3H89A

A combined crystallographic and molecular dynamics study of cathepsin-l retro-binding inhibitors(compound 4)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
220
structure length
215
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin L1
publication title A combined crystallographic and molecular dynamics study of cathepsin L retrobinding inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 215
sequence length 220
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h89A00
2FTDA 2AU1A 1M6DA 4OEMA 4YYQA 1QXPA 3N3KA 3K24A 1AYWA 2E01A 1YK8A 4YYUA 1VJVA 2AYNA 2NQIA 1PPOA 4N79A 2FO5A 1YALA 3TNXA 2AIMA 1ME4A 1F2AA 2NQDB 3K8UA 3O0UA 3U8EA 3RVVA 1ITOA 2DCDA 3F5VA 2AYOA 3BPMA 1U5IA 4OELA 9PAPA 4W5BA 3CBKA 3KWBX 2XU4A 1K3BB 1AU2A 1GLOA 1XKGA 2DJGB 2R9NA 1PADA 1KFXL 1KHPA 4MSXA 2Y6EA 4G54A 1PPDA 1MHWA 3HHAA 1PPPA 2DCAA 2P86A 4P6EA 3QT4A 2OULA 2G7YA 1HUCB 3IUTA 1CB5A 1GECE 2WBFX 5CVOB 3HD3A 3LFYA 1ATKA 4YYRA 3QJ3A 3MORA 2FUDA 3IEJA 2B1NA 5CHVA 1U9QX 2BDZA 3HWNA 1DF0A 1VSNA 3WXGA 3M99A 3IV2A 2HD5A 2O6XA 1PPNA 2C0YA 6PADA 2E02A 1EWPA 1O0EA 1AECA 1Y08A 3BOWA 4QRVA 1AU3A 3KFQA 4MZOA 1U9VA 2Y5BA 3IOQA 4BQVA 3WXEA 2XU1A 3BPFA 5CHTA 4BS6A 3QSDA 1NB3A 1MS6A 1NPZA 1CPJA 4CDDB 4X6HA 2XU3A 1PE6A 2NQGA 3MHHA 3KX1A 1NL6A 3P5XA 3BC3A 2R9MA 3O1GA 4FK5A 1AIMA 1DEUA 2F1GA 1S4VA 4BS5A 2DC8A 1U9WA 2CB5A 5EGWA 3I3TA 2H7JA 3H8CA 4AXLA 3V6EA 3PW3A 4WA6A 2G8JA 3IMAA 5JH3A 3P5UA 2R9FA 3LXSA 2R9CA 1YK7A 3USVA 4YYWA 1ICFA 4PP1A 1EWMA 3WXFA 2P0RA 3CH2X 3OISA 1YVBA 2R6NA 3CBJA 1ZCMA 2DZYA 2YJ8A 3D6SA 3BCNA 3N3GA 5FPWA 2VHSA 1QMYA 3V6CA 3MTNA 5JA7A 2PBHA 4DMXA 4N8WA 1STFE 3IHPA 2GHUA 1CS8A 2DCCA 3DF0A 3OVZA 1QDQA 2F7DA 1TL9A 1X9YA 4RY2A 2G8EA 5CVMA 5F02A 1THEA 1AU0A 1F2BA 2YJ9A 1BY8A 1BQIA 2VHFA 4QBBA 4Q8GA 3RVXA 4QRXA 2DC7A 4YVAA 4K7CA 3I06A 2GFOA 3BWKA 4AXMA 2PREA 2XU5A 3CH3X 5EF4A 2OZ2A 1BGOA 4XR7A 7PCKA 2HHNA 4PP2E 4YYVA 1POPA 4ZUXU 3AI8A 1CV8A 3K9MA 3S3QA 4YV8A 2BDLA 3OF8A 2YJBA 1Q6KA 3P5VA 1MEGA 4FJCA 1EWLA 2CIOA 4I07A 4CZWA 1FH0A 4MZSA 8PCHA 4Q8HA 3PNRA 5PADA 2NQAA 3OF9A 1U9XA 2JQGR 4PADA 2YJCA 1CVZA 4X6IA 4DMYA 3E1ZB 5A24A 1NQCA 3N4CA 1EF7A 1GCBA 3ZUAA 4QRGA 4W4UA 1MEMA 3B79A 2AS8A 1BP4A 2E03A 2FRAA 3ERVA 4CDCB 1KHQA 2HXZA 2JQFR 1AU4A 2R9OA 1QOLA 4W5CA 1TU6A 2AVWA 3RVWA 4PI3A 4HWYA 5J94A 2YJ2A 3P5WA 3H8BA 1CSBB 3KSEA 1F29A 3H6SA 2DC9A 2ACTA 1EWOA 3H7DA 1AYVA 1KXRA 3S3RA 3KW9A 2OP3A 4XUIA 3NHEA 3GCBA 2FYEA 1SNKA 1YT7A 1SP4B 1KFUL 1CJLA 1PBHA 3OVXA 1MDWA 1ME3A 1CTEA 1PIPA 4BSQA 2B1MA 1NLJA 4FIPA 4I05A 3HHIA 3KWZA 3PBHA 1NB5A 1AYUA 2FT2A 1A6RA 2DJFB 3MHSA 3F75A 2AUXA 2E00A 2IPPB 1F2CA 5K16A 1TLOA 2P7UA 4KLBA 3KKUA 2PNSA 2ARYA 4CDEB 5CVNB 4QH6A 1CQDA 2G6DA 2FRQA 3H89A 4I04A 2AUZA 1GMYA 4X6JA 2IBIA 1PCIA 4N4ZA 3PDFA 2HH5A 2DZZA 2PADA 2ATOA 2DCBA 4P6GA 4YYSA 1PXVA 1ZIVA 4BPVA 1IWDA 1JQPA 1MIRA 3C9EA 2FQ9A 1Y4HA 2DC6A 4CDFB
chains in the Genus database with same CATH superfamily
2FTDA 4D8BA 2AU1A 1M6DA 4OEMA 5KO3A 4YYQA 1QXPA 3N3KA 3K24A 1AYWA 2UZJA 2E01A 1YK8A 4YYUA 1VJVA 2AYNA 2NQIA 4D8EA 3IFUA 1PPOA 4N79A 2FO5A 1YALA 1YZBA 3TNXA 2AIMA 1ME4A 1F2AA 2NQDB 3K8UA 3O0UA 3U8EA 3RVVA 3PRPA 1ITOA 2DCDA 3F5VA 2AYOA 3BPMA 1U5IA 4OELA 9PAPA 4W5BA 3CBKA 3KWBX 2XU4A 1K3BB 4BOPA 1AU2A 1GLOA 1XKGA 2DJGB 2R9NA 3PT2A 1PADA 4GUAA 1KFXL 1KHPA 4MSXA 2Y6EA 3O65A 4G54A 3ZNHA 1PPDA 3MTVA 1MHWA 3HHAA 1PPPA 2DCAA 4P16A 2J7QC 2P86A 4P6EA 3QT4A 2OULA 2G7YA 1HUCB 3IUTA 1CB5A 3E9SA 1GECE 2WBFX 5CVOB 3HD3A 3LFYA 1ATKA 4YYRA 3B21A 3QJ3A 3MORA 4IP3A 2FUDA 3IEJA 2B1NA 5CHVA 1U9QX 2BDZA 3HWNA 1DF0A 1VSNA 3WXGA 3M99A 3IV2A 2HD5A 2O6XA 1PPNA 2C0YA 6PADA 2E02A 1EWPA 1O0EA 1AECA 1Y08A 3PSEA 3BOWA 4QRVA 1AU3A 3KFQA 4BOQA 4MZOA 1U9VA 2JRIA 2Y5BA 3IOQA 4BQVA 3WXEA 4RKXA 2XU1A 4D8IA 2JTCA 3BPFA 3C0RA 5CHTA 4BS6A 3QSDA 1NB3A 4OVZB 1MS6A 1NPZA 1CPJA 4CDDB 4X6HA 2XU3A 1PE6A 2NQGA 3MHHA 3KX1A 1NL6A 3P5XA 3BC3A 4IUMA 2R9MA 3O1GA 4FK5A 1AIMA 1DEUA 4WURA 2F1GA 1S4VA 4BS5A 2DC8A 1U9WA 3BB7A 2CB5A 5EGWA 5JZEA 2Z84A 3I3TA 2H7JA 3H8CA 5E6JA 4AXLA 3V6EA 3PW3A 4WA6A 2G8JA 3IMAA 5JH3A 3P5UA 2R9FA 3LXSA 2R9CA 3TRKA 1DKIA 1YK7A 3USVA 4YYWA 1ICFA 4OW0A 4PP1A 1EWMA 4R3DA 3WXFA 2P0RA 3CH2X 3OISA 1YVBA 2R6NA 3CBJA 1ZCMA 2DZYA 2YJ8A 3D6SA 3BCNA 3W31A 3PHXA 3MP2A 3N3GA 2BTWB 2J7QA 5FPWA 2VHSA 1QMYA 3V6CA 3MTNA 1PVJA 2PBHA 5JA7A 4DMXA 4N8WA 4BOUA 1STFE 2HWKA 3IHPA 2GHUA 1CS8A 2DCCA 3DF0A 3OVZA 3OQCA 1QDQA 2F7DA 1TL9A 1X9YA 4RY2A 2G8EA 2DOSA 5CVMA 5F02A 1THEA 1AU0A 4XZXA 1F2BA 2YJ9A 3PHUA 1BY8A 1BQIA 2VHFA 3RNVA 3PRMA 4QBBA 4Q8GA 3RVXA 4QRXA 2DC7A 4YVAA 4K7CA 3I06A 4MI7A 2GFOA 3BWKA 4A5UA 4AXMA 2PREA 2XU5A 3CH3X 5EF4A 2OZ2A 4PT5A 3BY4A 4RF1A 4RNAA 1BGOA 4XR7A 7PCKA 2HHNA 4PP2E 4YYVA 1POPA 4ZUXU 3AI8A 4HXDB 1CV8A 3K9MA 3S3QA 4YV8A 2BDLA 3OF8A 2YJBA 1Q6KA 3P5VA 1MEGA 4FJCA 1EWLA 2CIOA 4I07A 4CZWA 1FH0A 4MZSA 8PCHA 4Q8HA 2FE8A 3PNRA 5PADA 2NQAA 3OF9A 1U9XA 2JQGR 4PADA 2YJCA 4OVZA 1CVZA 4X6IA 4DMYA 4M0WA 3E1ZB 5A24A 1NQCA 3N4CA 1EF7A 1GCBA 3ZUAA 4QRGA 4BOSA 4W4UA 1MEMA 3B79A 2AS8A 5EZQA 1BP4A 2E03A 2FRAA 3ERVA 4CDCB 1KHQA 2HXZA 2JQFR 1AU4A 2R9OA 1QOLA 4W5CA 1TU6A 2AVWA 3RVWA 4PI3A 4HWYA 5J94A 2YJ2A 3P5WA 3H8BA 1CSBB 3KSEA 1F29A 3H6SA 2DC9A 2ACTA 1EWOA 3H7DA 1AYVA 1KXRA 3S3RA 3KW9A 2OP3A 4XUIA 3NHEA 3GCBA 2FYEA 1SNKA 1YT7A 1SP4B 1KFUL 1CJLA 4RF0A 3TMPA 1PBHA 3OVXA 1MDWA 1ME3A 1CTEA 1PIPA 4BSQA 2B1MA 1NLJA 2BTWA 3W30A 4FIPA 4I05A 3MJ5A 3HHIA 3KWZA 3PBHA 4ZTBA 1NB5A 3PHWA 2AGAA 5EZSA 1AYUA 4BOZA 2FT2A 2BU3A 1A6RA 2DJFB 3MHSA 3F75A 2AUXA 2E00A 2IPPB 1F2CA 5K16A 1TLOA 2P7UA 3BBAA 4KLBA 3KKUA 2PNSA 2ARYA 4CDEB 5CVNB 4QH6A 1CQDA 2G6DA 2FRQA 3H89A 4I04A 2AUZA 1GMYA 4X6JA 2IBIA 1PCIA 4N4ZA 1UKFA 4REZA 3PDFA 2HH5A 2DZZA 2PADA 2ATOA 2DCBA 4P6GA 4YYSA 1PXVA 4MM3B 1ZIVA 4BPVA 1IWDA 1JQPA 1MIRA 3C9EA 2FQ9A 1Y4HA 2DC6A 4CDFB
chains in the Genus database with same CATH topology
2FTDA 2AU1A 1E2TA 1M6DA 4OEMA 4YYQA 1QXPA 3N3KA 3K24A 1AYWA 2E01A 1YK8A 4YYUA 1VJVA 2AYNA 2NQIA 1PPOA 4N79A 2FO5A 1YALA 3TNXA 2AIMA 1ME4A 1F2AA 2NQDB 3K8UA 3O0UA 3U8EA 3RVVA 1ITOA 2DCDA 3F5VA 2AYOA 3BPMA 1U5IA 4OELA 9PAPA 4W5BA 3CBKA 3KWBX 2XU4A 1K3BB 1W4TA 1AU2A 1GLOA 1XKGA 2DJGB 2R9NA 1PADA 1KFXL 1KHPA 4MSXA 2Y6EA 4G54A 1PPDA 1MHWA 3HHAA 1PPPA 2DCAA 2P86A 4P6EA 3QT4A 2OULA 2G7YA 1HUCB 3IUTA 1CB5A 1GECE 2WBFX 5CVOB 3HD3A 3LFYA 1ATKA 4YYRA 3QJ3A 3MORA 2FUDA 3IEJA 2B1NA 5CHVA 1U9QX 2BDZA 4GUZA 3HWNA 1DF0A 1VSNA 3WXGA 3M99A 3IV2A 2HD5A 2O6XA 1PPNA 2C0YA 6PADA 2E02A 1EWPA 1O0EA 4BGFA 2BSZA 1AECA 1Y08A 3BOWA 4QRVA 1AU3A 3KFQA 4MZOA 1U9VA 2Y5BA 3IOQA 4BQVA 3WXEA 2XU1A 3BPFA 5CHTA 4BS6A 3QSDA 1NB3A 1MS6A 1NPZA 1CPJA 4CDDB 4X6HA 2XU3A 1PE6A 2NQGA 3MHHA 3KX1A 1NL6A 3P5XA 3BC3A 2R9MA 3O1GA 4FK5A 1AIMA 2VFBA 1DEUA 2F1GA 1S4VA 4NV8A 4BS5A 2DC8A 1U9WA 2CB5A 5EGWA 3I3TA 2H7JA 3H8CA 4AXLA 3D9WA 3V6EA 3PW3A 4WA6A 2G8JA 3IMAA 5JH3A 3P5UA 2R9FA 3LXSA 2R9CA 1YK7A 3USVA 4YYWA 1ICFA 4PP1A 4B55A 1EWMA 3WXFA 2P0RA 3CH2X 3OISA 1YVBA 2R6NA 3CBJA 1ZCMA 2DZYA 2YJ8A 3D6SA 3BCNA 4C5PA 3N3GA 5FPWA 2VHSA 1QMYA 3V6CA 3MTNA 5JA7A 2PBHA 4DMXA 4N8WA 1STFE 3IHPA 2GHUA 1CS8A 2DCCA 3DF0A 3OVZA 1QDQA 2F7DA 1TL9A 1X9YA 4RY2A 2G8EA 5CVMA 5F02A 1THEA 1AU0A 1F2BA 2YJ9A 1BY8A 1BQIA 2VHFA 4QBBA 4Q8GA 3RVXA 4QRXA 2DC7A 4YVAA 4K7CA 3I06A 2GFOA 3BWKA 4AXMA 2PREA 2XU5A 3CH3X 5EF4A 2OZ2A 1W5RA 2VFCA 1BGOA 4XR7A 7PCKA 2HHNA 4PP2E 4YYVA 1POPA 4ZUXU 3AI8A 1CV8A 3K9MA 3S3QA 4YV8A 2BDLA 3OF8A 2YJBA 1Q6KA 3P5VA 1MEGA 4FJCA 1EWLA 2CIOA 4I07A 4CZWA 1FH0A 4MZSA 8PCHA 4Q8HA 1GX3A 3PNRA 5PADA 2NQAA 3OF9A 1U9XA 2JQGR 4PADA 2YJCA 1CVZA 4X6IA 4DMYA 3E1ZB 5A24A 1NQCA 3N4CA 1EF7A 1GCBA 3ZUAA 4QRGA 4W4UA 1MEMA 3B79A 2AS8A 1BP4A 2E03A 2FRAA 3ERVA 4CDCB 1KHQA 2HXZA 2JQFR 1AU4A 2R9OA 1QOLA 4W5CA 1TU6A 2AVWA 3RVWA 4PI3A 4HWYA 5J94A 2YJ2A 3P5WA 1W6FA 3H8BA 1CSBB 3KSEA 1F29A 3H6SA 2DC9A 2ACTA 1EWOA 3H7DA 1AYVA 1KXRA 3S3RA 3KW9A 2OP3A 4XUIA 3NHEA 3GCBA 2FYEA 1SNKA 1YT7A 1SP4B 1KFUL 1CJLA 4NV7A 1PBHA 3OVXA 1MDWA 1ME3A 1CTEA 1PIPA 4BSQA 2B1MA 1NLJA 4FIPA 4I05A 3LTWA 3HHIA 3KWZA 3PBHA 1NB5A 1AYUA 2FT2A 1A6RA 2DJFB 3MHSA 3F75A 2AUXA 2E00A 2IPPB 1F2CA 5K16A 1TLOA 2P7UA 4KLBA 3KKUA 2PNSA 2ARYA 4CDEB 5CVNB 4QH6A 1CQDA 2G6DA 2FRQA 3H89A 4I04A 2AUZA 1GMYA 4X6JA 2IBIA 1PCIA 4N4ZA 3PDFA 2HH5A 2DZZA 2PADA 2ATOA 2DCBA 4P6GA 4YYSA 1PXVA 1ZIVA 4BPVA 1IWDA 1JQPA 1MIRA 3C9EA 2FQ9A 1Y4HA 2DC6A 4CDFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FTD A;  2AU1 A;  1M6D A;  4OEM A;  4YYQ A;  1QXP A;  3N3K A;  3K24 A;  1AYW A;  2E01 A;  1YK8 A;  4YYU A;  1VJV A;  2AYN A;  2NQI A;  1PPO A;  4N79 A;  2FO5 A;  1YAL A;  3TNX A;  2AIM A;  1ME4 A;  1F2A A;  2NQD B;  3K8U A;  3O0U A;  3U8E A;  3RVV A;  1ITO A;  2DCD A;  3F5V A;  2AYO A;  3BPM A;  1U5I A;  4OEL A;  9PAP A;  4W5B A;  3CBK A;  3KWB X;  2XU4 A;  1K3B B;  1AU2 A;  1GLO A;  1XKG A;  2DJG B;  2R9N A;  1PAD A;  1KFX L;  1KHP A;  4MSX A;  2Y6E A;  4G54 A;  1PPD A;  1MHW A;  3HHA A;  1PPP A;  2DCA A;  2P86 A;  4P6E A;  3QT4 A;  2OUL A;  2G7Y A;  1HUC B;  3IUT A;  1CB5 A;  1GEC E;  2WBF X;  5CVO B;  3HD3 A;  3LFY A;  1ATK A;  4YYR A;  3QJ3 A;  3MOR A;  2FUD A;  3IEJ A;  2B1N A;  5CHV A;  1U9Q X;  2BDZ A;  3HWN A;  1DF0 A;  1VSN A;  3WXG A;  3M99 A;  3IV2 A;  2HD5 A;  2O6X A;  1PPN A;  2C0Y A;  6PAD A;  2E02 A;  1EWP A;  1O0E A;  1AEC A;  1Y08 A;  3BOW A;  4QRV A;  1AU3 A;  3KFQ A;  4MZO A;  1U9V A;  2Y5B A;  3IOQ A;  4BQV A;  3WXE A;  2XU1 A;  3BPF A;  5CHT A;  4BS6 A;  3QSD A;  1NB3 A;  1MS6 A;  1NPZ A;  1CPJ A;  4CDD B;  4X6H A;  2XU3 A;  1PE6 A;  2NQG A;  3MHH A;  3KX1 A;  1NL6 A;  3P5X A;  3BC3 A;  2R9M A;  3O1G A;  4FK5 A;  1AIM A;  1DEU A;  2F1G A;  1S4V A;  4BS5 A;  2DC8 A;  1U9W A;  2CB5 A;  5EGW A;  3I3T A;  2H7J A;  3H8C A;  4AXL A;  3V6E A;  3PW3 A;  4WA6 A;  2G8J A;  3IMA A;  5JH3 A;  3P5U A;  2R9F A;  3LXS A;  2R9C A;  1YK7 A;  3USV A;  4YYW A;  1ICF A;  4PP1 A;  1EWM A;  3WXF A;  2P0R A;  3CH2 X;  3OIS A;  1YVB A;  2R6N A;  3CBJ A;  1ZCM A;  2DZY A;  2YJ8 A;  3D6S A;  3BCN A;  3N3G A;  5FPW A;  2VHS A;  1QMY A;  3V6C A;  3MTN A;  5JA7 A;  2PBH A;  4DMX A;  4N8W A;  1STF E;  3IHP A;  2GHU A;  1CS8 A;  2DCC A;  3DF0 A;  3OVZ A;  1QDQ A;  2F7D A;  1TL9 A;  1X9Y A;  4RY2 A;  2G8E A;  5CVM A;  5F02 A;  1THE A;  1AU0 A;  1F2B A;  2YJ9 A;  1BY8 A;  1BQI A;  2VHF A;  4QBB A;  4Q8G A;  3RVX A;  4QRX A;  2DC7 A;  4YVA A;  4K7C A;  3I06 A;  2GFO A;  3BWK A;  4AXM A;  2PRE A;  2XU5 A;  3CH3 X;  5EF4 A;  2OZ2 A;  1BGO A;  4XR7 A;  7PCK A;  2HHN A;  4PP2 E;  4YYV A;  1POP A;  4ZUX U;  3AI8 A;  1CV8 A;  3K9M A;  3S3Q A;  4YV8 A;  2BDL A;  3OF8 A;  2YJB A;  1Q6K A;  3P5V A;  1MEG A;  4FJC A;  1EWL A;  2CIO A;  4I07 A;  4CZW A;  1FH0 A;  4MZS A;  8PCH A;  4Q8H A;  3PNR A;  5PAD A;  2NQA A;  3OF9 A;  1U9X A;  2JQG R;  4PAD A;  2YJC A;  1CVZ A;  4X6I A;  4DMY A;  3E1Z B;  5A24 A;  1NQC A;  3N4C A;  1EF7 A;  1GCB A;  3ZUA A;  4QRG A;  4W4U A;  1MEM A;  3B79 A;  2AS8 A;  1BP4 A;  2E03 A;  2FRA A;  3ERV A;  4CDC B;  1KHQ A;  2HXZ A;  2JQF R;  1AU4 A;  2R9O A;  1QOL A;  4W5C A;  1TU6 A;  2AVW A;  3RVW A;  4PI3 A;  4HWY A;  5J94 A;  2YJ2 A;  3P5W A;  3H8B A;  1CSB B;  3KSE A;  1F29 A;  3H6S A;  2DC9 A;  2ACT A;  1EWO A;  3H7D A;  1AYV A;  1KXR A;  3S3R A;  3KW9 A;  2OP3 A;  4XUI A;  3NHE A;  3GCB A;  2FYE A;  1SNK A;  1YT7 A;  1SP4 B;  1KFU L;  1CJL A;  1PBH A;  3OVX A;  1MDW A;  1ME3 A;  1CTE A;  1PIP A;  4BSQ A;  2B1M A;  1NLJ A;  4FIP A;  4I05 A;  3HHI A;  3KWZ A;  3PBH A;  1NB5 A;  1AYU A;  2FT2 A;  1A6R A;  2DJF B;  3MHS A;  3F75 A;  2AUX A;  2E00 A;  2IPP B;  1F2C A;  5K16 A;  1TLO A;  2P7U A;  4KLB A;  3KKU A;  2PNS A;  2ARY A;  4CDE B;  5CVN B;  4QH6 A;  1CQD A;  2G6D A;  2FRQ A;  3H89 A;  4I04 A;  2AUZ A;  1GMY A;  4X6J A;  2IBI A;  1PCI A;  4N4Z A;  3PDF A;  2HH5 A;  2DZZ A;  2PAD A;  2ATO A;  2DCB A;  4P6G A;  4YYS A;  1PXV A;  1ZIV A;  4BPV A;  1IWD A;  1JQP A;  1MIR A;  3C9E A;  2FQ9 A;  1Y4H A;  2DC6 A;  4CDF B; 
#chains in the Genus database with same CATH topology
 2FTD A;  4D8B A;  2AU1 A;  1M6D A;  4OEM A;  5KO3 A;  4YYQ A;  1QXP A;  3N3K A;  3K24 A;  1AYW A;  2UZJ A;  2E01 A;  1YK8 A;  4YYU A;  1VJV A;  2AYN A;  2NQI A;  4D8E A;  3IFU A;  1PPO A;  4N79 A;  2FO5 A;  1YAL A;  1YZB A;  3TNX A;  2AIM A;  1ME4 A;  1F2A A;  2NQD B;  3K8U A;  3O0U A;  3U8E A;  3RVV A;  3PRP A;  1ITO A;  2DCD A;  3F5V A;  2AYO A;  3BPM A;  1U5I A;  4OEL A;  9PAP A;  4W5B A;  3CBK A;  3KWB X;  2XU4 A;  1K3B B;  4BOP A;  1AU2 A;  1GLO A;  1XKG A;  2DJG B;  2R9N A;  3PT2 A;  1PAD A;  4GUA A;  1KFX L;  1KHP A;  4MSX A;  2Y6E A;  3O65 A;  4G54 A;  3ZNH A;  1PPD A;  3MTV A;  1MHW A;  3HHA A;  1PPP A;  2DCA A;  4P16 A;  2J7Q C;  2P86 A;  4P6E A;  3QT4 A;  2OUL A;  2G7Y A;  1HUC B;  3IUT A;  1CB5 A;  3E9S A;  1GEC E;  2WBF X;  5CVO B;  3HD3 A;  3LFY A;  1ATK A;  4YYR A;  3B21 A;  3QJ3 A;  3MOR A;  4IP3 A;  2FUD A;  3IEJ A;  2B1N A;  5CHV A;  1U9Q X;  2BDZ A;  3HWN A;  1DF0 A;  1VSN A;  3WXG A;  3M99 A;  3IV2 A;  2HD5 A;  2O6X A;  1PPN A;  2C0Y A;  6PAD A;  2E02 A;  1EWP A;  1O0E A;  1AEC A;  1Y08 A;  3PSE A;  3BOW A;  4QRV A;  1AU3 A;  3KFQ A;  4BOQ A;  4MZO A;  1U9V A;  2JRI A;  2Y5B A;  3IOQ A;  4BQV A;  3WXE A;  4RKX A;  2XU1 A;  4D8I A;  2JTC A;  3BPF A;  3C0R A;  5CHT A;  4BS6 A;  3QSD A;  1NB3 A;  4OVZ B;  1MS6 A;  1NPZ A;  1CPJ A;  4CDD B;  4X6H A;  2XU3 A;  1PE6 A;  2NQG A;  3MHH A;  3KX1 A;  1NL6 A;  3P5X A;  3BC3 A;  4IUM A;  2R9M A;  3O1G A;  4FK5 A;  1AIM A;  1DEU A;  4WUR A;  2F1G A;  1S4V A;  4BS5 A;  2DC8 A;  1U9W A;  3BB7 A;  2CB5 A;  5EGW A;  5JZE A;  2Z84 A;  3I3T A;  2H7J A;  3H8C A;  5E6J A;  4AXL A;  3V6E A;  3PW3 A;  4WA6 A;  2G8J A;  3IMA A;  5JH3 A;  3P5U A;  2R9F A;  3LXS A;  2R9C A;  3TRK A;  1DKI A;  1YK7 A;  3USV A;  4YYW A;  1ICF A;  4OW0 A;  4PP1 A;  1EWM A;  4R3D A;  3WXF A;  2P0R A;  3CH2 X;  3OIS A;  1YVB A;  2R6N A;  3CBJ A;  1ZCM A;  2DZY A;  2YJ8 A;  3D6S A;  3BCN A;  3W31 A;  3PHX A;  3MP2 A;  3N3G A;  2BTW B;  2J7Q A;  5FPW A;  2VHS A;  1QMY A;  3V6C A;  3MTN A;  1PVJ A;  2PBH A;  5JA7 A;  4DMX A;  4N8W A;  4BOU A;  1STF E;  2HWK A;  3IHP A;  2GHU A;  1CS8 A;  2DCC A;  3DF0 A;  3OVZ A;  3OQC A;  1QDQ A;  2F7D A;  1TL9 A;  1X9Y A;  4RY2 A;  2G8E A;  2DOS A;  5CVM A;  5F02 A;  1THE A;  1AU0 A;  4XZX A;  1F2B A;  2YJ9 A;  3PHU A;  1BY8 A;  1BQI A;  2VHF A;  3RNV A;  3PRM A;  4QBB A;  4Q8G A;  3RVX A;  4QRX A;  2DC7 A;  4YVA A;  4K7C A;  3I06 A;  4MI7 A;  2GFO A;  3BWK A;  4A5U A;  4AXM A;  2PRE A;  2XU5 A;  3CH3 X;  5EF4 A;  2OZ2 A;  4PT5 A;  3BY4 A;  4RF1 A;  4RNA A;  1BGO A;  4XR7 A;  7PCK A;  2HHN A;  4PP2 E;  4YYV A;  1POP A;  4ZUX U;  3AI8 A;  4HXD B;  1CV8 A;  3K9M A;  3S3Q A;  4YV8 A;  2BDL A;  3OF8 A;  2YJB A;  1Q6K A;  3P5V A;  1MEG A;  4FJC A;  1EWL A;  2CIO A;  4I07 A;  4CZW A;  1FH0 A;  4MZS A;  8PCH A;  4Q8H A;  2FE8 A;  3PNR A;  5PAD A;  2NQA A;  3OF9 A;  1U9X A;  2JQG R;  4PAD A;  2YJC A;  4OVZ A;  1CVZ A;  4X6I A;  4DMY A;  4M0W A;  3E1Z B;  5A24 A;  1NQC A;  3N4C A;  1EF7 A;  1GCB A;  3ZUA A;  4QRG A;  4BOS A;  4W4U A;  1MEM A;  3B79 A;  2AS8 A;  5EZQ A;  1BP4 A;  2E03 A;  2FRA A;  3ERV A;  4CDC B;  1KHQ A;  2HXZ A;  2JQF R;  1AU4 A;  2R9O A;  1QOL A;  4W5C A;  1TU6 A;  2AVW A;  3RVW A;  4PI3 A;  4HWY A;  5J94 A;  2YJ2 A;  3P5W A;  3H8B A;  1CSB B;  3KSE A;  1F29 A;  3H6S A;  2DC9 A;  2ACT A;  1EWO A;  3H7D A;  1AYV A;  1KXR A;  3S3R A;  3KW9 A;  2OP3 A;  4XUI A;  3NHE A;  3GCB A;  2FYE A;  1SNK A;  1YT7 A;  1SP4 B;  1KFU L;  1CJL A;  4RF0 A;  3TMP A;  1PBH A;  3OVX A;  1MDW A;  1ME3 A;  1CTE A;  1PIP A;  4BSQ A;  2B1M A;  1NLJ A;  2BTW A;  3W30 A;  4FIP A;  4I05 A;  3MJ5 A;  3HHI A;  3KWZ A;  3PBH A;  4ZTB A;  1NB5 A;  3PHW A;  2AGA A;  5EZS A;  1AYU A;  4BOZ A;  2FT2 A;  2BU3 A;  1A6R A;  2DJF B;  3MHS A;  3F75 A;  2AUX A;  2E00 A;  2IPP B;  1F2C A;  5K16 A;  1TLO A;  2P7U A;  3BBA A;  4KLB A;  3KKU A;  2PNS A;  2ARY A;  4CDE B;  5CVN B;  4QH6 A;  1CQD A;  2G6D A;  2FRQ A;  3H89 A;  4I04 A;  2AUZ A;  1GMY A;  4X6J A;  2IBI A;  1PCI A;  4N4Z A;  1UKF A;  4REZ A;  3PDF A;  2HH5 A;  2DZZ A;  2PAD A;  2ATO A;  2DCB A;  4P6G A;  4YYS A;  1PXV A;  4MM3 B;  1ZIV A;  4BPV A;  1IWD A;  1JQP A;  1MIR A;  3C9E A;  2FQ9 A;  1Y4H A;  2DC6 A;  4CDF B; 
#chains in the Genus database with same CATH homology
 2FTD A;  2AU1 A;  1E2T A;  1M6D A;  4OEM A;  4YYQ A;  1QXP A;  3N3K A;  3K24 A;  1AYW A;  2E01 A;  1YK8 A;  4YYU A;  1VJV A;  2AYN A;  2NQI A;  1PPO A;  4N79 A;  2FO5 A;  1YAL A;  3TNX A;  2AIM A;  1ME4 A;  1F2A A;  2NQD B;  3K8U A;  3O0U A;  3U8E A;  3RVV A;  1ITO A;  2DCD A;  3F5V A;  2AYO A;  3BPM A;  1U5I A;  4OEL A;  9PAP A;  4W5B A;  3CBK A;  3KWB X;  2XU4 A;  1K3B B;  1W4T A;  1AU2 A;  1GLO A;  1XKG A;  2DJG B;  2R9N A;  1PAD A;  1KFX L;  1KHP A;  4MSX A;  2Y6E A;  4G54 A;  1PPD A;  1MHW A;  3HHA A;  1PPP A;  2DCA A;  2P86 A;  4P6E A;  3QT4 A;  2OUL A;  2G7Y A;  1HUC B;  3IUT A;  1CB5 A;  1GEC E;  2WBF X;  5CVO B;  3HD3 A;  3LFY A;  1ATK A;  4YYR A;  3QJ3 A;  3MOR A;  2FUD A;  3IEJ A;  2B1N A;  5CHV A;  1U9Q X;  2BDZ A;  4GUZ A;  3HWN A;  1DF0 A;  1VSN A;  3WXG A;  3M99 A;  3IV2 A;  2HD5 A;  2O6X A;  1PPN A;  2C0Y A;  6PAD A;  2E02 A;  1EWP A;  1O0E A;  4BGF A;  2BSZ A;  1AEC A;  1Y08 A;  3BOW A;  4QRV A;  1AU3 A;  3KFQ A;  4MZO A;  1U9V A;  2Y5B A;  3IOQ A;  4BQV A;  3WXE A;  2XU1 A;  3BPF A;  5CHT A;  4BS6 A;  3QSD A;  1NB3 A;  1MS6 A;  1NPZ A;  1CPJ A;  4CDD B;  4X6H A;  2XU3 A;  1PE6 A;  2NQG A;  3MHH A;  3KX1 A;  1NL6 A;  3P5X A;  3BC3 A;  2R9M A;  3O1G A;  4FK5 A;  1AIM A;  2VFB A;  1DEU A;  2F1G A;  1S4V A;  4NV8 A;  4BS5 A;  2DC8 A;  1U9W A;  2CB5 A;  5EGW A;  3I3T A;  2H7J A;  3H8C A;  4AXL A;  3D9W A;  3V6E A;  3PW3 A;  4WA6 A;  2G8J A;  3IMA A;  5JH3 A;  3P5U A;  2R9F A;  3LXS A;  2R9C A;  1YK7 A;  3USV A;  4YYW A;  1ICF A;  4PP1 A;  4B55 A;  1EWM A;  3WXF A;  2P0R A;  3CH2 X;  3OIS A;  1YVB A;  2R6N A;  3CBJ A;  1ZCM A;  2DZY A;  2YJ8 A;  3D6S A;  3BCN A;  4C5P A;  3N3G A;  5FPW A;  2VHS A;  1QMY A;  3V6C A;  3MTN A;  5JA7 A;  2PBH A;  4DMX A;  4N8W A;  1STF E;  3IHP A;  2GHU A;  1CS8 A;  2DCC A;  3DF0 A;  3OVZ A;  1QDQ A;  2F7D A;  1TL9 A;  1X9Y A;  4RY2 A;  2G8E A;  5CVM A;  5F02 A;  1THE A;  1AU0 A;  1F2B A;  2YJ9 A;  1BY8 A;  1BQI A;  2VHF A;  4QBB A;  4Q8G A;  3RVX A;  4QRX A;  2DC7 A;  4YVA A;  4K7C A;  3I06 A;  2GFO A;  3BWK A;  4AXM A;  2PRE A;  2XU5 A;  3CH3 X;  5EF4 A;  2OZ2 A;  1W5R A;  2VFC A;  1BGO A;  4XR7 A;  7PCK A;  2HHN A;  4PP2 E;  4YYV A;  1POP A;  4ZUX U;  3AI8 A;  1CV8 A;  3K9M A;  3S3Q A;  4YV8 A;  2BDL A;  3OF8 A;  2YJB A;  1Q6K A;  3P5V A;  1MEG A;  4FJC A;  1EWL A;  2CIO A;  4I07 A;  4CZW A;  1FH0 A;  4MZS A;  8PCH A;  4Q8H A;  1GX3 A;  3PNR A;  5PAD A;  2NQA A;  3OF9 A;  1U9X A;  2JQG R;  4PAD A;  2YJC A;  1CVZ A;  4X6I A;  4DMY A;  3E1Z B;  5A24 A;  1NQC A;  3N4C A;  1EF7 A;  1GCB A;  3ZUA A;  4QRG A;  4W4U A;  1MEM A;  3B79 A;  2AS8 A;  1BP4 A;  2E03 A;  2FRA A;  3ERV A;  4CDC B;  1KHQ A;  2HXZ A;  2JQF R;  1AU4 A;  2R9O A;  1QOL A;  4W5C A;  1TU6 A;  2AVW A;  3RVW A;  4PI3 A;  4HWY A;  5J94 A;  2YJ2 A;  3P5W A;  1W6F A;  3H8B A;  1CSB B;  3KSE A;  1F29 A;  3H6S A;  2DC9 A;  2ACT A;  1EWO A;  3H7D A;  1AYV A;  1KXR A;  3S3R A;  3KW9 A;  2OP3 A;  4XUI A;  3NHE A;  3GCB A;  2FYE A;  1SNK A;  1YT7 A;  1SP4 B;  1KFU L;  1CJL A;  4NV7 A;  1PBH A;  3OVX A;  1MDW A;  1ME3 A;  1CTE A;  1PIP A;  4BSQ A;  2B1M A;  1NLJ A;  4FIP A;  4I05 A;  3LTW A;  3HHI A;  3KWZ A;  3PBH A;  1NB5 A;  1AYU A;  2FT2 A;  1A6R A;  2DJF B;  3MHS A;  3F75 A;  2AUX A;  2E00 A;  2IPP B;  1F2C A;  5K16 A;  1TLO A;  2P7U A;  4KLB A;  3KKU A;  2PNS A;  2ARY A;  4CDE B;  5CVN B;  4QH6 A;  1CQD A;  2G6D A;  2FRQ A;  3H89 A;  4I04 A;  2AUZ A;  1GMY A;  4X6J A;  2IBI A;  1PCI A;  4N4Z A;  3PDF A;  2HH5 A;  2DZZ A;  2PAD A;  2ATO A;  2DCB A;  4P6G A;  4YYS A;  1PXV A;  1ZIV A;  4BPV A;  1IWD A;  1JQP A;  1MIR A;  3C9E A;  2FQ9 A;  1Y4H A;  2DC6 A;  4CDF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...