3H89A

A combined crystallographic and molecular dynamics study of cathepsin-l retro-binding inhibitors(compound 4)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
220
structure length
215
Chain Sequence
b'APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L1
publication title A combined crystallographic and molecular dynamics study of cathepsin L retrobinding inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 215
sequence length 220
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h89A00
2E00A 1GLOA 2AUZA 1VJVA 3WXGA 2YJ8A 1NLJA 2G8JA 1CSBB 4W4UA 1XKGA 5JA7A 3C9EA 3MTNA 4ZUXU 1A6RA 3QT4A 5PADA 1EWPA 3KW9A 3IOQA 3N3GA 2FO5A 5CVMA 3K24A 3HWNA 4BS6A 1POPA 3AI8A 4K7CA 1YK7A 2FTDA 4N4ZA 4PP2E 3U8EA 3D6SA 2R9OA 2AS8A 1YALA 2R9MA 1BP4A 1SNKA 3KWZA 3CH3X 1PCIA 1U9VA 1STFE 3KWBX 2P7UA 4I05A 4X6HA 4FJCA 4QRVA 1Y08A 2FYEA 2E03A 1PPOA 1YT7A 1KFXL 1GCBA 1Q6KA 2E02A 5CVOB 2DJFB 3MHHA 4CZWA 4PP1A 4BPVA 2ATOA 3H7DA 3BPFA 1MEGA 1IWDA 2FT2A 3KFQA 4OEMA 1U9XA 2Y6EA 4HWYA 1CVZA 2HD5A 1PBHA 3BC3A 2R9NA 4W5CA 1MS6A 1M6DA 3O0UA 2PREA 2DC9A 3IV2A 3PNRA 4MZOA 4YYWA 2AUXA 1F2CA 1KHPA 4QH6A 2VHFA 2G8EA 4N8WA 2OP3A 3HHIA 1ATKA 4FK5A 1TLOA 2B1MA 2BDLA 3K9MA 1CQDA 2AIMA 4AXLA 2JQGR 1MDWA 3HHAA 3IMAA 1F2AA 2YJ2A 4YYSA 1CTEA 3OISA 3DF0A 3TNXA 1SP4B 2E01A 2DCDA 4G54A 1U9WA 4CDFB 1F29A 1ITOA 1PPDA 3WXEA 4YYVA 1AYUA 5JH3A 1ZCMA 2HXZA 2CIOA 1GECE 2PBHA 4Q8GA 3V6EA 1QMYA 1AIMA 3H8BA 1TU6A 4Q8HA 1PPNA 2P86A 4X6JA 1EF7A 3F75A 3MHSA 4XR7A 4YVAA 2NQAA 3OVXA 1MEMA 2DC6A 3F5VA 2CB5A 2AVWA 2YJ9A 1DF0A 3O1GA 4I04A 5K16A 4YYUA 1PADA 1CS8A 1MIRA 1DEUA 1EWLA 3S3RA 3ERVA 2OZ2A 4BSQA 2F1GA 2R9FA 3OF8A 3KSEA 4AXMA 2F7DA 1AYWA 4X6IA 4N79A 1ZIVA 3BCNA 2IBIA 2WBFX 3IUTA 1KXRA 3LFYA 4YYQA 2ARYA 4QRXA 4FIPA 3PW3A 4CDDB 2IPPB 1NPZA 2G6DA 4W5BA 1YK8A 1CPJA 1BGOA 1BQIA 1MHWA 4YV8A 2OULA 1AU2A 2AU1A 1PIPA 5A24A 8PCHA 1AU3A 3N4CA 1F2BA 5EGWA 2R6NA 3KX1A 1U5IA 5CVNB 1PXVA 1QOLA 3V6CA 4OELA 2XU5A 3BPMA 5J94A 4DMXA 3KKUA 1NB5A 1S4VA 1NQCA 3P5UA 1O0EA 2DCAA 2VHSA 3K8UA 3IEJA 4I07A 2G7YA 1K3BB 2DC7A 4DMYA 1ICFA 4XUIA 4MZSA 1ME3A 1KFUL 1QXPA 1EWOA 2H7JA 2JQFR 4PADA 3CBKA 1YVBA 1AU4A 1CV8A 3P5XA 2PADA 1PPPA 2DCCA 3BOWA 1NB3A 2AYNA 3MORA 4CDEB 2YJCA 2XU3A 4P6EA 7PCKA 4QBBA 3QJ3A 2XU4A 1PE6A 2GFOA 1FH0A 2Y5BA 3WXFA 2R9CA 2O6XA 3IHPA 1JQPA 3E1ZB 5EF4A 1THEA 2DCBA 9PAPA 1AU0A 3GCBA 1CJLA 2FRQA 3P5VA 2NQGA 4BS5A 3PDFA 5F02A 4KLBA 1CB5A 4RY2A 4PI3A 1GMYA 3OVZA 3ZUAA 4MSXA 1ME4A 2HH5A 1Y4HA 2BDZA 1X9YA 2GHUA 1BY8A 3HD3A 2DZZA 2P0RA 3RVVA 2FQ9A 2NQIA 1EWMA 2C0YA 1HUCB 3N3KA 5FPWA 4CDCB 2YJBA 1U9QX 2HHNA 3RVWA 3NHEA 1AYVA 3H8CA 5CHVA 1AECA 3I06A 3P5WA 6PADA 4QRGA 2B1NA 3CH2X 4BQVA 3B79A 1KHQA 4P6GA 4WA6A 2DC8A 2DZYA 3CBJA 2FUDA 3H6SA 5CHTA 3USVA 3S3QA 2XU1A 2AYOA 3PBHA 2DJGB 2PNSA 1TL9A 1QDQA 2FRAA 3H89A 3LXSA 3OF9A 2ACTA 3BWKA 1NL6A 3RVXA 3I3TA 4YYRA 2NQDB 3M99A 3QSDA 1VSNA
chains in the Genus database with same CATH superfamily
2E00A 1GLOA 2AUZA 1VJVA 3WXGA 2YJ8A 1NLJA 3RNVA 2G8JA 1CSBB 4W4UA 3PHXA 1XKGA 5JA7A 3C9EA 3MTNA 2JTCA 4ZUXU 1A6RA 3QT4A 5PADA 1EWPA 3KW9A 3IOQA 5KO3A 3N3GA 1YZBA 2FO5A 5CVMA 3K24A 3HWNA 4BS6A 1POPA 5E6JA 3AI8A 4K7CA 1YK7A 2FTDA 3O65A 4M0WA 4N4ZA 4PP2E 4BOQA 3U8EA 3D6SA 2R9OA 2AS8A 4BOZA 1YALA 2R9MA 1BP4A 1SNKA 3KWZA 3CH3X 1PCIA 1U9VA 2AGAA 1STFE 2UZJA 4P16A 3KWBX 2BTWA 2P7UA 2J7QC 4I05A 4X6HA 4FJCA 4QRVA 4R3DA 1Y08A 1UKFA 2FYEA 4PT5A 4OW0A 2E03A 1PPOA 1YT7A 1KFXL 1GCBA 1Q6KA 2E02A 5CVOB 2DJFB 3MHHA 4CZWA 4PP1A 4BPVA 2ATOA 3H7DA 3BPFA 1MEGA 1IWDA 3W30A 4D8IA 2FT2A 3KFQA 4OEMA 1U9XA 4D8BA 2Y6EA 2Z84A 4HWYA 1CVZA 2HD5A 1PBHA 3BC3A 2R9NA 4W5CA 1MS6A 1M6DA 3O0UA 2PREA 2DC9A 4ZTBA 3IV2A 3W31A 3PNRA 4MZOA 4YYWA 2AUXA 1F2CA 1KHPA 4QH6A 2VHFA 4RF0A 2G8EA 3BB7A 2OP3A 4N8WA 3HHIA 1DKIA 1ATKA 3BBAA 4FK5A 1TLOA 2B1MA 2BDLA 3K9MA 1CQDA 2AIMA 3PHUA 4AXLA 2JQGR 1MDWA 3HHAA 3IMAA 1F2AA 2YJ2A 4YYSA 1CTEA 3OISA 3DF0A 3TNXA 1SP4B 2FE8A 3BY4A 3MJ5A 2E01A 2DCDA 4G54A 1U9WA 4WURA 4CDFB 1F29A 1ITOA 4IP3A 1PPDA 3WXEA 4YYVA 1AYUA 5JH3A 5JZEA 1ZCMA 2HXZA 2CIOA 1GECE 2PBHA 4Q8GA 3V6EA 1QMYA 4BOPA 1AIMA 3H8BA 1TU6A 4Q8HA 1PPNA 2P86A 4X6JA 3MP2A 1EF7A 3F75A 3MHSA 4XR7A 4YVAA 4RF1A 2NQAA 3OVXA 1MEMA 2DC6A 3F5VA 2CB5A 2AVWA 2YJ9A 1DF0A 3O1GA 4I04A 5K16A 4YYUA 1PADA 1CS8A 1MIRA 1DEUA 1EWLA 3S3RA 3ERVA 4RKXA 2OZ2A 4BSQA 2F1GA 2R9FA 3OF8A 3KSEA 4AXMA 2F7DA 1AYWA 3TRKA 4X6IA 4BOUA 4N79A 1ZIVA 3BCNA 2IBIA 2WBFX 3IUTA 1KXRA 3LFYA 4YYQA 2ARYA 4QRXA 4FIPA 2DOSA 3PW3A 3MTVA 4CDDB 2IPPB 1NPZA 2G6DA 4W5BA 1YK8A 1CPJA 1BGOA 1BQIA 3PRMA 1MHWA 4YV8A 2OULA 1AU2A 2AU1A 1PIPA 5A24A 8PCHA 1AU3A 3N4CA 1F2BA 5EGWA 4MM3B 2R6NA 3KX1A 1U5IA 5CVNB 1PXVA 1QOLA 3V6CA 4OELA 2XU5A 3BPMA 5J94A 4DMXA 3KKUA 1NB5A 3PT2A 1S4VA 1NQCA 4BOSA 1PVJA 3P5UA 3OQCA 1O0EA 2DCAA 2VHSA 3K8UA 3IEJA 4I07A 2G7YA 1K3BB 2DC7A 4DMYA 1ICFA 4XUIA 3ZNHA 4MZSA 1ME3A 1KFUL 1QXPA 4OVZB 1EWOA 2H7JA 2JQFR 4PADA 3CBKA 1YVBA 1AU4A 1CV8A 4MI7A 3P5XA 2PADA 1PPPA 2DCCA 5EZSA 3BOWA 1NB3A 4IUMA 2AYNA 3MORA 4CDEB 2YJCA 3PHWA 2XU3A 2HWKA 4P6EA 2BTWB 7PCKA 4QBBA 3QJ3A 2XU4A 1PE6A 2GFOA 1FH0A 2Y5BA 3WXFA 2R9CA 2O6XA 3IHPA 1JQPA 4OVZA 3E1ZB 5EF4A 1THEA 2DCBA 9PAPA 1AU0A 3GCBA 1CJLA 2FRQA 3P5VA 2NQGA 4BS5A 3PDFA 5F02A 4KLBA 1CB5A 4RY2A 4PI3A 1GMYA 3PRPA 3OVZA 3ZUAA 4MSXA 1ME4A 2HH5A 1Y4HA 2BDZA 1X9YA 2GHUA 1BY8A 3HD3A 2DZZA 2P0RA 4HXDB 3RVVA 2FQ9A 2NQIA 1EWMA 2C0YA 1HUCB 3N3KA 4D8EA 5FPWA 4REZA 4CDCB 2YJBA 1U9QX 2HHNA 3RVWA 3NHEA 1AYVA 3H8CA 5CHVA 1AECA 3IFUA 3I06A 3P5WA 6PADA 4QRGA 2B1NA 3CH2X 4BQVA 3B79A 5EZQA 1KHQA 4P6GA 4WA6A 2DC8A 2DZYA 3TMPA 3CBJA 2FUDA 3H6SA 5CHTA 3USVA 3S3QA 4GUAA 2XU1A 3PSEA 4XZXA 2AYOA 3PBHA 2DJGB 2JRIA 2BU3A 4A5UA 3C0RA 2PNSA 1TL9A 4RNAA 1QDQA 2FRAA 3H89A 3LXSA 3OF9A 2ACTA 2J7QA 3BWKA 1NL6A 3RVXA 3B21A 3I3TA 4YYRA 2NQDB 3M99A 3E9SA 3QSDA 1VSNA
chains in the Genus database with same CATH topology
2E00A 4B55A 1GLOA 2AUZA 1VJVA 3WXGA 2YJ8A 1NLJA 2G8JA 1CSBB 4W4UA 1XKGA 5JA7A 3C9EA 3MTNA 4ZUXU 1A6RA 3QT4A 5PADA 1EWPA 3KW9A 3IOQA 3N3GA 2FO5A 5CVMA 4C5PA 3K24A 3HWNA 4BS6A 1POPA 3AI8A 4K7CA 1YK7A 2FTDA 2VFCA 4N4ZA 4PP2E 3U8EA 3D6SA 2R9OA 2AS8A 1YALA 2R9MA 1BP4A 1SNKA 3KWZA 3CH3X 1PCIA 1U9VA 1STFE 3KWBX 2P7UA 4I05A 4X6HA 4FJCA 4QRVA 1Y08A 2FYEA 2E03A 1PPOA 1YT7A 1KFXL 1GCBA 1Q6KA 2E02A 5CVOB 2DJFB 3MHHA 4CZWA 4PP1A 4BPVA 2ATOA 3H7DA 3BPFA 1MEGA 1IWDA 4GUZA 2FT2A 3KFQA 4OEMA 1U9XA 2Y6EA 4HWYA 1CVZA 2HD5A 1PBHA 3BC3A 2R9NA 4W5CA 1MS6A 1M6DA 3O0UA 2PREA 2DC9A 3IV2A 3PNRA 4MZOA 4YYWA 2AUXA 1F2CA 1KHPA 4QH6A 2VHFA 2G8EA 4N8WA 2OP3A 3HHIA 1ATKA 4FK5A 1TLOA 2B1MA 2BDLA 3K9MA 1CQDA 2AIMA 4AXLA 2JQGR 1MDWA 3HHAA 3IMAA 1F2AA 1GX3A 2YJ2A 4YYSA 1CTEA 3OISA 3DF0A 3TNXA 1SP4B 2E01A 2DCDA 4G54A 1U9WA 1W4TA 4CDFB 1F29A 1ITOA 1PPDA 3WXEA 4YYVA 1AYUA 5JH3A 1ZCMA 2HXZA 2CIOA 1GECE 2PBHA 4Q8GA 3V6EA 1QMYA 1AIMA 3H8BA 1TU6A 4Q8HA 1PPNA 2P86A 4X6JA 1EF7A 3F75A 3MHSA 4XR7A 4YVAA 2NQAA 3OVXA 1MEMA 2DC6A 3F5VA 2CB5A 2AVWA 2YJ9A 1DF0A 3O1GA 4I04A 5K16A 4YYUA 1PADA 1CS8A 2VFBA 1MIRA 1DEUA 1EWLA 3S3RA 3ERVA 2OZ2A 4BSQA 2F1GA 2R9FA 3OF8A 3KSEA 4AXMA 2F7DA 1AYWA 4X6IA 4N79A 1ZIVA 3BCNA 2IBIA 2WBFX 3IUTA 1KXRA 3LFYA 4YYQA 2ARYA 4QRXA 1W6FA 4FIPA 3PW3A 4CDDB 1E2TA 2IPPB 1NPZA 2G6DA 4W5BA 1YK8A 1CPJA 1BGOA 1BQIA 1MHWA 4YV8A 2OULA 1AU2A 2AU1A 1PIPA 5A24A 8PCHA 1AU3A 3N4CA 1F2BA 5EGWA 2R6NA 3KX1A 1U5IA 5CVNB 1PXVA 1QOLA 3V6CA 4OELA 2XU5A 3BPMA 5J94A 4DMXA 3KKUA 1NB5A 1S4VA 1NQCA 3P5UA 3LTWA 1O0EA 2DCAA 2VHSA 3K8UA 3IEJA 4I07A 2G7YA 1K3BB 2DC7A 4DMYA 1ICFA 4XUIA 4MZSA 1ME3A 1KFUL 1QXPA 1EWOA 2H7JA 2JQFR 4PADA 3CBKA 1YVBA 1AU4A 1CV8A 3P5XA 2PADA 1PPPA 2DCCA 3BOWA 1NB3A 2AYNA 3MORA 4CDEB 2YJCA 2XU3A 4P6EA 7PCKA 4QBBA 3QJ3A 2XU4A 1PE6A 2GFOA 1FH0A 2Y5BA 3WXFA 4BGFA 2R9CA 2O6XA 3IHPA 1JQPA 3E1ZB 5EF4A 1THEA 2DCBA 9PAPA 1AU0A 3GCBA 1CJLA 2FRQA 3P5VA 3D9WA 4NV7A 2BSZA 2NQGA 4BS5A 3PDFA 5F02A 4KLBA 1CB5A 4RY2A 4PI3A 1GMYA 3OVZA 3ZUAA 4MSXA 1ME4A 2HH5A 1Y4HA 2BDZA 1X9YA 2GHUA 1BY8A 3HD3A 2DZZA 2P0RA 3RVVA 2FQ9A 2NQIA 1EWMA 2C0YA 1HUCB 3N3KA 5FPWA 4CDCB 2YJBA 1U9QX 2HHNA 3RVWA 4NV8A 3NHEA 1AYVA 3H8CA 5CHVA 1AECA 3I06A 3P5WA 6PADA 4QRGA 2B1NA 3CH2X 4BQVA 3B79A 1KHQA 4P6GA 4WA6A 2DC8A 2DZYA 3CBJA 2FUDA 3H6SA 5CHTA 3USVA 3S3QA 2XU1A 2AYOA 3PBHA 2DJGB 2PNSA 1TL9A 1QDQA 2FRAA 3H89A 3LXSA 3OF9A 2ACTA 3BWKA 1NL6A 3RVXA 1W5RA 3I3TA 4YYRA 2NQDB 3M99A 3QSDA 1VSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E00 A;  1GLO A;  2AUZ A;  1VJV A;  3WXG A;  2YJ8 A;  1NLJ A;  2G8J A;  1CSB B;  4W4U A;  1XKG A;  5JA7 A;  3C9E A;  3MTN A;  4ZUX U;  1A6R A;  3QT4 A;  5PAD A;  1EWP A;  3KW9 A;  3IOQ A;  3N3G A;  2FO5 A;  5CVM A;  3K24 A;  3HWN A;  4BS6 A;  1POP A;  3AI8 A;  4K7C A;  1YK7 A;  2FTD A;  4N4Z A;  4PP2 E;  3U8E A;  3D6S A;  2R9O A;  2AS8 A;  1YAL A;  2R9M A;  1BP4 A;  1SNK A;  3KWZ A;  3CH3 X;  1PCI A;  1U9V A;  1STF E;  3KWB X;  2P7U A;  4I05 A;  4X6H A;  4FJC A;  4QRV A;  1Y08 A;  2FYE A;  2E03 A;  1PPO A;  1YT7 A;  1KFX L;  1GCB A;  1Q6K A;  2E02 A;  5CVO B;  2DJF B;  3MHH A;  4CZW A;  4PP1 A;  4BPV A;  2ATO A;  3H7D A;  3BPF A;  1MEG A;  1IWD A;  2FT2 A;  3KFQ A;  4OEM A;  1U9X A;  2Y6E A;  4HWY A;  1CVZ A;  2HD5 A;  1PBH A;  3BC3 A;  2R9N A;  4W5C A;  1MS6 A;  1M6D A;  3O0U A;  2PRE A;  2DC9 A;  3IV2 A;  3PNR A;  4MZO A;  4YYW A;  2AUX A;  1F2C A;  1KHP A;  4QH6 A;  2VHF A;  2G8E A;  4N8W A;  2OP3 A;  3HHI A;  1ATK A;  4FK5 A;  1TLO A;  2B1M A;  2BDL A;  3K9M A;  1CQD A;  2AIM A;  4AXL A;  2JQG R;  1MDW A;  3HHA A;  3IMA A;  1F2A A;  2YJ2 A;  4YYS A;  1CTE A;  3OIS A;  3DF0 A;  3TNX A;  1SP4 B;  2E01 A;  2DCD A;  4G54 A;  1U9W A;  4CDF B;  1F29 A;  1ITO A;  1PPD A;  3WXE A;  4YYV A;  1AYU A;  5JH3 A;  1ZCM A;  2HXZ A;  2CIO A;  1GEC E;  2PBH A;  4Q8G A;  3V6E A;  1QMY A;  1AIM A;  3H8B A;  1TU6 A;  4Q8H A;  1PPN A;  2P86 A;  4X6J A;  1EF7 A;  3F75 A;  3MHS A;  4XR7 A;  4YVA A;  2NQA A;  3OVX A;  1MEM A;  2DC6 A;  3F5V A;  2CB5 A;  2AVW A;  2YJ9 A;  1DF0 A;  3O1G A;  4I04 A;  5K16 A;  4YYU A;  1PAD A;  1CS8 A;  1MIR A;  1DEU A;  1EWL A;  3S3R A;  3ERV A;  2OZ2 A;  4BSQ A;  2F1G A;  2R9F A;  3OF8 A;  3KSE A;  4AXM A;  2F7D A;  1AYW A;  4X6I A;  4N79 A;  1ZIV A;  3BCN A;  2IBI A;  2WBF X;  3IUT A;  1KXR A;  3LFY A;  4YYQ A;  2ARY A;  4QRX A;  4FIP A;  3PW3 A;  4CDD B;  2IPP B;  1NPZ A;  2G6D A;  4W5B A;  1YK8 A;  1CPJ A;  1BGO A;  1BQI A;  1MHW A;  4YV8 A;  2OUL A;  1AU2 A;  2AU1 A;  1PIP A;  5A24 A;  8PCH A;  1AU3 A;  3N4C A;  1F2B A;  5EGW A;  2R6N A;  3KX1 A;  1U5I A;  5CVN B;  1PXV A;  1QOL A;  3V6C A;  4OEL A;  2XU5 A;  3BPM A;  5J94 A;  4DMX A;  3KKU A;  1NB5 A;  1S4V A;  1NQC A;  3P5U A;  1O0E A;  2DCA A;  2VHS A;  3K8U A;  3IEJ A;  4I07 A;  2G7Y A;  1K3B B;  2DC7 A;  4DMY A;  1ICF A;  4XUI A;  4MZS A;  1ME3 A;  1KFU L;  1QXP A;  1EWO A;  2H7J A;  2JQF R;  4PAD A;  3CBK A;  1YVB A;  1AU4 A;  1CV8 A;  3P5X A;  2PAD A;  1PPP A;  2DCC A;  3BOW A;  1NB3 A;  2AYN A;  3MOR A;  4CDE B;  2YJC A;  2XU3 A;  4P6E A;  7PCK A;  4QBB A;  3QJ3 A;  2XU4 A;  1PE6 A;  2GFO A;  1FH0 A;  2Y5B A;  3WXF A;  2R9C A;  2O6X A;  3IHP A;  1JQP A;  3E1Z B;  5EF4 A;  1THE A;  2DCB A;  9PAP A;  1AU0 A;  3GCB A;  1CJL A;  2FRQ A;  3P5V A;  2NQG A;  4BS5 A;  3PDF A;  5F02 A;  4KLB A;  1CB5 A;  4RY2 A;  4PI3 A;  1GMY A;  3OVZ A;  3ZUA A;  4MSX A;  1ME4 A;  2HH5 A;  1Y4H A;  2BDZ A;  1X9Y A;  2GHU A;  1BY8 A;  3HD3 A;  2DZZ A;  2P0R A;  3RVV A;  2FQ9 A;  2NQI A;  1EWM A;  2C0Y A;  1HUC B;  3N3K A;  5FPW A;  4CDC B;  2YJB A;  1U9Q X;  2HHN A;  3RVW A;  3NHE A;  1AYV A;  3H8C A;  5CHV A;  1AEC A;  3I06 A;  3P5W A;  6PAD A;  4QRG A;  2B1N A;  3CH2 X;  4BQV A;  3B79 A;  1KHQ A;  4P6G A;  4WA6 A;  2DC8 A;  2DZY A;  3CBJ A;  2FUD A;  3H6S A;  5CHT A;  3USV A;  3S3Q A;  2XU1 A;  2AYO A;  3PBH A;  2DJG B;  2PNS A;  1TL9 A;  1QDQ A;  2FRA A;  3H89 A;  3LXS A;  3OF9 A;  2ACT A;  3BWK A;  1NL6 A;  3RVX A;  3I3T A;  4YYR A;  2NQD B;  3M99 A;  3QSD A;  1VSN A; 
#chains in the Genus database with same CATH topology
 2E00 A;  1GLO A;  2AUZ A;  1VJV A;  3WXG A;  2YJ8 A;  1NLJ A;  3RNV A;  2G8J A;  1CSB B;  4W4U A;  3PHX A;  1XKG A;  5JA7 A;  3C9E A;  3MTN A;  2JTC A;  4ZUX U;  1A6R A;  3QT4 A;  5PAD A;  1EWP A;  3KW9 A;  3IOQ A;  5KO3 A;  3N3G A;  1YZB A;  2FO5 A;  5CVM A;  3K24 A;  3HWN A;  4BS6 A;  1POP A;  5E6J A;  3AI8 A;  4K7C A;  1YK7 A;  2FTD A;  3O65 A;  4M0W A;  4N4Z A;  4PP2 E;  4BOQ A;  3U8E A;  3D6S A;  2R9O A;  2AS8 A;  4BOZ A;  1YAL A;  2R9M A;  1BP4 A;  1SNK A;  3KWZ A;  3CH3 X;  1PCI A;  1U9V A;  2AGA A;  1STF E;  2UZJ A;  4P16 A;  3KWB X;  2BTW A;  2P7U A;  2J7Q C;  4I05 A;  4X6H A;  4FJC A;  4QRV A;  4R3D A;  1Y08 A;  1UKF A;  2FYE A;  4PT5 A;  4OW0 A;  2E03 A;  1PPO A;  1YT7 A;  1KFX L;  1GCB A;  1Q6K A;  2E02 A;  5CVO B;  2DJF B;  3MHH A;  4CZW A;  4PP1 A;  4BPV A;  2ATO A;  3H7D A;  3BPF A;  1MEG A;  1IWD A;  3W30 A;  4D8I A;  2FT2 A;  3KFQ A;  4OEM A;  1U9X A;  4D8B A;  2Y6E A;  2Z84 A;  4HWY A;  1CVZ A;  2HD5 A;  1PBH A;  3BC3 A;  2R9N A;  4W5C A;  1MS6 A;  1M6D A;  3O0U A;  2PRE A;  2DC9 A;  4ZTB A;  3IV2 A;  3W31 A;  3PNR A;  4MZO A;  4YYW A;  2AUX A;  1F2C A;  1KHP A;  4QH6 A;  2VHF A;  4RF0 A;  2G8E A;  3BB7 A;  2OP3 A;  4N8W A;  3HHI A;  1DKI A;  1ATK A;  3BBA A;  4FK5 A;  1TLO A;  2B1M A;  2BDL A;  3K9M A;  1CQD A;  2AIM A;  3PHU A;  4AXL A;  2JQG R;  1MDW A;  3HHA A;  3IMA A;  1F2A A;  2YJ2 A;  4YYS A;  1CTE A;  3OIS A;  3DF0 A;  3TNX A;  1SP4 B;  2FE8 A;  3BY4 A;  3MJ5 A;  2E01 A;  2DCD A;  4G54 A;  1U9W A;  4WUR A;  4CDF B;  1F29 A;  1ITO A;  4IP3 A;  1PPD A;  3WXE A;  4YYV A;  1AYU A;  5JH3 A;  5JZE A;  1ZCM A;  2HXZ A;  2CIO A;  1GEC E;  2PBH A;  4Q8G A;  3V6E A;  1QMY A;  4BOP A;  1AIM A;  3H8B A;  1TU6 A;  4Q8H A;  1PPN A;  2P86 A;  4X6J A;  3MP2 A;  1EF7 A;  3F75 A;  3MHS A;  4XR7 A;  4YVA A;  4RF1 A;  2NQA A;  3OVX A;  1MEM A;  2DC6 A;  3F5V A;  2CB5 A;  2AVW A;  2YJ9 A;  1DF0 A;  3O1G A;  4I04 A;  5K16 A;  4YYU A;  1PAD A;  1CS8 A;  1MIR A;  1DEU A;  1EWL A;  3S3R A;  3ERV A;  4RKX A;  2OZ2 A;  4BSQ A;  2F1G A;  2R9F A;  3OF8 A;  3KSE A;  4AXM A;  2F7D A;  1AYW A;  3TRK A;  4X6I A;  4BOU A;  4N79 A;  1ZIV A;  3BCN A;  2IBI A;  2WBF X;  3IUT A;  1KXR A;  3LFY A;  4YYQ A;  2ARY A;  4QRX A;  4FIP A;  2DOS A;  3PW3 A;  3MTV A;  4CDD B;  2IPP B;  1NPZ A;  2G6D A;  4W5B A;  1YK8 A;  1CPJ A;  1BGO A;  1BQI A;  3PRM A;  1MHW A;  4YV8 A;  2OUL A;  1AU2 A;  2AU1 A;  1PIP A;  5A24 A;  8PCH A;  1AU3 A;  3N4C A;  1F2B A;  5EGW A;  4MM3 B;  2R6N A;  3KX1 A;  1U5I A;  5CVN B;  1PXV A;  1QOL A;  3V6C A;  4OEL A;  2XU5 A;  3BPM A;  5J94 A;  4DMX A;  3KKU A;  1NB5 A;  3PT2 A;  1S4V A;  1NQC A;  4BOS A;  1PVJ A;  3P5U A;  3OQC A;  1O0E A;  2DCA A;  2VHS A;  3K8U A;  3IEJ A;  4I07 A;  2G7Y A;  1K3B B;  2DC7 A;  4DMY A;  1ICF A;  4XUI A;  3ZNH A;  4MZS A;  1ME3 A;  1KFU L;  1QXP A;  4OVZ B;  1EWO A;  2H7J A;  2JQF R;  4PAD A;  3CBK A;  1YVB A;  1AU4 A;  1CV8 A;  4MI7 A;  3P5X A;  2PAD A;  1PPP A;  2DCC A;  5EZS A;  3BOW A;  1NB3 A;  4IUM A;  2AYN A;  3MOR A;  4CDE B;  2YJC A;  3PHW A;  2XU3 A;  2HWK A;  4P6E A;  2BTW B;  7PCK A;  4QBB A;  3QJ3 A;  2XU4 A;  1PE6 A;  2GFO A;  1FH0 A;  2Y5B A;  3WXF A;  2R9C A;  2O6X A;  3IHP A;  1JQP A;  4OVZ A;  3E1Z B;  5EF4 A;  1THE A;  2DCB A;  9PAP A;  1AU0 A;  3GCB A;  1CJL A;  2FRQ A;  3P5V A;  2NQG A;  4BS5 A;  3PDF A;  5F02 A;  4KLB A;  1CB5 A;  4RY2 A;  4PI3 A;  1GMY A;  3PRP A;  3OVZ A;  3ZUA A;  4MSX A;  1ME4 A;  2HH5 A;  1Y4H A;  2BDZ A;  1X9Y A;  2GHU A;  1BY8 A;  3HD3 A;  2DZZ A;  2P0R A;  4HXD B;  3RVV A;  2FQ9 A;  2NQI A;  1EWM A;  2C0Y A;  1HUC B;  3N3K A;  4D8E A;  5FPW A;  4REZ A;  4CDC B;  2YJB A;  1U9Q X;  2HHN A;  3RVW A;  3NHE A;  1AYV A;  3H8C A;  5CHV A;  1AEC A;  3IFU A;  3I06 A;  3P5W A;  6PAD A;  4QRG A;  2B1N A;  3CH2 X;  4BQV A;  3B79 A;  5EZQ A;  1KHQ A;  4P6G A;  4WA6 A;  2DC8 A;  2DZY A;  3TMP A;  3CBJ A;  2FUD A;  3H6S A;  5CHT A;  3USV A;  3S3Q A;  4GUA A;  2XU1 A;  3PSE A;  4XZX A;  2AYO A;  3PBH A;  2DJG B;  2JRI A;  2BU3 A;  4A5U A;  3C0R A;  2PNS A;  1TL9 A;  4RNA A;  1QDQ A;  2FRA A;  3H89 A;  3LXS A;  3OF9 A;  2ACT A;  2J7Q A;  3BWK A;  1NL6 A;  3RVX A;  3B21 A;  3I3T A;  4YYR A;  2NQD B;  3M99 A;  3E9S A;  3QSD A;  1VSN A; 
#chains in the Genus database with same CATH homology
 2E00 A;  4B55 A;  1GLO A;  2AUZ A;  1VJV A;  3WXG A;  2YJ8 A;  1NLJ A;  2G8J A;  1CSB B;  4W4U A;  1XKG A;  5JA7 A;  3C9E A;  3MTN A;  4ZUX U;  1A6R A;  3QT4 A;  5PAD A;  1EWP A;  3KW9 A;  3IOQ A;  3N3G A;  2FO5 A;  5CVM A;  4C5P A;  3K24 A;  3HWN A;  4BS6 A;  1POP A;  3AI8 A;  4K7C A;  1YK7 A;  2FTD A;  2VFC A;  4N4Z A;  4PP2 E;  3U8E A;  3D6S A;  2R9O A;  2AS8 A;  1YAL A;  2R9M A;  1BP4 A;  1SNK A;  3KWZ A;  3CH3 X;  1PCI A;  1U9V A;  1STF E;  3KWB X;  2P7U A;  4I05 A;  4X6H A;  4FJC A;  4QRV A;  1Y08 A;  2FYE A;  2E03 A;  1PPO A;  1YT7 A;  1KFX L;  1GCB A;  1Q6K A;  2E02 A;  5CVO B;  2DJF B;  3MHH A;  4CZW A;  4PP1 A;  4BPV A;  2ATO A;  3H7D A;  3BPF A;  1MEG A;  1IWD A;  4GUZ A;  2FT2 A;  3KFQ A;  4OEM A;  1U9X A;  2Y6E A;  4HWY A;  1CVZ A;  2HD5 A;  1PBH A;  3BC3 A;  2R9N A;  4W5C A;  1MS6 A;  1M6D A;  3O0U A;  2PRE A;  2DC9 A;  3IV2 A;  3PNR A;  4MZO A;  4YYW A;  2AUX A;  1F2C A;  1KHP A;  4QH6 A;  2VHF A;  2G8E A;  4N8W A;  2OP3 A;  3HHI A;  1ATK A;  4FK5 A;  1TLO A;  2B1M A;  2BDL A;  3K9M A;  1CQD A;  2AIM A;  4AXL A;  2JQG R;  1MDW A;  3HHA A;  3IMA A;  1F2A A;  1GX3 A;  2YJ2 A;  4YYS A;  1CTE A;  3OIS A;  3DF0 A;  3TNX A;  1SP4 B;  2E01 A;  2DCD A;  4G54 A;  1U9W A;  1W4T A;  4CDF B;  1F29 A;  1ITO A;  1PPD A;  3WXE A;  4YYV A;  1AYU A;  5JH3 A;  1ZCM A;  2HXZ A;  2CIO A;  1GEC E;  2PBH A;  4Q8G A;  3V6E A;  1QMY A;  1AIM A;  3H8B A;  1TU6 A;  4Q8H A;  1PPN A;  2P86 A;  4X6J A;  1EF7 A;  3F75 A;  3MHS A;  4XR7 A;  4YVA A;  2NQA A;  3OVX A;  1MEM A;  2DC6 A;  3F5V A;  2CB5 A;  2AVW A;  2YJ9 A;  1DF0 A;  3O1G A;  4I04 A;  5K16 A;  4YYU A;  1PAD A;  1CS8 A;  2VFB A;  1MIR A;  1DEU A;  1EWL A;  3S3R A;  3ERV A;  2OZ2 A;  4BSQ A;  2F1G A;  2R9F A;  3OF8 A;  3KSE A;  4AXM A;  2F7D A;  1AYW A;  4X6I A;  4N79 A;  1ZIV A;  3BCN A;  2IBI A;  2WBF X;  3IUT A;  1KXR A;  3LFY A;  4YYQ A;  2ARY A;  4QRX A;  1W6F A;  4FIP A;  3PW3 A;  4CDD B;  1E2T A;  2IPP B;  1NPZ A;  2G6D A;  4W5B A;  1YK8 A;  1CPJ A;  1BGO A;  1BQI A;  1MHW A;  4YV8 A;  2OUL A;  1AU2 A;  2AU1 A;  1PIP A;  5A24 A;  8PCH A;  1AU3 A;  3N4C A;  1F2B A;  5EGW A;  2R6N A;  3KX1 A;  1U5I A;  5CVN B;  1PXV A;  1QOL A;  3V6C A;  4OEL A;  2XU5 A;  3BPM A;  5J94 A;  4DMX A;  3KKU A;  1NB5 A;  1S4V A;  1NQC A;  3P5U A;  3LTW A;  1O0E A;  2DCA A;  2VHS A;  3K8U A;  3IEJ A;  4I07 A;  2G7Y A;  1K3B B;  2DC7 A;  4DMY A;  1ICF A;  4XUI A;  4MZS A;  1ME3 A;  1KFU L;  1QXP A;  1EWO A;  2H7J A;  2JQF R;  4PAD A;  3CBK A;  1YVB A;  1AU4 A;  1CV8 A;  3P5X A;  2PAD A;  1PPP A;  2DCC A;  3BOW A;  1NB3 A;  2AYN A;  3MOR A;  4CDE B;  2YJC A;  2XU3 A;  4P6E A;  7PCK A;  4QBB A;  3QJ3 A;  2XU4 A;  1PE6 A;  2GFO A;  1FH0 A;  2Y5B A;  3WXF A;  4BGF A;  2R9C A;  2O6X A;  3IHP A;  1JQP A;  3E1Z B;  5EF4 A;  1THE A;  2DCB A;  9PAP A;  1AU0 A;  3GCB A;  1CJL A;  2FRQ A;  3P5V A;  3D9W A;  4NV7 A;  2BSZ A;  2NQG A;  4BS5 A;  3PDF A;  5F02 A;  4KLB A;  1CB5 A;  4RY2 A;  4PI3 A;  1GMY A;  3OVZ A;  3ZUA A;  4MSX A;  1ME4 A;  2HH5 A;  1Y4H A;  2BDZ A;  1X9Y A;  2GHU A;  1BY8 A;  3HD3 A;  2DZZ A;  2P0R A;  3RVV A;  2FQ9 A;  2NQI A;  1EWM A;  2C0Y A;  1HUC B;  3N3K A;  5FPW A;  4CDC B;  2YJB A;  1U9Q X;  2HHN A;  3RVW A;  4NV8 A;  3NHE A;  1AYV A;  3H8C A;  5CHV A;  1AEC A;  3I06 A;  3P5W A;  6PAD A;  4QRG A;  2B1N A;  3CH2 X;  4BQV A;  3B79 A;  1KHQ A;  4P6G A;  4WA6 A;  2DC8 A;  2DZY A;  3CBJ A;  2FUD A;  3H6S A;  5CHT A;  3USV A;  3S3Q A;  2XU1 A;  2AYO A;  3PBH A;  2DJG B;  2PNS A;  1TL9 A;  1QDQ A;  2FRA A;  3H89 A;  3LXS A;  3OF9 A;  2ACT A;  3BWK A;  1NL6 A;  3RVX A;  1W5R A;  3I3T A;  4YYR A;  2NQD B;  3M99 A;  3QSD A;  1VSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...