3H89A

A combined crystallographic and molecular dynamics study of cathepsin-l retro-binding inhibitors(compound 4)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
220
structure length
215
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L1
publication title A combined crystallographic and molecular dynamics study of cathepsin L retrobinding inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 215
sequence length 220
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h89A00
5A24A 1MIRA 5PADA 3KSEA 1QOLA 2NQDB 3RVVA 5JH3A 1ZIVA 5FPWA 1XKGA 2HH5A 4PI3A 2YJ2A 4AXLA 2GHUA 1PPOA 3B79A 4BPVA 5JA7A 7PCKA 1NQCA 4X6JA 2WBFX 3WXGA 9PAPA 2DCBA 4BS6A 2P0RA 4I07A 3TNXA 3OISA 2AUXA 2FYEA 2YJ9A 2DCCA 5F02A 2AU1A 1ME3A 1CQDA 4N8WA 3ERVA 3KFQA 4OEMA 1U9WA 2DZZA 2OP3A 1VJVA 4CDDB 5EF4A 2DC7A 1AECA 2IBIA 3CBJA 3MTNA 1PPDA 3M99A 4YYWA 3BPFA 5CVNB 1EWMA 2YJCA 3OVXA 3LFYA 2BDZA 1EF7A 2CIOA 2E00A 2HXZA 1MS6A 1CTEA 1ATKA 4G54A 1YK7A 3QSDA 4W4UA 3BWKA 4W5BA 4MZOA 3BCNA 2PREA 1F29A 3P5WA 5CHVA 3QJ3A 1GCBA 3LXSA 3PBHA 2G8JA 4DMXA 1JQPA 2R9MA 2HHNA 4FIPA 1MEMA 2VHSA 1ICFA 1PPPA 1AU0A 1TL9A 3H8CA 2E02A 3H7DA 1IWDA 4ZUXU 4YYUA 2C0YA 1HUCB 4Q8HA 2R6NA 4PP1A 2PNSA 2OULA 3OVZA 2CB5A 1F2AA 3CBKA 1TLOA 3CH3X 3RVXA 3WXFA 1U9XA 2AIMA 1PIPA 1FH0A 2B1NA 2XU3A 2DCAA 5CVOB 2E01A 4P6EA 2ATOA 1PXVA 2AVWA 1DF0A 3P5UA 1NL6A 2B1MA 2R9NA 1STFE 1PCIA 1CV8A 4AXMA 4DMYA 1EWLA 1KHQA 1CSBB 3KX1A 3ZUAA 3PW3A 3BPMA 4KLBA 3DF0A 2G6DA 3OF8A 2AS8A 2DJFB 3H6SA 4YYQA 5K16A 2IPPB 4OELA 1SP4B 2JQGR 3HHIA 1Q6KA 2NQGA 2AYOA 3IUTA 1KFXL 2Y5BA 1NB5A 2P86A 2R9FA 4N79A 1KXRA 1CJLA 1Y4HA 2DCDA 1AU4A 2G8EA 4QBBA 3F75A 1YVBA 1CPJA 1U9QX 2DC6A 1CS8A 3BC3A 3U8EA 2ACTA 4X6HA 3GCBA 2Y6EA 3H89A 4QRXA 2FRAA 2XU5A 4FJCA 1EWOA 5J94A 4RY2A 1DEUA 4I05A 1VSNA 2VHFA 3N3KA 1MDWA 3MORA 3PNRA 1PPNA 3AI8A 1Y08A 4CZWA 4K7CA 3N3GA 3V6CA 1YT7A 3H8BA 3O1GA 1NB3A 2XU4A 1S4VA 1ME4A 2G7YA 4QRGA 5CHTA 2DC9A 1THEA 3IMAA 2E03A 1AU2A 1AYVA 2DZYA 3OF9A 1A6RA 3KWBX 2JQFR 2PBHA 4PADA 1BQIA 2O6XA 2H7JA 2PADA 4YYRA 4CDFB 2FUDA 1GECE 5EGWA 3IOQA 1CB5A 6PADA 1GLOA 1TU6A 2YJBA 1AIMA 1PADA 4Q8GA 2NQAA 1AU3A 4BSQA 3BOWA 8PCHA 3WXEA 4FK5A 4BS5A 1BY8A 2HD5A 4BQVA 3E1ZB 3P5XA 3QT4A 3V6EA 3IHPA 3HD3A 2FO5A 3KKUA 3NHEA 1NPZA 3C9EA 1MHWA 2AUZA 3PDFA 2ARYA 3KWZA 2FT2A 2NQIA 3KW9A 2F7DA 3IV2A 2R9OA 2BDLA 1QDQA 3S3RA 4XR7A 4YYVA 3USVA 1NLJA 1CVZA 1SNKA 2GFOA 2AYNA 3O0UA 4I04A 2DC8A 3RVWA 1PBHA 1YALA 4MSXA 2FQ9A 2XU1A 3HHAA 1BP4A 4XUIA 1KHPA 2DJGB 5CVMA 2R9CA 1AYUA 1MEGA 3MHSA 3D6SA 4YVAA 1M6DA 4QRVA 4W5CA 3P5VA 2OZ2A 1YK8A 4QH6A 4MZSA 1QMYA 2FTDA 1GMYA 3I3TA 4WA6A 1KFUL 1ITOA 1X9YA 2YJ8A 3K24A 4N4ZA 1F2BA 2P7UA 4HWYA 3N4CA 2F1GA 3I06A 4YYSA 2FRQA 1AYWA 4PP2E 1BGOA 1U5IA 4CDEB 1F2CA 4X6IA 3S3QA 4YV8A 1U9VA 4P6GA 1K3BB 1EWPA 1ZCMA 1PE6A 1QXPA 1POPA 3HWNA 3CH2X 3IEJA 3MHHA 3K9MA 3F5VA 3K8UA 1O0EA 4CDCB
chains in the Genus database with same CATH superfamily
5A24A 1MIRA 5PADA 3KSEA 1QOLA 2NQDB 3TRKA 3RVVA 5JH3A 1ZIVA 5FPWA 1XKGA 2HH5A 4PI3A 2YJ2A 4AXLA 2GHUA 1PPOA 3B79A 4BPVA 3W30A 5JA7A 7PCKA 4D8IA 1UKFA 1NQCA 4X6JA 2WBFX 3WXGA 9PAPA 2DCBA 4BS6A 2P0RA 4I07A 3TNXA 3OISA 1YZBA 2AUXA 2FYEA 2YJ9A 2DCCA 5F02A 2AU1A 4A5UA 1ME3A 1CQDA 4N8WA 3ERVA 3KFQA 4OEMA 1U9WA 2DZZA 2OP3A 1VJVA 4M0WA 4CDDB 5EF4A 2DC7A 1AECA 2IBIA 3CBJA 4XZXA 3MTNA 1PPDA 2J7QC 3M99A 4YYWA 3BPFA 5CVNB 1EWMA 2YJCA 3OVXA 3LFYA 2BDZA 3BBAA 1EF7A 3ZNHA 5KO3A 2CIOA 2E00A 2HXZA 1MS6A 4R3DA 1CTEA 1ATKA 4G54A 4BOSA 1YK7A 3QSDA 4W4UA 3BWKA 4W5BA 4MZOA 3BCNA 4RF0A 2PREA 1F29A 3P5WA 5CHVA 3QJ3A 1GCBA 4MI7A 3LXSA 3PBHA 2G8JA 4DMXA 2AGAA 1JQPA 2R9MA 2HHNA 4FIPA 1MEMA 2VHSA 1ICFA 1PPPA 1AU0A 1TL9A 3H8CA 4IP3A 2E02A 3H7DA 3PHXA 1IWDA 4ZUXU 4YYUA 2C0YA 4ZTBA 1HUCB 4Q8HA 2R6NA 4PP1A 2PNSA 2OULA 3OVZA 2CB5A 1F2AA 3CBKA 3PRMA 1TLOA 3CH3X 3RVXA 3WXFA 1U9XA 2AIMA 1PIPA 1FH0A 2B1NA 2XU3A 2FE8A 3BB7A 2DCAA 5CVOB 2E01A 4P6EA 2ATOA 2JRIA 1PXVA 2AVWA 1DF0A 3P5UA 1NL6A 2B1MA 2R9NA 1STFE 1PCIA 1CV8A 4AXMA 4DMYA 1EWLA 1KHQA 1CSBB 3KX1A 3O65A 3ZUAA 3PW3A 3PHWA 3BPMA 4KLBA 3DF0A 2G6DA 3OF8A 2UZJA 2AS8A 2DJFB 3H6SA 4YYQA 5K16A 2IPPB 4OELA 4HXDB 1SP4B 5JZEA 2JQGR 3HHIA 1Q6KA 2NQGA 2AYOA 4MM3B 3IUTA 1KFXL 2Y5BA 1NB5A 2P86A 2R9FA 1KXRA 1CJLA 1Y4HA 4N79A 2DCDA 3IFUA 1AU4A 2G8EA 4QBBA 3F75A 1YVBA 1CPJA 1U9QX 2DC6A 1CS8A 3BC3A 1DKIA 3U8EA 2ACTA 4X6HA 4RNAA 3GCBA 2Y6EA 3H89A 4QRXA 2FRAA 2XU5A 4FJCA 1EWOA 5J94A 4RY2A 1DEUA 4I05A 3PRPA 1VSNA 2BU3A 2BTWA 2VHFA 3N3KA 1MDWA 3MORA 3PNRA 1PPNA 3AI8A 1Y08A 4CZWA 4K7CA 3N3GA 3V6CA 1YT7A 3H8BA 3O1GA 4BOQA 3W31A 1NB3A 2XU4A 1S4VA 5EZSA 1ME4A 2G7YA 4QRGA 5CHTA 2DC9A 1THEA 3IMAA 2E03A 1AU2A 1AYVA 2DZYA 3OF9A 1A6RA 3KWBX 2JQFR 2PBHA 4PADA 1BQIA 2O6XA 4OVZA 2H7JA 2PADA 4YYRA 4CDFB 2FUDA 1GECE 5EGWA 3IOQA 4D8BA 1CB5A 6PADA 1GLOA 1TU6A 2YJBA 1AIMA 1PADA 4Q8GA 4IUMA 2NQAA 1AU3A 4BSQA 3BOWA 8PCHA 3WXEA 4FK5A 4BS5A 1BY8A 2HD5A 4BQVA 3PHUA 3E1ZB 3P5XA 2DOSA 3QT4A 3V6EA 3IHPA 3HD3A 4RKXA 2FO5A 3KKUA 3PSEA 3NHEA 1NPZA 3C9EA 4PT5A 1MHWA 2AUZA 3PDFA 2ARYA 4WURA 4BOZA 3KWZA 2FT2A 3MP2A 2NQIA 3KW9A 2F7DA 3IV2A 1PVJA 2R9OA 2BDLA 1QDQA 3S3RA 4XR7A 4YYVA 3USVA 1NLJA 2JTCA 3OQCA 3E9SA 3B21A 1CVZA 1SNKA 2GFOA 2AYNA 3O0UA 4I04A 2DC8A 3RNVA 1PBHA 3RVWA 3C0RA 1YALA 4MSXA 2FQ9A 2XU1A 3HHAA 1BP4A 4XUIA 1KHPA 2DJGB 4OW0A 5CVMA 2R9CA 4P16A 1AYUA 3MJ5A 1MEGA 2Z84A 3MHSA 3D6SA 4YVAA 4RF1A 1M6DA 2J7QA 4QRVA 4W5CA 2BTWB 3P5VA 2OZ2A 1YK8A 4QH6A 4MZSA 1QMYA 2FTDA 1GMYA 3I3TA 5EZQA 4REZA 2HWKA 4GUAA 4WA6A 1KFUL 1ITOA 4D8EA 1X9YA 2YJ8A 3K24A 4N4ZA 1F2BA 2P7UA 5E6JA 4BOUA 4HWYA 3N4CA 3MTVA 4OVZB 2F1GA 3I06A 3BY4A 4YYSA 2FRQA 1AYWA 4PP2E 1BGOA 1U5IA 4CDEB 1F2CA 4X6IA 3S3QA 4YV8A 1U9VA 4P6GA 1K3BB 1EWPA 1ZCMA 1PE6A 1QXPA 4BOPA 1POPA 3HWNA 3TMPA 3CH2X 3IEJA 3MHHA 3K9MA 3F5VA 3K8UA 1O0EA 3PT2A 4CDCB
chains in the Genus database with same CATH topology
5A24A 1MIRA 2BSZA 5PADA 3KSEA 1QOLA 2NQDB 3RVVA 5JH3A 1ZIVA 5FPWA 1XKGA 2HH5A 4PI3A 2YJ2A 4AXLA 2GHUA 1PPOA 3B79A 4BPVA 5JA7A 7PCKA 1NQCA 4X6JA 2WBFX 3WXGA 9PAPA 2DCBA 4BS6A 2P0RA 4NV8A 4I07A 3TNXA 3OISA 2AUXA 2FYEA 2YJ9A 2DCCA 5F02A 2AU1A 1ME3A 1CQDA 4N8WA 3ERVA 3KFQA 4OEMA 1U9WA 2DZZA 2OP3A 1VJVA 4CDDB 5EF4A 2DC7A 1AECA 2IBIA 3CBJA 3MTNA 2VFCA 1PPDA 3M99A 4YYWA 3BPFA 5CVNB 1EWMA 2YJCA 3OVXA 3LFYA 2BDZA 1EF7A 2CIOA 2E00A 2HXZA 1MS6A 2VFBA 1CTEA 1ATKA 4G54A 1W5RA 1YK7A 3QSDA 4W4UA 3BWKA 4W5BA 4MZOA 3BCNA 2PREA 1F29A 3P5WA 5CHVA 3QJ3A 1GCBA 3LXSA 3PBHA 2G8JA 4DMXA 1JQPA 2R9MA 2HHNA 4FIPA 1MEMA 2VHSA 1ICFA 1PPPA 1AU0A 1TL9A 1W6FA 3H8CA 2E02A 3H7DA 1IWDA 4ZUXU 4YYUA 2C0YA 1W4TA 1HUCB 4Q8HA 2R6NA 4PP1A 2PNSA 2OULA 3OVZA 2CB5A 1F2AA 3CBKA 1TLOA 3CH3X 3RVXA 3WXFA 1U9XA 2AIMA 1PIPA 1FH0A 2B1NA 2XU3A 2DCAA 5CVOB 2E01A 4P6EA 2ATOA 1PXVA 2AVWA 1DF0A 3P5UA 1NL6A 2B1MA 2R9NA 1STFE 4C5PA 1PCIA 1CV8A 4AXMA 4DMYA 1EWLA 1KHQA 1CSBB 3KX1A 3ZUAA 3PW3A 3BPMA 4KLBA 3DF0A 2G6DA 3OF8A 2AS8A 2DJFB 3H6SA 4YYQA 5K16A 2IPPB 4OELA 1SP4B 2JQGR 3HHIA 1Q6KA 2NQGA 2AYOA 3IUTA 1KFXL 2Y5BA 1NB5A 2P86A 2R9FA 4N79A 1KXRA 1CJLA 1Y4HA 2DCDA 1AU4A 2G8EA 1E2TA 3F75A 4QBBA 1YVBA 1CPJA 1U9QX 2DC6A 1CS8A 3BC3A 3U8EA 2ACTA 4X6HA 3GCBA 2Y6EA 3H89A 4QRXA 4BGFA 2FRAA 2XU5A 4FJCA 1EWOA 5J94A 4RY2A 1DEUA 4I05A 1VSNA 2VHFA 3N3KA 1MDWA 3MORA 3PNRA 1PPNA 3AI8A 1Y08A 4NV7A 4CZWA 4K7CA 3N3GA 3V6CA 1YT7A 3H8BA 3O1GA 1NB3A 2XU4A 1S4VA 1ME4A 2G7YA 4QRGA 5CHTA 2DC9A 1THEA 3IMAA 2E03A 1AU2A 1AYVA 2DZYA 3OF9A 1A6RA 3KWBX 2JQFR 2PBHA 3D9WA 4PADA 1BQIA 2O6XA 2H7JA 2PADA 4YYRA 4CDFB 2FUDA 1GECE 5EGWA 3IOQA 1CB5A 6PADA 1GLOA 1TU6A 2YJBA 1AIMA 1PADA 4Q8GA 2NQAA 1AU3A 4B55A 4BSQA 3BOWA 8PCHA 3WXEA 4FK5A 4BS5A 1BY8A 2HD5A 4BQVA 3E1ZB 3P5XA 3QT4A 3V6EA 1GX3A 3IHPA 3HD3A 3LTWA 2FO5A 3KKUA 3NHEA 1NPZA 3C9EA 1MHWA 2AUZA 3PDFA 2ARYA 3KWZA 2FT2A 2NQIA 3KW9A 2F7DA 3IV2A 2R9OA 2BDLA 1QDQA 3S3RA 4XR7A 4YYVA 3USVA 1NLJA 1CVZA 1SNKA 2GFOA 2AYNA 3O0UA 4I04A 2DC8A 3RVWA 1PBHA 4GUZA 1YALA 4MSXA 2FQ9A 2XU1A 3HHAA 1BP4A 4XUIA 1KHPA 2DJGB 5CVMA 2R9CA 1AYUA 1MEGA 3MHSA 3D6SA 4YVAA 1M6DA 4QRVA 4W5CA 3P5VA 2OZ2A 1YK8A 4QH6A 4MZSA 1QMYA 2FTDA 1GMYA 3I3TA 4WA6A 1KFUL 1ITOA 1X9YA 2YJ8A 3K24A 4N4ZA 1F2BA 2P7UA 4HWYA 3N4CA 2F1GA 3I06A 4YYSA 2FRQA 1AYWA 4PP2E 1BGOA 1U5IA 4CDEB 1F2CA 4X6IA 3S3QA 4YV8A 1U9VA 4P6GA 1K3BB 1EWPA 1ZCMA 1PE6A 1QXPA 1POPA 3HWNA 3CH2X 3IEJA 3MHHA 3K9MA 3F5VA 3K8UA 1O0EA 4CDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A24 A;  1MIR A;  5PAD A;  3KSE A;  1QOL A;  2NQD B;  3RVV A;  5JH3 A;  1ZIV A;  5FPW A;  1XKG A;  2HH5 A;  4PI3 A;  2YJ2 A;  4AXL A;  2GHU A;  1PPO A;  3B79 A;  4BPV A;  5JA7 A;  7PCK A;  1NQC A;  4X6J A;  2WBF X;  3WXG A;  9PAP A;  2DCB A;  4BS6 A;  2P0R A;  4I07 A;  3TNX A;  3OIS A;  2AUX A;  2FYE A;  2YJ9 A;  2DCC A;  5F02 A;  2AU1 A;  1ME3 A;  1CQD A;  4N8W A;  3ERV A;  3KFQ A;  4OEM A;  1U9W A;  2DZZ A;  2OP3 A;  1VJV A;  4CDD B;  5EF4 A;  2DC7 A;  1AEC A;  2IBI A;  3CBJ A;  3MTN A;  1PPD A;  3M99 A;  4YYW A;  3BPF A;  5CVN B;  1EWM A;  2YJC A;  3OVX A;  3LFY A;  2BDZ A;  1EF7 A;  2CIO A;  2E00 A;  2HXZ A;  1MS6 A;  1CTE A;  1ATK A;  4G54 A;  1YK7 A;  3QSD A;  4W4U A;  3BWK A;  4W5B A;  4MZO A;  3BCN A;  2PRE A;  1F29 A;  3P5W A;  5CHV A;  3QJ3 A;  1GCB A;  3LXS A;  3PBH A;  2G8J A;  4DMX A;  1JQP A;  2R9M A;  2HHN A;  4FIP A;  1MEM A;  2VHS A;  1ICF A;  1PPP A;  1AU0 A;  1TL9 A;  3H8C A;  2E02 A;  3H7D A;  1IWD A;  4ZUX U;  4YYU A;  2C0Y A;  1HUC B;  4Q8H A;  2R6N A;  4PP1 A;  2PNS A;  2OUL A;  3OVZ A;  2CB5 A;  1F2A A;  3CBK A;  1TLO A;  3CH3 X;  3RVX A;  3WXF A;  1U9X A;  2AIM A;  1PIP A;  1FH0 A;  2B1N A;  2XU3 A;  2DCA A;  5CVO B;  2E01 A;  4P6E A;  2ATO A;  1PXV A;  2AVW A;  1DF0 A;  3P5U A;  1NL6 A;  2B1M A;  2R9N A;  1STF E;  1PCI A;  1CV8 A;  4AXM A;  4DMY A;  1EWL A;  1KHQ A;  1CSB B;  3KX1 A;  3ZUA A;  3PW3 A;  3BPM A;  4KLB A;  3DF0 A;  2G6D A;  3OF8 A;  2AS8 A;  2DJF B;  3H6S A;  4YYQ A;  5K16 A;  2IPP B;  4OEL A;  1SP4 B;  2JQG R;  3HHI A;  1Q6K A;  2NQG A;  2AYO A;  3IUT A;  1KFX L;  2Y5B A;  1NB5 A;  2P86 A;  2R9F A;  4N79 A;  1KXR A;  1CJL A;  1Y4H A;  2DCD A;  1AU4 A;  2G8E A;  4QBB A;  3F75 A;  1YVB A;  1CPJ A;  1U9Q X;  2DC6 A;  1CS8 A;  3BC3 A;  3U8E A;  2ACT A;  4X6H A;  3GCB A;  2Y6E A;  3H89 A;  4QRX A;  2FRA A;  2XU5 A;  4FJC A;  1EWO A;  5J94 A;  4RY2 A;  1DEU A;  4I05 A;  1VSN A;  2VHF A;  3N3K A;  1MDW A;  3MOR A;  3PNR A;  1PPN A;  3AI8 A;  1Y08 A;  4CZW A;  4K7C A;  3N3G A;  3V6C A;  1YT7 A;  3H8B A;  3O1G A;  1NB3 A;  2XU4 A;  1S4V A;  1ME4 A;  2G7Y A;  4QRG A;  5CHT A;  2DC9 A;  1THE A;  3IMA A;  2E03 A;  1AU2 A;  1AYV A;  2DZY A;  3OF9 A;  1A6R A;  3KWB X;  2JQF R;  2PBH A;  4PAD A;  1BQI A;  2O6X A;  2H7J A;  2PAD A;  4YYR A;  4CDF B;  2FUD A;  1GEC E;  5EGW A;  3IOQ A;  1CB5 A;  6PAD A;  1GLO A;  1TU6 A;  2YJB A;  1AIM A;  1PAD A;  4Q8G A;  2NQA A;  1AU3 A;  4BSQ A;  3BOW A;  8PCH A;  3WXE A;  4FK5 A;  4BS5 A;  1BY8 A;  2HD5 A;  4BQV A;  3E1Z B;  3P5X A;  3QT4 A;  3V6E A;  3IHP A;  3HD3 A;  2FO5 A;  3KKU A;  3NHE A;  1NPZ A;  3C9E A;  1MHW A;  2AUZ A;  3PDF A;  2ARY A;  3KWZ A;  2FT2 A;  2NQI A;  3KW9 A;  2F7D A;  3IV2 A;  2R9O A;  2BDL A;  1QDQ A;  3S3R A;  4XR7 A;  4YYV A;  3USV A;  1NLJ A;  1CVZ A;  1SNK A;  2GFO A;  2AYN A;  3O0U A;  4I04 A;  2DC8 A;  3RVW A;  1PBH A;  1YAL A;  4MSX A;  2FQ9 A;  2XU1 A;  3HHA A;  1BP4 A;  4XUI A;  1KHP A;  2DJG B;  5CVM A;  2R9C A;  1AYU A;  1MEG A;  3MHS A;  3D6S A;  4YVA A;  1M6D A;  4QRV A;  4W5C A;  3P5V A;  2OZ2 A;  1YK8 A;  4QH6 A;  4MZS A;  1QMY A;  2FTD A;  1GMY A;  3I3T A;  4WA6 A;  1KFU L;  1ITO A;  1X9Y A;  2YJ8 A;  3K24 A;  4N4Z A;  1F2B A;  2P7U A;  4HWY A;  3N4C A;  2F1G A;  3I06 A;  4YYS A;  2FRQ A;  1AYW A;  4PP2 E;  1BGO A;  1U5I A;  4CDE B;  1F2C A;  4X6I A;  3S3Q A;  4YV8 A;  1U9V A;  4P6G A;  1K3B B;  1EWP A;  1ZCM A;  1PE6 A;  1QXP A;  1POP A;  3HWN A;  3CH2 X;  3IEJ A;  3MHH A;  3K9M A;  3F5V A;  3K8U A;  1O0E A;  4CDC B; 
#chains in the Genus database with same CATH topology
 5A24 A;  1MIR A;  5PAD A;  3KSE A;  1QOL A;  2NQD B;  3TRK A;  3RVV A;  5JH3 A;  1ZIV A;  5FPW A;  1XKG A;  2HH5 A;  4PI3 A;  2YJ2 A;  4AXL A;  2GHU A;  1PPO A;  3B79 A;  4BPV A;  3W30 A;  5JA7 A;  7PCK A;  4D8I A;  1UKF A;  1NQC A;  4X6J A;  2WBF X;  3WXG A;  9PAP A;  2DCB A;  4BS6 A;  2P0R A;  4I07 A;  3TNX A;  3OIS A;  1YZB A;  2AUX A;  2FYE A;  2YJ9 A;  2DCC A;  5F02 A;  2AU1 A;  4A5U A;  1ME3 A;  1CQD A;  4N8W A;  3ERV A;  3KFQ A;  4OEM A;  1U9W A;  2DZZ A;  2OP3 A;  1VJV A;  4M0W A;  4CDD B;  5EF4 A;  2DC7 A;  1AEC A;  2IBI A;  3CBJ A;  4XZX A;  3MTN A;  1PPD A;  2J7Q C;  3M99 A;  4YYW A;  3BPF A;  5CVN B;  1EWM A;  2YJC A;  3OVX A;  3LFY A;  2BDZ A;  3BBA A;  1EF7 A;  3ZNH A;  5KO3 A;  2CIO A;  2E00 A;  2HXZ A;  1MS6 A;  4R3D A;  1CTE A;  1ATK A;  4G54 A;  4BOS A;  1YK7 A;  3QSD A;  4W4U A;  3BWK A;  4W5B A;  4MZO A;  3BCN A;  4RF0 A;  2PRE A;  1F29 A;  3P5W A;  5CHV A;  3QJ3 A;  1GCB A;  4MI7 A;  3LXS A;  3PBH A;  2G8J A;  4DMX A;  2AGA A;  1JQP A;  2R9M A;  2HHN A;  4FIP A;  1MEM A;  2VHS A;  1ICF A;  1PPP A;  1AU0 A;  1TL9 A;  3H8C A;  4IP3 A;  2E02 A;  3H7D A;  3PHX A;  1IWD A;  4ZUX U;  4YYU A;  2C0Y A;  4ZTB A;  1HUC B;  4Q8H A;  2R6N A;  4PP1 A;  2PNS A;  2OUL A;  3OVZ A;  2CB5 A;  1F2A A;  3CBK A;  3PRM A;  1TLO A;  3CH3 X;  3RVX A;  3WXF A;  1U9X A;  2AIM A;  1PIP A;  1FH0 A;  2B1N A;  2XU3 A;  2FE8 A;  3BB7 A;  2DCA A;  5CVO B;  2E01 A;  4P6E A;  2ATO A;  2JRI A;  1PXV A;  2AVW A;  1DF0 A;  3P5U A;  1NL6 A;  2B1M A;  2R9N A;  1STF E;  1PCI A;  1CV8 A;  4AXM A;  4DMY A;  1EWL A;  1KHQ A;  1CSB B;  3KX1 A;  3O65 A;  3ZUA A;  3PW3 A;  3PHW A;  3BPM A;  4KLB A;  3DF0 A;  2G6D A;  3OF8 A;  2UZJ A;  2AS8 A;  2DJF B;  3H6S A;  4YYQ A;  5K16 A;  2IPP B;  4OEL A;  4HXD B;  1SP4 B;  5JZE A;  2JQG R;  3HHI A;  1Q6K A;  2NQG A;  2AYO A;  4MM3 B;  3IUT A;  1KFX L;  2Y5B A;  1NB5 A;  2P86 A;  2R9F A;  1KXR A;  1CJL A;  1Y4H A;  4N79 A;  2DCD A;  3IFU A;  1AU4 A;  2G8E A;  4QBB A;  3F75 A;  1YVB A;  1CPJ A;  1U9Q X;  2DC6 A;  1CS8 A;  3BC3 A;  1DKI A;  3U8E A;  2ACT A;  4X6H A;  4RNA A;  3GCB A;  2Y6E A;  3H89 A;  4QRX A;  2FRA A;  2XU5 A;  4FJC A;  1EWO A;  5J94 A;  4RY2 A;  1DEU A;  4I05 A;  3PRP A;  1VSN A;  2BU3 A;  2BTW A;  2VHF A;  3N3K A;  1MDW A;  3MOR A;  3PNR A;  1PPN A;  3AI8 A;  1Y08 A;  4CZW A;  4K7C A;  3N3G A;  3V6C A;  1YT7 A;  3H8B A;  3O1G A;  4BOQ A;  3W31 A;  1NB3 A;  2XU4 A;  1S4V A;  5EZS A;  1ME4 A;  2G7Y A;  4QRG A;  5CHT A;  2DC9 A;  1THE A;  3IMA A;  2E03 A;  1AU2 A;  1AYV A;  2DZY A;  3OF9 A;  1A6R A;  3KWB X;  2JQF R;  2PBH A;  4PAD A;  1BQI A;  2O6X A;  4OVZ A;  2H7J A;  2PAD A;  4YYR A;  4CDF B;  2FUD A;  1GEC E;  5EGW A;  3IOQ A;  4D8B A;  1CB5 A;  6PAD A;  1GLO A;  1TU6 A;  2YJB A;  1AIM A;  1PAD A;  4Q8G A;  4IUM A;  2NQA A;  1AU3 A;  4BSQ A;  3BOW A;  8PCH A;  3WXE A;  4FK5 A;  4BS5 A;  1BY8 A;  2HD5 A;  4BQV A;  3PHU A;  3E1Z B;  3P5X A;  2DOS A;  3QT4 A;  3V6E A;  3IHP A;  3HD3 A;  4RKX A;  2FO5 A;  3KKU A;  3PSE A;  3NHE A;  1NPZ A;  3C9E A;  4PT5 A;  1MHW A;  2AUZ A;  3PDF A;  2ARY A;  4WUR A;  4BOZ A;  3KWZ A;  2FT2 A;  3MP2 A;  2NQI A;  3KW9 A;  2F7D A;  3IV2 A;  1PVJ A;  2R9O A;  2BDL A;  1QDQ A;  3S3R A;  4XR7 A;  4YYV A;  3USV A;  1NLJ A;  2JTC A;  3OQC A;  3E9S A;  3B21 A;  1CVZ A;  1SNK A;  2GFO A;  2AYN A;  3O0U A;  4I04 A;  2DC8 A;  3RNV A;  1PBH A;  3RVW A;  3C0R A;  1YAL A;  4MSX A;  2FQ9 A;  2XU1 A;  3HHA A;  1BP4 A;  4XUI A;  1KHP A;  2DJG B;  4OW0 A;  5CVM A;  2R9C A;  4P16 A;  1AYU A;  3MJ5 A;  1MEG A;  2Z84 A;  3MHS A;  3D6S A;  4YVA A;  4RF1 A;  1M6D A;  2J7Q A;  4QRV A;  4W5C A;  2BTW B;  3P5V A;  2OZ2 A;  1YK8 A;  4QH6 A;  4MZS A;  1QMY A;  2FTD A;  1GMY A;  3I3T A;  5EZQ A;  4REZ A;  2HWK A;  4GUA A;  4WA6 A;  1KFU L;  1ITO A;  4D8E A;  1X9Y A;  2YJ8 A;  3K24 A;  4N4Z A;  1F2B A;  2P7U A;  5E6J A;  4BOU A;  4HWY A;  3N4C A;  3MTV A;  4OVZ B;  2F1G A;  3I06 A;  3BY4 A;  4YYS A;  2FRQ A;  1AYW A;  4PP2 E;  1BGO A;  1U5I A;  4CDE B;  1F2C A;  4X6I A;  3S3Q A;  4YV8 A;  1U9V A;  4P6G A;  1K3B B;  1EWP A;  1ZCM A;  1PE6 A;  1QXP A;  4BOP A;  1POP A;  3HWN A;  3TMP A;  3CH2 X;  3IEJ A;  3MHH A;  3K9M A;  3F5V A;  3K8U A;  1O0E A;  3PT2 A;  4CDC B; 
#chains in the Genus database with same CATH homology
 5A24 A;  1MIR A;  2BSZ A;  5PAD A;  3KSE A;  1QOL A;  2NQD B;  3RVV A;  5JH3 A;  1ZIV A;  5FPW A;  1XKG A;  2HH5 A;  4PI3 A;  2YJ2 A;  4AXL A;  2GHU A;  1PPO A;  3B79 A;  4BPV A;  5JA7 A;  7PCK A;  1NQC A;  4X6J A;  2WBF X;  3WXG A;  9PAP A;  2DCB A;  4BS6 A;  2P0R A;  4NV8 A;  4I07 A;  3TNX A;  3OIS A;  2AUX A;  2FYE A;  2YJ9 A;  2DCC A;  5F02 A;  2AU1 A;  1ME3 A;  1CQD A;  4N8W A;  3ERV A;  3KFQ A;  4OEM A;  1U9W A;  2DZZ A;  2OP3 A;  1VJV A;  4CDD B;  5EF4 A;  2DC7 A;  1AEC A;  2IBI A;  3CBJ A;  3MTN A;  2VFC A;  1PPD A;  3M99 A;  4YYW A;  3BPF A;  5CVN B;  1EWM A;  2YJC A;  3OVX A;  3LFY A;  2BDZ A;  1EF7 A;  2CIO A;  2E00 A;  2HXZ A;  1MS6 A;  2VFB A;  1CTE A;  1ATK A;  4G54 A;  1W5R A;  1YK7 A;  3QSD A;  4W4U A;  3BWK A;  4W5B A;  4MZO A;  3BCN A;  2PRE A;  1F29 A;  3P5W A;  5CHV A;  3QJ3 A;  1GCB A;  3LXS A;  3PBH A;  2G8J A;  4DMX A;  1JQP A;  2R9M A;  2HHN A;  4FIP A;  1MEM A;  2VHS A;  1ICF A;  1PPP A;  1AU0 A;  1TL9 A;  1W6F A;  3H8C A;  2E02 A;  3H7D A;  1IWD A;  4ZUX U;  4YYU A;  2C0Y A;  1W4T A;  1HUC B;  4Q8H A;  2R6N A;  4PP1 A;  2PNS A;  2OUL A;  3OVZ A;  2CB5 A;  1F2A A;  3CBK A;  1TLO A;  3CH3 X;  3RVX A;  3WXF A;  1U9X A;  2AIM A;  1PIP A;  1FH0 A;  2B1N A;  2XU3 A;  2DCA A;  5CVO B;  2E01 A;  4P6E A;  2ATO A;  1PXV A;  2AVW A;  1DF0 A;  3P5U A;  1NL6 A;  2B1M A;  2R9N A;  1STF E;  4C5P A;  1PCI A;  1CV8 A;  4AXM A;  4DMY A;  1EWL A;  1KHQ A;  1CSB B;  3KX1 A;  3ZUA A;  3PW3 A;  3BPM A;  4KLB A;  3DF0 A;  2G6D A;  3OF8 A;  2AS8 A;  2DJF B;  3H6S A;  4YYQ A;  5K16 A;  2IPP B;  4OEL A;  1SP4 B;  2JQG R;  3HHI A;  1Q6K A;  2NQG A;  2AYO A;  3IUT A;  1KFX L;  2Y5B A;  1NB5 A;  2P86 A;  2R9F A;  4N79 A;  1KXR A;  1CJL A;  1Y4H A;  2DCD A;  1AU4 A;  2G8E A;  1E2T A;  3F75 A;  4QBB A;  1YVB A;  1CPJ A;  1U9Q X;  2DC6 A;  1CS8 A;  3BC3 A;  3U8E A;  2ACT A;  4X6H A;  3GCB A;  2Y6E A;  3H89 A;  4QRX A;  4BGF A;  2FRA A;  2XU5 A;  4FJC A;  1EWO A;  5J94 A;  4RY2 A;  1DEU A;  4I05 A;  1VSN A;  2VHF A;  3N3K A;  1MDW A;  3MOR A;  3PNR A;  1PPN A;  3AI8 A;  1Y08 A;  4NV7 A;  4CZW A;  4K7C A;  3N3G A;  3V6C A;  1YT7 A;  3H8B A;  3O1G A;  1NB3 A;  2XU4 A;  1S4V A;  1ME4 A;  2G7Y A;  4QRG A;  5CHT A;  2DC9 A;  1THE A;  3IMA A;  2E03 A;  1AU2 A;  1AYV A;  2DZY A;  3OF9 A;  1A6R A;  3KWB X;  2JQF R;  2PBH A;  3D9W A;  4PAD A;  1BQI A;  2O6X A;  2H7J A;  2PAD A;  4YYR A;  4CDF B;  2FUD A;  1GEC E;  5EGW A;  3IOQ A;  1CB5 A;  6PAD A;  1GLO A;  1TU6 A;  2YJB A;  1AIM A;  1PAD A;  4Q8G A;  2NQA A;  1AU3 A;  4B55 A;  4BSQ A;  3BOW A;  8PCH A;  3WXE A;  4FK5 A;  4BS5 A;  1BY8 A;  2HD5 A;  4BQV A;  3E1Z B;  3P5X A;  3QT4 A;  3V6E A;  1GX3 A;  3IHP A;  3HD3 A;  3LTW A;  2FO5 A;  3KKU A;  3NHE A;  1NPZ A;  3C9E A;  1MHW A;  2AUZ A;  3PDF A;  2ARY A;  3KWZ A;  2FT2 A;  2NQI A;  3KW9 A;  2F7D A;  3IV2 A;  2R9O A;  2BDL A;  1QDQ A;  3S3R A;  4XR7 A;  4YYV A;  3USV A;  1NLJ A;  1CVZ A;  1SNK A;  2GFO A;  2AYN A;  3O0U A;  4I04 A;  2DC8 A;  3RVW A;  1PBH A;  4GUZ A;  1YAL A;  4MSX A;  2FQ9 A;  2XU1 A;  3HHA A;  1BP4 A;  4XUI A;  1KHP A;  2DJG B;  5CVM A;  2R9C A;  1AYU A;  1MEG A;  3MHS A;  3D6S A;  4YVA A;  1M6D A;  4QRV A;  4W5C A;  3P5V A;  2OZ2 A;  1YK8 A;  4QH6 A;  4MZS A;  1QMY A;  2FTD A;  1GMY A;  3I3T A;  4WA6 A;  1KFU L;  1ITO A;  1X9Y A;  2YJ8 A;  3K24 A;  4N4Z A;  1F2B A;  2P7U A;  4HWY A;  3N4C A;  2F1G A;  3I06 A;  4YYS A;  2FRQ A;  1AYW A;  4PP2 E;  1BGO A;  1U5I A;  4CDE B;  1F2C A;  4X6I A;  3S3Q A;  4YV8 A;  1U9V A;  4P6G A;  1K3B B;  1EWP A;  1ZCM A;  1PE6 A;  1QXP A;  1POP A;  3HWN A;  3CH2 X;  3IEJ A;  3MHH A;  3K9M A;  3F5V A;  3K8U A;  1O0E A;  4CDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...