ARY A;  1AU4 A;  1YZB A;  2FUD A;  1CVZ A;  4RKX A;  1YK7 A;  4I04 A;  4DMX A;  4Q8H A;  3RVX A;  3BBA A;  2NQG A;  1NPZ A;  2JRI A;  1GMY A;  1X9Y A;  3BC3 A;  1DEU A;  3P5V A;  1NQC A;  3C0R A;  3F75 A;  2NQI A;  4YYQ A;  1CS8 A;  2AUX A;  3K9M A;  4QRG A;  4QRV A;  2J7Q C;  1CV8 A;  5F02 A;  4BOZ A;  1AYU A;  4BOP A;  2FO5 A;  2HD5 A;  3MP2 A;  4IP3 A;  3K8U A;  2F7D A;  4DMY A;  1AU2 A;  2JQG R;  1VSN A;  3PHW A;  1CJL A;  1PPD A;  1THE A;  3BCN A;  1PVJ A;  4D8I A;  3QJ3 A;  4YVA A;  4REZ A;  4W5C A;  2AVW A;  4OVZ A;  4RF0 A;  3IV2 A;  4BS6 A;  2IPP B;  1QMY A;  1MDW A;  4MZO A;  1ME4 A;  4X6J A;  2E03 A;  3IEJ A;  3OF8 A;  2B1M A;  4YYW A;  1PPP A;  1AU3 A;  3TMP A;  2WBF X;  1ME3 A;  2P7U A;  4P6E A;  3P5X A;  3MTV A;  3KWZ A;  1PPO A;  1BGO A;  2PNS A;  1F2A A;  2CB5 A;  1U5I A;  2DC6 A;  3N4C A;  4PT5 A;  3O65 A;  4BOU A;  1CSB B;  4R3D A;  3KW9 A;  1PAD A;  1CTE A;  2FYE A;  3LFY A;  5CHV A;  1F2B A;  2DCB A;  3IOQ A;  4HXD B;  1STF E;  3O0U A;  1U9W A;  4X6H A;  3TNX A;  3ERV A;  3KFQ A;  2GFO A;  1NB5 A;  3E1Z B;  5JZE A;  4YYS A;  2FTD A;  2Y6E A;  4M0W A;  1SNK A;  2CIO A;  4CDC B;  3WXF A;  6PAD A;  3BPF A;  1AU0 A;  3BB7 A;  3RNV A;  2J7Q A;  3HWN A;  1Y4H A;  2P0R A;  3ZUA A;  3KWB X;  3MHS A;  2HXZ A;  4G54 A;  1DKI A;  3OVZ A;  3P5U A;  2AIM A;  1PCI A;  3RVV A;  1EWM A;  4N8W A;  2OZ2 A;  1U9X A;  1DF0 A;  4XUI A;  5EZQ A;  1AYV A;  2B1N A;  3O1G A;  4RY2 A;  1JQP A;  2HH5 A;  2DC8 A;  1KFU L;  3MJ5 A;  1QXP A;  1QOL A;  1IWD A;  2P86 A;  1F29 A;  2PRE A;  2AUZ A;  1MEM A;  4PI3 A;  4XZX A;  3N3K A;  4BQV A;  3QT4 A;  2Z84 A;  1POP A;  3BWK A;  4I07 A;  1ATK A;  1F2C A;  4WUR A;  3S3Q A;  3LXS A;  4W4U A;  3E9S A;  4PP1 A;  4XR7 A;  3OF9 A;  2IBI A;  3ZNH A;  1MIR A;  2E02 A;  3MHH A;  1KHP A;  1AIM A;  3H6S A;  3BPM A;  3IHP A;  1YAL A;  5FPW A;  1QDQ A;  4HWY A;  3OVX A;  1FH0 A;  2YJ2 A;  3IMA A;  1MS6 A;  5K16 A;  3AI8 A;  1PXV A;  2VHS A; 
#chains in the Genus database with same CATH homology
 4QRX A;  5CVN B;  2YJ8 A;  3PNR A;  2G8E A;  1SP4 B;  2VFB A;  4YYR A;  5JA7 A;  2DCA A;  3V6C A;  2FQ9 A;  2DC7 A;  4QH6 A;  1CPJ A;  4QBB A;  2DJF B;  1EWP A;  1KHQ A;  4MSX A;  2R6N A;  1KXR A;  2PAD A;  4N4Z A;  1AYW A;  4NV7 A;  4OEM A;  2AU1 A;  2C0Y A;  1GEC E;  1CB5 A;  4CZW A;  2E00 A;  2G6D A;  2R9N A;  4AXM A;  1GX3 A;  1ZIV A;  2YJ9 A;  2JQF R;  1U9V A;  3WXG A;  2GHU A;  4N79 A;  2OUL A;  1EF7 A;  1ICF A;  1NB3 A;  1VJV A;  2XU3 A;  3KSE A;  4X6I A;  4BS5 A;  4AXL A;  4I05 A;  5PAD A;  3K24 A;  4ZUX U;  3MOR A;  2AYO A;  2YJB A;  1XKG A;  5EF4 A;  1A6R A;  3DF0 A;  4BGF A;  9PAP A;  3PW3 A;  2BDZ A;  1GLO A;  3N3G A;  4B55 A;  2VFC A;  2OP3 A;  3B79 A;  1BQI A;  2E01 A;  2G7Y A;  1TLO A;  3I06 A;  2NQD B;  4PP2 E;  2ACT A;  2DZZ A;  3CH2 X;  5CHT A;  2O6X A;  1PBH A;  1PPN A;  3I3T A;  4Q8G A;  3U8E A;  4P6G A;  2G8J A;  3USV A;  3CBK A;  2DC9 A;  4K7C A;  4YV8 A;  3GCB A;  3PDF A;  5JH3 A;  3KX1 A;  2F1G A;  3CBJ A;  1MEG A;  3RVW A;  2XU5 A;  1O0E A;  3OIS A;  7PCK A;  2R9F A;  5EGW A;  3NHE A;  1YVB A;  4CDD B;  4BPV A;  1EWO A;  3HHI A;  3P5W A;  4FJC A;  4YYU A;  1W4T A;  1M6D A;  2AS8 A;  2FRQ A;  3IUT A;  1YK8 A;  2VHF A;  4FIP A;  4CDF B;  2R9O A;  2H7J A;  3KKU A;  3PBH A;  4FK5 A;  4OEL A;  1EWL A;  1K3B B;  3HHA A;  3H8B A;  1PIP A;  2NQA A;  4MZS A;  4CDE B;  3D6S A;  4KLB A;  1NL6 A;  2DZY A;  1U9Q X;  2R9M A;  1PE6 A;  3CH3 X;  2Y5B A;  1Q6K A;  4PAD A;  2ATO A;  3F5V A;  4YYV A;  2BDL A;  3H89 A;  5CVM A;  2YJC A;  2AYN A;  3LTW A;  1TL9 A;  3C9E A;  1S4V A;  3WXE A;  1ITO A;  8PCH A;  2HHN A;  2FRA A;  1MHW A;  1YT7 A;  2DCD A;  3D9W A;  1HUC B;  1KFX L;  1NLJ A;  2XU4 A;  2FT2 A;  3BOW A;  4BSQ A;  1Y08 A;  3M99 A;  4WA6 A;  1GCB A;  5J94 A;  3MTN A;  5CVO B;  1ZCM A;  3H8C A;  2DJG B;  4W5B A;  1TU6 A;  3HD3 A;  5A24 A;  1AEC A;  2PBH A;  3QSD A;  1BP4 A;  3H7D A;  2XU1 A;  1CQD A;  2R9C A;  2DCC A;  3S3R A;  3V6E A;  1BY8 A;  2ARY A;  1AU4 A;  2FUD A;  1CVZ A;  1YK7 A;  4I04 A;  4DMX A;  4Q8H A;  3RVX A;  2NQG A;  1NPZ A;  1GMY A;  1X9Y A;  3BC3 A;  1DEU A;  3P5V A;  1NQC A;  3F75 A;  2NQI A;  4YYQ A;  1CS8 A;  2AUX A;  3K9M A;  4QRG A;  4QRV A;  1CV8 A;  5F02 A;  1AYU A;  2FO5 A;  2HD5 A;  3K8U A;  2F7D A;  4DMY A;  1AU2 A;  2JQG R;  1VSN A;  1CJL A;  1PPD A;  4NV8 A;  1THE A;  3BCN A;  3QJ3 A;  4YVA A;  4W5C A;  2AVW A;  3IV2 A;  4BS6 A;  2IPP B;  1QMY A;  1MDW A;  4MZO A;  1ME4 A;  4X6J A;  2E03 A;  3IEJ A;  3OF8 A;  2B1M A;  4YYW A;  1PPP A;  1AU3 A;  2WBF X;  1ME3 A;  2P7U A;  4P6E A;  3P5X A;  3KWZ A;  1PPO A;  1BGO A;  1F2A A;  2CB5 A;  1U5I A;  2DC6 A;  2PNS A;  3N4C A;  1CSB B;  3KW9 A;  4C5P A;  1PAD A;  1CTE A;  2FYE A;  3LFY A;  5CHV A;  1F2B A;  2DCB A;  3IOQ A;  1STF E;  4GUZ A;  3O0U A;  1U9W A;  4X6H A;  3TNX A;  3ERV A;  3KFQ A;  2GFO A;  1NB5 A;  3E1Z B;  4YYS A;  2FTD A;  2Y6E A;  1SNK A;  2CIO A;  4CDC B;  3WXF A;  6PAD A;  3BPF A;  1AU0 A;  3HWN A;  1Y4H A;  2P0R A;  3ZUA A;  3KWB X;  3MHS A;  2HXZ A;  1W6F A;  4G54 A;  3OVZ A;  3P5U A;  2AIM A;  1PCI A;  3RVV A;  1W5R A;  1EWM A;  4N8W A;  2OZ2 A;  1U9X A;  1DF0 A;  4XUI A;  1AYV A;  2B1N A;  3O1G A;  4RY2 A;  1JQP A;  2HH5 A;  2DC8 A;  1KFU L;  1QXP A;  1QOL A;  1IWD A;  2P86 A;  1F29 A;  2PRE A;  2AUZ A;  1MEM A;  4PI3 A;  3N3K A;  4BQV A;  3QT4 A;  1POP A;  3BWK A;  4I07 A;  1ATK A;  1F2C A;  1E2T A;  3S3Q A;  3LXS A;  4W4U A;  4PP1 A;  4XR7 A;  3OF9 A;  2IBI A;  1MIR A;  2E02 A;  3MHH A;  1KHP A;  1AIM A;  3H6S A;  3BPM A;  3IHP A;  1YAL A;  5FPW A;  1QDQ A;  4HWY A;  3OVX A;  1FH0 A;  2YJ2 A;  3IMA A;  1MS6 A;  5K16 A;  3AI8 A;  1PXV A;  2BSZ A;  2VHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...