1PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1padA00
5FPWA 2YJ9A 3U8EA 3RVWA 3B79A 1A6RA 3RVXA 2E00A 4I05A 1GMYA 1VSNA 4N79A 2NQDB 1TL9A 5JH3A 1Y08A 1MIRA 3MORA 3CBKA 2YJ8A 3OF9A 2DCDA 4KLBA 1PE6A 1BGOA 4QRVA 3IOQA 4MZSA 3DF0A 1QXPA 2PBHA 3OVXA 3F5VA 1VJVA 2E01A 5F02A 2DJFB 3NHEA 3BC3A 4QRXA 4YV8A 1MHWA 3ZUAA 1CSBB 4ZUXU 3I3TA 2P7UA 3IMAA 3LFYA 4WA6A 4DMXA 2YJBA 1MEMA 3OF8A 2JQFR 2NQIA 2YJCA 3H8CA 3CH2X 4MSXA 3H7DA 2G8EA 1PPDA 2ACTA 2OZ2A 3WXFA 1M6DA 2FRQA 3P5UA 4X6JA 2DCAA 2AIMA 1F2CA 2OULA 1JQPA 1NB3A 5CHVA 3I06A 1NQCA 3PW3A 2PADA 1AU0A 4QBBA 1ME3A 3KFQA 3QSDA 4CDCB 2F1GA 1MDWA 3BWKA 4W4UA 1GLOA 5CHTA 3K8UA 2DC9A 2Y5BA 2PNSA 2AU1A 1NB5A 3D6SA 3RVVA 1YK8A 3S3QA 2BDLA 4HWYA 2R9FA 2FTDA 2ARYA 7PCKA 1CTEA 4FK5A 4YYSA 2C0YA 3CBJA 2XU1A 2AS8A 1CQDA 3ERVA 2DCCA 2B1NA 2HXZA 9PAPA 3BOWA 1PBHA 1CVZA 4OELA 4AXLA 2DJGB 2CB5A 4PP2E 1KFUL 3AI8A 1X9YA 5JA7A 1KHPA 1F2BA 2NQGA 4YYRA 4CDEB 1GECE 4N8WA 3KKUA 3H89A 1QMYA 1U9WA 1BQIA 3O1GA 2F7DA 4Q8HA 1EWMA 4QH6A 1ICFA 4OEMA 3P5VA 1CPJA 3WXGA 3HWNA 4YYWA 1SP4B 3S3RA 3OVZA 3CH3X 2FUDA 3IV2A 2IBIA 3TNXA 4AXMA 1NPZA 1SNKA 3KX1A 1MS6A 1AU3A 2VHSA 2Y6EA 4P6EA 4YYVA 2G8JA 1CJLA 3MHSA 3PBHA 2XU5A 1IWDA 2E03A 4I04A 4X6IA 2WBFX 1Y4HA 1EWLA 3BPMA 1PPNA 2BDZA 3KW9A 1FH0A 3QT4A 1YT7A 3K24A 4DMYA 3USVA 5A24A 3M99A 1AECA 1AU4A 2FYEA 3HHAA 1PPOA 1F29A 1BP4A 1KXRA 2DC6A 1TU6A 4MZOA 1NL6A 4P6GA 3K9MA 4CDFB 1NLJA 1F2AA 3HD3A 3OISA 2R6NA 3BCNA 4W5BA 3KWBX 4N4ZA 1GCBA 2DZYA 6PADA 1O0EA 1AYWA 3V6EA 4YVAA 3N3KA 4XUIA 4XR7A 1PIPA 1YK7A 5CVOB 5J94A 1CS8A 4PADA 2NQAA 3MHHA 2DC8A 2AYNA 2O6XA 2R9OA 3MTNA 5PADA 1K3BB 1U9QX 4YYUA 1PPPA 4PP1A 1ITOA 1BY8A 3IHPA 3N3GA 2VHFA 1YVBA 4I07A 3WXEA 2XU4A 2ATOA 3LXSA 2AYOA 5CVMA 4CDDB 1DEUA 1TLOA 4W5CA 1AIMA 1U5IA 4QRGA 2DC7A 4RY2A 3PNRA 5EGWA 4BS6A 2FRAA 1S4VA 1QOLA 5CVNB 1KHQA 1Q6KA 1CV8A 3BPFA 1PADA 2G7YA 2XU3A 3H8BA 2FO5A 2HH5A 3V6CA 1POPA 4PI3A 2P0RA 1THEA 3H6SA 2E02A 3HHIA 2P86A 2DZZA 1XKGA 1YALA 1PXVA 3P5XA 1CB5A 2HD5A 3IUTA 2GFOA 2GHUA 1ME4A 1ZCMA 1ATKA 4G54A 2JQGR 4K7CA 3GCBA 2R9CA 2HHNA 4BQVA 2AUXA 3KWZA 1AYUA 1ZIVA 4BSQA 4YYQA 2R9NA 4CZWA 2OP3A 2DCBA 2IPPB 2YJ2A 2B1MA 3QJ3A 2H7JA 1PCIA 4BPVA 2CIOA 1STFE 1U9VA 3E1ZB 4X6HA 1EWPA 2FT2A 3N4CA 5K16A 2G6DA 3C9EA 2R9MA 3IEJA 3F75A 3KSEA 2PREA 1EF7A 1AU2A 4BS5A 1EWOA 8PCHA 3PDFA 3O0UA 2AVWA 4Q8GA 2FQ9A 4FJCA 1KFXL 4FIPA 1AYVA 1HUCB 5EF4A 1QDQA 1MEGA 3P5WA 2AUZA 1DF0A 1U9XA
chains in the Genus database with same CATH superfamily
4RF1A 5FPWA 2YJ9A 3TRKA 3U8EA 3RVWA 3B21A 3B79A 1A6RA 3PHUA 3RVXA 5JZEA 2E00A 4I05A 1GMYA 1VSNA 4N79A 2NQDB 1TL9A 5JH3A 1Y08A 2BTWA 1MIRA 3PHXA 3MORA 3CBKA 3O65A 2YJ8A 3OF9A 2DCDA 4KLBA 1PE6A 1BGOA 4RNAA 4QRVA 3IOQA 4MZSA 2DOSA 3DF0A 1QXPA 2AGAA 3IFUA 2PBHA 3OVXA 4BOUA 3F5VA 1VJVA 2E01A 5F02A 3W30A 2DJFB 3NHEA 3BC3A 4QRXA 4YV8A 1MHWA 3ZUAA 1CSBB 4ZUXU 4MI7A 3I3TA 2P7UA 3MP2A 3IMAA 3LFYA 4WA6A 4DMXA 2YJBA 5EZQA 1MEMA 3OF8A 2JQFR 2NQIA 4REZA 2YJCA 3H8CA 3CH2X 2JRIA 4MSXA 4WURA 3H7DA 2G8EA 4XZXA 1PPDA 2ACTA 2OZ2A 3WXFA 1M6DA 2FRQA 3P5UA 4X6JA 2DCAA 2AIMA 1F2CA 2OULA 1JQPA 1NB3A 5EZSA 5CHVA 3I06A 1NQCA 3PW3A 2PADA 1AU0A 1ME3A 3KFQA 4QBBA 3QSDA 4CDCB 2F1GA 1MDWA 3BY4A 3BWKA 4W4UA 3BBAA 1GLOA 5CHTA 4IP3A 3K8UA 4RKXA 2DC9A 5E6JA 2Y5BA 4BOSA 3TMPA 2PNSA 2AU1A 3E9SA 1NB5A 3D6SA 4OW0A 3RVVA 1YK8A 3S3QA 2BDLA 4HWYA 2R9FA 3PHWA 2FTDA 2ARYA 7PCKA 1CTEA 4FK5A 4HXDB 4YYSA 2C0YA 3CBJA 4M0WA 2XU1A 2AS8A 1CQDA 3ERVA 3BB7A 2DCCA 2B1NA 2HXZA 1PVJA 9PAPA 3BOWA 1PBHA 1CVZA 4OELA 4AXLA 2DJGB 2CB5A 4PP2E 1KFUL 3PSEA 3AI8A 1X9YA 4OVZB 5JA7A 1KHPA 1F2BA 2NQGA 4YYRA 4CDEB 1GECE 4N8WA 3KKUA 4A5UA 4RF0A 3H89A 1QMYA 1U9WA 4PT5A 1BQIA 3O1GA 2F7DA 4Q8HA 1EWMA 4QH6A 1ICFA 4OEMA 4GUAA 3P5VA 1CPJA 3WXGA 3HWNA 4YYWA 2BTWB 1SP4B 3S3RA 3OVZA 3CH3X 1YZBA 2FUDA 3IV2A 2IBIA 3TNXA 1UKFA 4AXMA 1NPZA 1SNKA 3KX1A 1MS6A 1AU3A 2VHSA 2Y6EA 4P6EA 4YYVA 4BOPA 2G8JA 1CJLA 3MHSA 3PBHA 2XU5A 1IWDA 2E03A 4I04A 4X6IA 2WBFX 1Y4HA 2J7QC 1EWLA 3BPMA 1PPNA 2BDZA 3KW9A 4R3DA 1FH0A 3QT4A 1YT7A 3K24A 4DMYA 3USVA 5A24A 3M99A 1AECA 1AU4A 2FYEA 3HHAA 4D8BA 3C0RA 1PPOA 1F29A 1BP4A 1KXRA 3RNVA 2DC6A 2FE8A 1TU6A 4MZOA 1NL6A 4P6GA 3K9MA 4CDFB 3MJ5A 1NLJA 1F2AA 3HD3A 4IUMA 3OISA 2R6NA 3BCNA 4W5BA 3KWBX 4N4ZA 1DKIA 1GCBA 2DZYA 6PADA 1O0EA 1AYWA 3V6EA 4YVAA 3OQCA 3N3KA 4XUIA 4XR7A 1PIPA 1YK7A 5CVOB 5J94A 3MTVA 1CS8A 4PADA 2NQAA 3MHHA 2DC8A 2AYNA 2BU3A 2O6XA 2R9OA 3MTNA 5PADA 3ZNHA 1K3BB 1U9QX 4YYUA 1PPPA 4PP1A 1ITOA 1BY8A 3IHPA 3N3GA 2VHFA 1YVBA 4I07A 3WXEA 2XU4A 2ATOA 3LXSA 2AYOA 5CVMA 4CDDB 1DEUA 4ZTBA 1TLOA 4W5CA 1AIMA 2JTCA 4BOQA 1U5IA 4QRGA 2DC7A 4RY2A 3PNRA 5EGWA 4BS6A 2FRAA 1S4VA 1QOLA 4P16A 5CVNB 1KHQA 1Q6KA 4BOZA 1CV8A 4MM3B 3BPFA 1PADA 2G7YA 2XU3A 3H8BA 2FO5A 2HH5A 3V6CA 1POPA 4PI3A 2P0RA 1THEA 3H6SA 2E02A 3HHIA 2P86A 2DZZA 1XKGA 1YALA 1PXVA 3P5XA 5KO3A 1CB5A 2HD5A 3IUTA 2GFOA 2GHUA 1ME4A 1ZCMA 1ATKA 2HWKA 4G54A 2JQGR 4K7CA 3GCBA 2R9CA 2HHNA 4BQVA 2AUXA 3KWZA 2Z84A 1AYUA 1ZIVA 4BSQA 4YYQA 2R9NA 4CZWA 2OP3A 2DCBA 2IPPB 2YJ2A 2B1MA 3QJ3A 2H7JA 1PCIA 4BPVA 2CIOA 1STFE 1U9VA 3E1ZB 4X6HA 1EWPA 2FT2A 3N4CA 5K16A 2G6DA 3C9EA 2R9MA 3IEJA 4D8IA 3PRPA 3F75A 3KSEA 2PREA 1EF7A 1AU2A 4BS5A 1EWOA 3PRMA 3PT2A 8PCHA 3PDFA 2UZJA 3O0UA 2J7QA 2AVWA 4Q8GA 2FQ9A 4FJCA 1KFXL 4FIPA 3W31A 1AYVA 1HUCB 5EF4A 1QDQA 1MEGA 3P5WA 4OVZA 2AUZA 4D8EA 1DF0A 1U9XA
chains in the Genus database with same CATH topology
5FPWA 2YJ9A 3U8EA 3RVWA 3B79A 1A6RA 3RVXA 2E00A 4I05A 1GMYA 1VSNA 4N79A 2NQDB 1TL9A 5JH3A 1Y08A 1MIRA 3MORA 3CBKA 2YJ8A 3OF9A 2DCDA 4KLBA 1PE6A 1BGOA 4QRVA 3IOQA 4MZSA 3DF0A 1QXPA 2PBHA 3OVXA 3F5VA 1VJVA 2E01A 5F02A 2DJFB 3NHEA 3BC3A 4QRXA 4YV8A 1MHWA 3ZUAA 1CSBB 4ZUXU 3I3TA 2P7UA 3IMAA 3LFYA 4WA6A 4DMXA 2YJBA 3OF8A 1MEMA 2JQFR 2NQIA 2YJCA 3H8CA 3CH2X 4MSXA 3H7DA 2G8EA 1PPDA 2ACTA 4GUZA 2OZ2A 3WXFA 1M6DA 2FRQA 3P5UA 4X6JA 2DCAA 2AIMA 1F2CA 2OULA 1JQPA 1NB3A 5CHVA 3I06A 1NQCA 3PW3A 2PADA 1AU0A 3KFQA 1ME3A 4QBBA 3QSDA 4CDCB 2F1GA 1MDWA 3BWKA 4W4UA 1GLOA 5CHTA 3K8UA 2DC9A 2Y5BA 2PNSA 2AU1A 1NB5A 3D6SA 3RVVA 1YK8A 3S3QA 2BDLA 4HWYA 3D9WA 2R9FA 2FTDA 2ARYA 7PCKA 1CTEA 4FK5A 4YYSA 2C0YA 3CBJA 2XU1A 2AS8A 1CQDA 4C5PA 3ERVA 2DCCA 1W6FA 2B1NA 2HXZA 9PAPA 3BOWA 1PBHA 1CVZA 4OELA 4AXLA 2DJGB 2VFCA 2CB5A 4PP2E 1KFUL 3AI8A 1X9YA 5JA7A 1KHPA 1F2BA 2NQGA 4YYRA 4CDEB 1GECE 4N8WA 3KKUA 3H89A 1QMYA 1U9WA 1BQIA 3O1GA 3LTWA 2F7DA 4Q8HA 1EWMA 4QH6A 1ICFA 4OEMA 3P5VA 1CPJA 3WXGA 3HWNA 4YYWA 4BGFA 1SP4B 3S3RA 3OVZA 3CH3X 2FUDA 3IV2A 2IBIA 3TNXA 1GX3A 4AXMA 1NPZA 1SNKA 3KX1A 1MS6A 1AU3A 2VHSA 2Y6EA 4P6EA 4YYVA 2G8JA 1CJLA 3MHSA 3PBHA 2XU5A 1IWDA 2E03A 4I04A 4X6IA 2WBFX 1Y4HA 1EWLA 3BPMA 1PPNA 2BDZA 3KW9A 1FH0A 3QT4A 1YT7A 3K24A 4DMYA 3USVA 5A24A 3M99A 1AECA 1AU4A 1W5RA 2FYEA 3HHAA 1PPOA 1F29A 1BP4A 1KXRA 2DC6A 1TU6A 4MZOA 1NL6A 2VFBA 4P6GA 3K9MA 4CDFB 1NLJA 1F2AA 3HD3A 3OISA 2R6NA 3BCNA 4W5BA 3KWBX 4N4ZA 1GCBA 2DZYA 6PADA 1O0EA 1AYWA 3V6EA 4B55A 4YVAA 3N3KA 4XUIA 4XR7A 1PIPA 1YK7A 5CVOB 5J94A 1CS8A 4PADA 2NQAA 3MHHA 2DC8A 2AYNA 2O6XA 2R9OA 3MTNA 5PADA 1K3BB 1U9QX 4YYUA 1PPPA 4PP1A 1ITOA 1BY8A 3IHPA 3N3GA 2VHFA 1YVBA 4I07A 3WXEA 2XU4A 2ATOA 3LXSA 2AYOA 5CVMA 4CDDB 1DEUA 1TLOA 4W5CA 1AIMA 1U5IA 4QRGA 2DC7A 4RY2A 3PNRA 5EGWA 4BS6A 4NV7A 2FRAA 1S4VA 1QOLA 5CVNB 1KHQA 2BSZA 1Q6KA 1CV8A 3BPFA 1PADA 2G7YA 2XU3A 3H8BA 4NV8A 2FO5A 2HH5A 3V6CA 1POPA 4PI3A 2P0RA 1THEA 3H6SA 2E02A 3HHIA 2P86A 2DZZA 1XKGA 1YALA 1PXVA 3P5XA 1CB5A 2HD5A 3IUTA 2GFOA 2GHUA 1ME4A 1ZCMA 1ATKA 4G54A 2JQGR 4K7CA 3GCBA 2R9CA 2HHNA 4BQVA 2AUXA 3KWZA 1AYUA 1ZIVA 4BSQA 4YYQA 2R9NA 4CZWA 2OP3A 2DCBA 2IPPB 2YJ2A 2B1MA 3QJ3A 2H7JA 1PCIA 4BPVA 2CIOA 1STFE 1U9VA 3E1ZB 4X6HA 1EWPA 2FT2A 3N4CA 5K16A 2G6DA 3C9EA 2R9MA 3IEJA 3F75A 3KSEA 2PREA 1EF7A 1AU2A 4BS5A 1EWOA 8PCHA 3PDFA 3O0UA 2AVWA 4Q8GA 2FQ9A 4FJCA 1KFXL 4FIPA 1AYVA 1HUCB 1W4TA 5EF4A 1QDQA 1MEGA 3P5WA 2AUZA 1DF0A 1E2TA 1U9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPW A;  2YJ9 A;  3U8E A;  3RVW A;  3B79 A;  1A6R A;  3RVX A;  2E00 A;  4I05 A;  1GMY A;  1VSN A;  4N79 A;  2NQD B;  1TL9 A;  5JH3 A;  1Y08 A;  1MIR A;  3MOR A;  3CBK A;  2YJ8 A;  3OF9 A;  2DCD A;  4KLB A;  1PE6 A;  1BGO A;  4QRV A;  3IOQ A;  4MZS A;  3DF0 A;  1QXP A;  2PBH A;  3OVX A;  3F5V A;  1VJV A;  2E01 A;  5F02 A;  2DJF B;  3NHE A;  3BC3 A;  4QRX A;  4YV8 A;  1MHW A;  3ZUA A;  1CSB B;  4ZUX U;  3I3T A;  2P7U A;  3IMA A;  3LFY A;  4WA6 A;  4DMX A;  2YJB A;  1MEM A;  3OF8 A;  2JQF R;  2NQI A;  2YJC A;  3H8C A;  3CH2 X;  4MSX A;  3H7D A;  2G8E A;  1PPD A;  2ACT A;  2OZ2 A;  3WXF A;  1M6D A;  2FRQ A;  3P5U A;  4X6J A;  2DCA A;  2AIM A;  1F2C A;  2OUL A;  1JQP A;  1NB3 A;  5CHV A;  3I06 A;  1NQC A;  3PW3 A;  2PAD A;  1AU0 A;  4QBB A;  1ME3 A;  3KFQ A;  3QSD A;  4CDC B;  2F1G A;  1MDW A;  3BWK A;  4W4U A;  1GLO A;  5CHT A;  3K8U A;  2DC9 A;  2Y5B A;  2PNS A;  2AU1 A;  1NB5 A;  3D6S A;  3RVV A;  1YK8 A;  3S3Q A;  2BDL A;  4HWY A;  2R9F A;  2FTD A;  2ARY A;  7PCK A;  1CTE A;  4FK5 A;  4YYS A;  2C0Y A;  3CBJ A;  2XU1 A;  2AS8 A;  1CQD A;  3ERV A;  2DCC A;  2B1N A;  2HXZ A;  9PAP A;  3BOW A;  1PBH A;  1CVZ A;  4OEL A;  4AXL A;  2DJG B;  2CB5 A;  4PP2 E;  1KFU L;  3AI8 A;  1X9Y A;  5JA7 A;  1KHP A;  1F2B A;  2NQG A;  4YYR A;  4CDE B;  1GEC E;  4N8W A;  3KKU A;  3H89 A;  1QMY A;  1U9W A;  1BQI A;  3O1G A;  2F7D A;  4Q8H A;  1EWM A;  4QH6 A;  1ICF A;  4OEM A;  3P5V A;  1CPJ A;  3WXG A;  3HWN A;  4YYW A;  1SP4 B;  3S3R A;  3OVZ A;  3CH3 X;  2FUD A;  3IV2 A;  2IBI A;  3TNX A;  4AXM A;  1NPZ A;  1SNK A;  3KX1 A;  1MS6 A;  1AU3 A;  2VHS A;  2Y6E A;  4P6E A;  4YYV A;  2G8J A;  1CJL A;  3MHS A;  3PBH A;  2XU5 A;  1IWD A;  2E03 A;  4I04 A;  4X6I A;  2WBF X;  1Y4H A;  1EWL A;  3BPM A;  1PPN A;  2BDZ A;  3KW9 A;  1FH0 A;  3QT4 A;  1YT7 A;  3K24 A;  4DMY A;  3USV A;  5A24 A;  3M99 A;  1AEC A;  1AU4 A;  2FYE A;  3HHA A;  1PPO A;  1F29 A;  1BP4 A;  1KXR A;  2DC6 A;  1TU6 A;  4MZO A;  1NL6 A;  4P6G A;  3K9M A;  4CDF B;  1NLJ A;  1F2A A;  3HD3 A;  3OIS A;  2R6N A;  3BCN A;  4W5B A;  3KWB X;  4N4Z A;  1GCB A;  2DZY A;  6PAD A;  1O0E A;  1AYW A;  3V6E A;  4YVA A;  3N3K A;  4XUI A;  4XR7 A;  1PIP A;  1YK7 A;  5CVO B;  5J94 A;  1CS8 A;  4PAD A;  2NQA A;  3MHH A;  2DC8 A;  2AYN A;  2O6X A;  2R9O A;  3MTN A;  5PAD A;  1K3B B;  1U9Q X;  4YYU A;  1PPP A;  4PP1 A;  1ITO A;  1BY8 A;  3IHP A;  3N3G A;  2VHF A;  1YVB A;  4I07 A;  3WXE A;  2XU4 A;  2ATO A;  3LXS A;  2AYO A;  5CVM A;  4CDD B;  1DEU A;  1TLO A;  4W5C A;  1AIM A;  1U5I A;  4QRG A;  2DC7 A;  4RY2 A;  3PNR A;  5EGW A;  4BS6 A;  2FRA A;  1S4V A;  1QOL A;  5CVN B;  1KHQ A;  1Q6K A;  1CV8 A;  3BPF A;  1PAD A;  2G7Y A;  2XU3 A;  3H8B A;  2FO5 A;  2HH5 A;  3V6C A;  1POP A;  4PI3 A;  2P0R A;  1THE A;  3H6S A;  2E02 A;  3HHI A;  2P86 A;  2DZZ A;  1XKG A;  1YAL A;  1PXV A;  3P5X A;  1CB5 A;  2HD5 A;  3IUT A;  2GFO A;  2GHU A;  1ME4 A;  1ZCM A;  1ATK A;  4G54 A;  2JQG R;  4K7C A;  3GCB A;  2R9C A;  2HHN A;  4BQV A;  2AUX A;  3KWZ A;  1AYU A;  1ZIV A;  4BSQ A;  4YYQ A;  2R9N A;  4CZW A;  2OP3 A;  2DCB A;  2IPP B;  2YJ2 A;  2B1M A;  3QJ3 A;  2H7J A;  1PCI A;  4BPV A;  2CIO A;  1STF E;  1U9V A;  3E1Z B;  4X6H A;  1EWP A;  2FT2 A;  3N4C A;  5K16 A;  2G6D A;  3C9E A;  2R9M A;  3IEJ A;  3F75 A;  3KSE A;  2PRE A;  1EF7 A;  1AU2 A;  4BS5 A;  1EWO A;  8PCH A;  3PDF A;  3O0U A;  2AVW A;  4Q8G A;  2FQ9 A;  4FJC A;  1KFX L;  4FIP A;  1AYV A;  1HUC B;  5EF4 A;  1QDQ A;  1MEG A;  3P5W A;  2AUZ A;  1DF0 A;  1U9X A; 
#chains in the Genus database with same CATH topology
 4RF1 A;  5FPW A;  2YJ9 A;  3TRK A;  3U8E A;  3RVW A;  3B21 A;  3B79 A;  1A6R A;  3PHU A;  3RVX A;  5JZE A;  2E00 A;  4I05 A;  1GMY A;  1VSN A;  4N79 A;  2NQD B;  1TL9 A;  5JH3 A;  1Y08 A;  2BTW A;  1MIR A;  3PHX A;  3MOR A;  3CBK A;  3O65 A;  2YJ8 A;  3OF9 A;  2DCD A;  4KLB A;  1PE6 A;  1BGO A;  4RNA A;  4QRV A;  3IOQ A;  4MZS A;  2DOS A;  3DF0 A;  1QXP A;  2AGA A;  3IFU A;  2PBH A;  3OVX A;  4BOU A;  3F5V A;  1VJV A;  2E01 A;  5F02 A;  3W30 A;  2DJF B;  3NHE A;  3BC3 A;  4QRX A;  4YV8 A;  1MHW A;  3ZUA A;  1CSB B;  4ZUX U;  4MI7 A;  3I3T A;  2P7U A;  3MP2 A;  3IMA A;  3LFY A;  4WA6 A;  4DMX A;  2YJB A;  5EZQ A;  1MEM A;  3OF8 A;  2JQF R;  2NQI A;  4REZ A;  2YJC A;  3H8C A;  3CH2 X;  2JRI A;  4MSX A;  4WUR A;  3H7D A;  2G8E A;  4XZX A;  1PPD A;  2ACT A;  2OZ2 A;  3WXF A;  1M6D A;  2FRQ A;  3P5U A;  4X6J A;  2DCA A;  2AIM A;  1F2C A;  2OUL A;  1JQP A;  1NB3 A;  5EZS A;  5CHV A;  3I06 A;  1NQC A;  3PW3 A;  2PAD A;  1AU0 A;  1ME3 A;  3KFQ A;  4QBB A;  3QSD A;  4CDC B;  2F1G A;  1MDW A;  3BY4 A;  3BWK A;  4W4U A;  3BBA A;  1GLO A;  5CHT A;  4IP3 A;  3K8U A;  4RKX A;  2DC9 A;  5E6J A;  2Y5B A;  4BOS A;  3TMP A;  2PNS A;  2AU1 A;  3E9S A;  1NB5 A;  3D6S A;  4OW0 A;  3RVV A;  1YK8 A;  3S3Q A;  2BDL A;  4HWY A;  2R9F A;  3PHW A;  2FTD A;  2ARY A;  7PCK A;  1CTE A;  4FK5 A;  4HXD B;  4YYS A;  2C0Y A;  3CBJ A;  4M0W A;  2XU1 A;  2AS8 A;  1CQD A;  3ERV A;  3BB7 A;  2DCC A;  2B1N A;  2HXZ A;  1PVJ A;  9PAP A;  3BOW A;  1PBH A;  1CVZ A;  4OEL A;  4AXL A;  2DJG B;  2CB5 A;  4PP2 E;  1KFU L;  3PSE A;  3AI8 A;  1X9Y A;  4OVZ B;  5JA7 A;  1KHP A;  1F2B A;  2NQG A;  4YYR A;  4CDE B;  1GEC E;  4N8W A;  3KKU A;  4A5U A;  4RF0 A;  3H89 A;  1QMY A;  1U9W A;  4PT5 A;  1BQI A;  3O1G A;  2F7D A;  4Q8H A;  1EWM A;  4QH6 A;  1ICF A;  4OEM A;  4GUA A;  3P5V A;  1CPJ A;  3WXG A;  3HWN A;  4YYW A;  2BTW B;  1SP4 B;  3S3R A;  3OVZ A;  3CH3 X;  1YZB A;  2FUD A;  3IV2 A;  2IBI A;  3TNX A;  1UKF A;  4AXM A;  1NPZ A;  1SNK A;  3KX1 A;  1MS6 A;  1AU3 A;  2VHS A;  2Y6E A;  4P6E A;  4YYV A;  4BOP A;  2G8J A;  1CJL A;  3MHS A;  3PBH A;  2XU5 A;  1IWD A;  2E03 A;  4I04 A;  4X6I A;  2WBF X;  1Y4H A;  2J7Q C;  1EWL A;  3BPM A;  1PPN A;  2BDZ A;  3KW9 A;  4R3D A;  1FH0 A;  3QT4 A;  1YT7 A;  3K24 A;  4DMY A;  3USV A;  5A24 A;  3M99 A;  1AEC A;  1AU4 A;  2FYE A;  3HHA A;  4D8B A;  3C0R A;  1PPO A;  1F29 A;  1BP4 A;  1KXR A;  3RNV A;  2DC6 A;  2FE8 A;  1TU6 A;  4MZO A;  1NL6 A;  4P6G A;  3K9M A;  4CDF B;  3MJ5 A;  1NLJ A;  1F2A A;  3HD3 A;  4IUM A;  3OIS A;  2R6N A;  3BCN A;  4W5B A;  3KWB X;  4N4Z A;  1DKI A;  1GCB A;  2DZY A;  6PAD A;  1O0E A;  1AYW A;  3V6E A;  4YVA A;  3OQC A;  3N3K A;  4XUI A;  4XR7 A;  1PIP A;  1YK7 A;  5CVO B;  5J94 A;  3MTV A;  1CS8 A;  4PAD A;  2NQA A;  3MHH A;  2DC8 A;  2AYN A;  2BU3 A;  2O6X A;  2R9O A;  3MTN A;  5PAD A;  3ZNH A;  1K3B B;  1U9Q X;  4YYU A;  1PPP A;  4PP1 A;  1ITO A;  1BY8 A;  3IHP A;  3N3G A;  2VHF A;  1YVB A;  4I07 A;  3WXE A;  2XU4 A;  2ATO A;  3LXS A;  2AYO A;  5CVM A;  4CDD B;  1DEU A;  4ZTB A;  1TLO A;  4W5C A;  1AIM A;  2JTC A;  4BOQ A;  1U5I A;  4QRG A;  2DC7 A;  4RY2 A;  3PNR A;  5EGW A;  4BS6 A;  2FRA A;  1S4V A;  1QOL A;  4P16 A;  5CVN B;  1KHQ A;  1Q6K A;  4BOZ A;  1CV8 A;  4MM3 B;  3BPF A;  1PAD A;  2G7Y A;  2XU3 A;  3H8B A;  2FO5 A;  2HH5 A;  3V6C A;  1POP A;  4PI3 A;  2P0R A;  1THE A;  3H6S A;  2E02 A;  3HHI A;  2P86 A;  2DZZ A;  1XKG A;  1YAL A;  1PXV A;  3P5X A;  5KO3 A;  1CB5 A;  2HD5 A;  3IUT A;  2GFO A;  2GHU A;  1ME4 A;  1ZCM A;  1ATK A;  2HWK A;  4G54 A;  2JQG R;  4K7C A;  3GCB A;  2R9C A;  2HHN A;  4BQV A;  2AUX A;  3KWZ A;  2Z84 A;  1AYU A;  1ZIV A;  4BSQ A;  4YYQ A;  2R9N A;  4CZW A;  2OP3 A;  2DCB A;  2IPP B;  2YJ2 A;  2B1M A;  3QJ3 A;  2H7J A;  1PCI A;  4BPV A;  2CIO A;  1STF E;  1U9V A;  3E1Z B;  4X6H A;  1EWP A;  2FT2 A;  3N4C A;  5K16 A;  2G6D A;  3C9E A;  2R9M A;  3IEJ A;  4D8I A;  3PRP A;  3F75 A;  3KSE A;  2PRE A;  1EF7 A;  1AU2 A;  4BS5 A;  1EWO A;  3PRM A;  3PT2 A;  8PCH A;  3PDF A;  2UZJ A;  3O0U A;  2J7Q A;  2AVW A;  4Q8G A;  2FQ9 A;  4FJC A;  1KFX L;  4FIP A;  3W31 A;  1AYV A;  1HUC B;  5EF4 A;  1QDQ A;  1MEG A;  3P5W A;  4OVZ A;  2AUZ A;  4D8E A;  1DF0 A;  1U9X A; 
#chains in the Genus database with same CATH homology
 5FPW A;  2YJ9 A;  3U8E A;  3RVW A;  3B79 A;  1A6R A;  3RVX A;  2E00 A;  4I05 A;  1GMY A;  1VSN A;  4N79 A;  2NQD B;  1TL9 A;  5JH3 A;  1Y08 A;  1MIR A;  3MOR A;  3CBK A;  2YJ8 A;  3OF9 A;  2DCD A;  4KLB A;  1PE6 A;  1BGO A;  4QRV A;  3IOQ A;  4MZS A;  3DF0 A;  1QXP A;  2PBH A;  3OVX A;  3F5V A;  1VJV A;  2E01 A;  5F02 A;  2DJF B;  3NHE A;  3BC3 A;  4QRX A;  4YV8 A;  1MHW A;  3ZUA A;  1CSB B;  4ZUX U;  3I3T A;  2P7U A;  3IMA A;  3LFY A;  4WA6 A;  4DMX A;  2YJB A;  3OF8 A;  1MEM A;  2JQF R;  2NQI A;  2YJC A;  3H8C A;  3CH2 X;  4MSX A;  3H7D A;  2G8E A;  1PPD A;  2ACT A;  4GUZ A;  2OZ2 A;  3WXF A;  1M6D A;  2FRQ A;  3P5U A;  4X6J A;  2DCA A;  2AIM A;  1F2C A;  2OUL A;  1JQP A;  1NB3 A;  5CHV A;  3I06 A;  1NQC A;  3PW3 A;  2PAD A;  1AU0 A;  3KFQ A;  1ME3 A;  4QBB A;  3QSD A;  4CDC B;  2F1G A;  1MDW A;  3BWK A;  4W4U A;  1GLO A;  5CHT A;  3K8U A;  2DC9 A;  2Y5B A;  2PNS A;  2AU1 A;  1NB5 A;  3D6S A;  3RVV A;  1YK8 A;  3S3Q A;  2BDL A;  4HWY A;  3D9W A;  2R9F A;  2FTD A;  2ARY A;  7PCK A;  1CTE A;  4FK5 A;  4YYS A;  2C0Y A;  3CBJ A;  2XU1 A;  2AS8 A;  1CQD A;  4C5P A;  3ERV A;  2DCC A;  1W6F A;  2B1N A;  2HXZ A;  9PAP A;  3BOW A;  1PBH A;  1CVZ A;  4OEL A;  4AXL A;  2DJG B;  2VFC A;  2CB5 A;  4PP2 E;  1KFU L;  3AI8 A;  1X9Y A;  5JA7 A;  1KHP A;  1F2B A;  2NQG A;  4YYR A;  4CDE B;  1GEC E;  4N8W A;  3KKU A;  3H89 A;  1QMY A;  1U9W A;  1BQI A;  3O1G A;  3LTW A;  2F7D A;  4Q8H A;  1EWM A;  4QH6 A;  1ICF A;  4OEM A;  3P5V A;  1CPJ A;  3WXG A;  3HWN A;  4YYW A;  4BGF A;  1SP4 B;  3S3R A;  3OVZ A;  3CH3 X;  2FUD A;  3IV2 A;  2IBI A;  3TNX A;  1GX3 A;  4AXM A;  1NPZ A;  1SNK A;  3KX1 A;  1MS6 A;  1AU3 A;  2VHS A;  2Y6E A;  4P6E A;  4YYV A;  2G8J A;  1CJL A;  3MHS A;  3PBH A;  2XU5 A;  1IWD A;  2E03 A;  4I04 A;  4X6I A;  2WBF X;  1Y4H A;  1EWL A;  3BPM A;  1PPN A;  2BDZ A;  3KW9 A;  1FH0 A;  3QT4 A;  1YT7 A;  3K24 A;  4DMY A;  3USV A;  5A24 A;  3M99 A;  1AEC A;  1AU4 A;  1W5R A;  2FYE A;  3HHA A;  1PPO A;  1F29 A;  1BP4 A;  1KXR A;  2DC6 A;  1TU6 A;  4MZO A;  1NL6 A;  2VFB A;  4P6G A;  3K9M A;  4CDF B;  1NLJ A;  1F2A A;  3HD3 A;  3OIS A;  2R6N A;  3BCN A;  4W5B A;  3KWB X;  4N4Z A;  1GCB A;  2DZY A;  6PAD A;  1O0E A;  1AYW A;  3V6E A;  4B55 A;  4YVA A;  3N3K A;  4XUI A;  4XR7 A;  1PIP A;  1YK7 A;  5CVO B;  5J94 A;  1CS8 A;  4PAD A;  2NQA A;  3MHH A;  2DC8 A;  2AYN A;  2O6X A;  2R9O A;  3MTN A;  5PAD A;  1K3B B;  1U9Q X;  4YYU A;  1PPP A;  4PP1 A;  1ITO A;  1BY8 A;  3IHP A;  3N3G A;  2VHF A;  1YVB A;  4I07 A;  3WXE A;  2XU4 A;  2ATO A;  3LXS A;  2AYO A;  5CVM A;  4CDD B;  1DEU A;  1TLO A;  4W5C A;  1AIM A;  1U5I A;  4QRG A;  2DC7 A;  4RY2 A;  3PNR A;  5EGW A;  4BS6 A;  4NV7 A;  2FRA A;  1S4V A;  1QOL A;  5CVN B;  1KHQ A;  2BSZ A;  1Q6K A;  1CV8 A;  3BPF A;  1PAD A;  2G7Y A;  2XU3 A;  3H8B A;  4NV8 A;  2FO5 A;  2HH5 A;  3V6C A;  1POP A;  4PI3 A;  2P0R A;  1THE A;  3H6S A;  2E02 A;  3HHI A;  2P86 A;  2DZZ A;  1XKG A;  1YAL A;  1PXV A;  3P5X A;  1CB5 A;  2HD5 A;  3IUT A;  2GFO A;  2GHU A;  1ME4 A;  1ZCM A;  1ATK A;  4G54 A;  2JQG R;  4K7C A;  3GCB A;  2R9C A;  2HHN A;  4BQV A;  2AUX A;  3KWZ A;  1AYU A;  1ZIV A;  4BSQ A;  4YYQ A;  2R9N A;  4CZW A;  2OP3 A;  2DCB A;  2IPP B;  2YJ2 A;  2B1M A;  3QJ3 A;  2H7J A;  1PCI A;  4BPV A;  2CIO A;  1STF E;  1U9V A;  3E1Z B;  4X6H A;  1EWP A;  2FT2 A;  3N4C A;  5K16 A;  2G6D A;  3C9E A;  2R9M A;  3IEJ A;  3F75 A;  3KSE A;  2PRE A;  1EF7 A;  1AU2 A;  4BS5 A;  1EWO A;  8PCH A;  3PDF A;  3O0U A;  2AVW A;  4Q8G A;  2FQ9 A;  4FJC A;  1KFX L;  4FIP A;  1AYV A;  1HUC B;  1W4T A;  5EF4 A;  1QDQ A;  1MEG A;  3P5W A;  2AUZ A;  1DF0 A;  1E2T A;  1U9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...