1PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1padA00
4XR7A 1BQIA 1CS8A 1PXVA 3HD3A 1VSNA 1EWLA 3O0UA 1K3BB 4HWYA 5A24A 3USVA 1PE6A 1CPJA 2JQGR 3MHSA 1TL9A 3U8EA 2HXZA 1NB3A 1FH0A 2E01A 5J94A 1YALA 1TU6A 1IWDA 2FT2A 2OULA 1EWMA 2PADA 3F75A 3HWNA 1POPA 2BDZA 2F1GA 1S4VA 2R9FA 4MZOA 1ZCMA 1CB5A 2FO5A 3P5VA 3K24A 1MEMA 3OF9A 3D6SA 3CH3X 1MEGA 2R9NA 4N8WA 3KWBX 3MTNA 2G8JA 1AIMA 1YK8A 4MSXA 4QRXA 2XU4A 1AECA 3IEJA 3KFQA 4CDFB 1U5IA 8PCHA 1X9YA 1U9WA 4G54A 2ACTA 3IOQA 4QBBA 3P5UA 1EWOA 1U9XA 1PADA 2G8EA 2E02A 1BY8A 2PREA 2FYEA 3KW9A 5EGWA 1SP4B 3F5VA 2R9OA 2CB5A 2FTDA 1PBHA 1CQDA 1PPNA 2E00A 1ZIVA 2AVWA 1DF0A 2DZYA 1YT7A 2NQAA 3IHPA 2H7JA 1DEUA 2F7DA 2XU3A 5CVOB 4FIPA 4N4ZA 1BP4A 2P86A 4YV8A 2DC7A 3S3RA 2O6XA 2DC8A 1CTEA 3K8UA 4X6JA 4KLBA 2ARYA 1HUCB 3HHIA 4FK5A 4X6HA 4CDEB 1AYUA 2B1NA 4XUIA 3BPFA 1PIPA 2GHUA 3HHAA 1MHWA 1KXRA 3H7DA 1QDQA 3KSEA 3V6CA 1EWPA 4PP1A 4BPVA 4AXLA 3O1GA 1A6RA 1KHPA 1PPDA 2DCAA 2HH5A 3OVZA 2IPPB 2YJ8A 1GCBA 2OZ2A 3H8CA 5PADA 4WA6A 3KX1A 3LFYA 2VHSA 3N3GA 6PADA 3KKUA 1PPOA 3PBHA 2AU1A 1U9QX 4RY2A 4YYWA 1F2AA 1KHQA 4OELA 3P5XA 4BS6A 4W5CA 1AU3A 3DF0A 3N4CA 2YJCA 1AU4A 1CSBB 1Y08A 4MZSA 4QH6A 3S3QA 2DCDA 1KFXL 3K9MA 4I04A 5CHTA 3WXFA 1SNKA 2XU1A 1STFE 1NPZA 3PW3A 2P0RA 1AU0A 1EF7A 3C9EA 3AI8A 2G7YA 1M6DA 3QJ3A 4YYSA 3I3TA 2DJFB 2AYOA 5JH3A 3IUTA 3E1ZB 2NQGA 4BS5A 3MORA 3LXSA 2R9CA 1QMYA 2G6DA 4CZWA 3H6SA 4BSQA 1TLOA 2Y5BA 1XKGA 1GMYA 3PDFA 1ICFA 2B1MA 2DZZA 2ATOA 5JA7A 2NQIA 4X6IA 5FPWA 4I07A 1VJVA 4BQVA 2DC9A 4AXMA 2FQ9A 4K7CA 3OF8A 2E03A 3BCNA 5F02A 2NQDB 1QOLA 1YK7A 4DMXA 2R9MA 1NL6A 1GECE 4YYRA 2DCCA 3MHHA 2DJGB 2AUXA 4QRVA 1CJLA 2BDLA 3OISA 2YJBA 2AYNA 4Q8HA 4ZUXU 5CVMA 3QSDA 1CV8A 4P6EA 3ERVA 4Q8GA 4PADA 3PNRA 1BGOA 1THEA 3BC3A 4N79A 1CVZA 4QRGA 3CBKA 2JQFR 1QXPA 2Y6EA 2PBHA 2PNSA 3B79A 2AIMA 3RVXA 3TNXA 2OP3A 5EF4A 2C0YA 4P6GA 3IV2A 1AU2A 1AYWA 2HHNA 4YYUA 2YJ2A 1O0EA 2XU5A 4PI3A 1NB5A 2CIOA 2HD5A 4YYVA 2WBFX 1MIRA 1F29A 1F2BA 7PCKA 3CH2X 3NHEA 1Y4HA 2AS8A 1MS6A 1YVBA 2FUDA 2R6NA 3V6EA 1GLOA 2P7UA 3N3KA 1U9VA 3WXEA 5CVNB 2GFOA 4OEMA 1Q6KA 5K16A 3OVXA 2YJ9A 3ZUAA 2IBIA 2DC6A 2AUZA 4CDCB 3BOWA 2FRQA 4YVAA 4CDDB 1PCIA 3RVWA 4FJCA 4PP2E 1MDWA 1JQPA 1F2CA 4I05A 1PPPA 3WXGA 1ATKA 2DCBA 4W5BA 2FRAA 1NQCA 5CHVA 3H89A 3CBJA 3P5WA 1NLJA 9PAPA 1ITOA 1ME3A 3I06A 4DMYA 3BWKA 1ME4A 1AYVA 3KWZA 3BPMA 4W4UA 3QT4A 3GCBA 1KFUL 3M99A 3RVVA 2VHFA 3H8BA 3IMAA 4YYQA
chains in the Genus database with same CATH superfamily
4MM3B 4XR7A 1BQIA 1CS8A 1PXVA 3HD3A 1VSNA 4PT5A 1EWLA 3O0UA 1K3BB 4HWYA 5A24A 3USVA 3O65A 1PE6A 1CPJA 2JQGR 3MHSA 1TL9A 4ZTBA 3U8EA 2HXZA 4WURA 1NB3A 1FH0A 2E01A 5J94A 1YALA 1TU6A 3ZNHA 1IWDA 2FT2A 2OULA 3PT2A 1EWMA 2PADA 3F75A 3HWNA 1POPA 2BDZA 2F1GA 1S4VA 2R9FA 4MZOA 1ZCMA 1CB5A 2FO5A 4RNAA 2FE8A 3P5VA 3K24A 1MEMA 3OF9A 2AGAA 3D6SA 3CH3X 1MEGA 3B21A 2R9NA 4N8WA 3KWBX 3MTNA 2G8JA 2JRIA 1AIMA 1YK8A 4MSXA 4QRXA 4BOSA 2XU4A 1AECA 3IEJA 3KFQA 4CDFB 1U5IA 8PCHA 1X9YA 4OW0A 1U9WA 4G54A 2ACTA 3IOQA 4QBBA 3P5UA 1EWOA 1U9XA 1PADA 4A5UA 3PRPA 2G8EA 2E02A 1BY8A 4REZA 4IP3A 2PREA 2FYEA 3KW9A 5EGWA 1SP4B 3F5VA 2R9OA 2CB5A 2FTDA 1PBHA 1CQDA 1PPNA 2E00A 1ZIVA 4RF0A 2AVWA 4IUMA 1DF0A 2DZYA 3W31A 1YT7A 2NQAA 3IHPA 4GUAA 4RKXA 2H7JA 4OVZB 1DEUA 2F7DA 2DOSA 2XU3A 5CVOB 4FIPA 4N4ZA 1BP4A 2P86A 4YV8A 2DC7A 3S3RA 2O6XA 2DC8A 1CTEA 3K8UA 4X6JA 4KLBA 2ARYA 1HUCB 3HHIA 4FK5A 4X6HA 4CDEB 1AYUA 3BY4A 2J7QC 2B1NA 4XUIA 3PHWA 3BPFA 1PIPA 2GHUA 3PHXA 3HHAA 1MHWA 1KXRA 3H7DA 1QDQA 3KSEA 3V6CA 1EWPA 4OVZA 4PP1A 4BPVA 4AXLA 3O1GA 1A6RA 1KHPA 5EZQA 1PPDA 2DCAA 2HH5A 3OVZA 2IPPB 4XZXA 2YJ8A 1GCBA 2OZ2A 3H8CA 4BOPA 5PADA 4WA6A 3KX1A 3LFYA 2VHSA 3N3GA 6PADA 3KKUA 1PPOA 3PBHA 2AU1A 1U9QX 4RY2A 4YYWA 1F2AA 4D8EA 1KHQA 4OELA 3P5XA 3C0RA 4BS6A 4W5CA 1AU3A 4RF1A 3DF0A 3E9SA 3N4CA 2YJCA 1AU4A 1CSBB 1Y08A 4MZSA 4QH6A 3S3QA 2DCDA 1KFXL 4M0WA 3K9MA 4I04A 5CHTA 3WXFA 1SNKA 2XU1A 1STFE 3OQCA 1NPZA 3PW3A 4BOZA 2P0RA 1AU0A 1EF7A 3C9EA 3AI8A 2G7YA 1M6DA 3QJ3A 4YYSA 3I3TA 3MJ5A 3TMPA 2DJFB 2AYOA 5JH3A 3IUTA 3E1ZB 2NQGA 4BS5A 3MORA 3LXSA 2R9CA 1QMYA 2G6DA 4CZWA 3H6SA 4BSQA 1TLOA 3W30A 2Y5BA 1XKGA 1GMYA 3PDFA 3MP2A 1ICFA 2B1MA 2DZZA 4R3DA 2ATOA 5JA7A 3PRMA 2NQIA 4X6IA 5FPWA 4I07A 1VJVA 2BTWA 4BQVA 4P16A 2DC9A 4AXMA 2FQ9A 4K7CA 3OF8A 2E03A 3BCNA 5F02A 2NQDB 1QOLA 1YK7A 4DMXA 2JTCA 2BTWB 2R9MA 1NL6A 1GECE 4YYRA 2DCCA 3MHHA 2DJGB 2AUXA 1CJLA 2BDLA 4QRVA 3OISA 2YJBA 5E6JA 2AYNA 4Q8HA 5EZSA 4ZUXU 5CVMA 3QSDA 1CV8A 4P6EA 3ERVA 4Q8GA 4PADA 3PNRA 1BGOA 1THEA 3BC3A 4N79A 1CVZA 4QRGA 4BOQA 3CBKA 2JQFR 1QXPA 2Y6EA 2PBHA 2PNSA 3B79A 3BB7A 2AIMA 3RVXA 3TNXA 2OP3A 5EF4A 2C0YA 4P6GA 4HXDB 3IV2A 1AU2A 1AYWA 2HHNA 1DKIA 4YYUA 2YJ2A 1O0EA 2XU5A 4PI3A 1NB5A 2CIOA 2HD5A 4YYVA 2WBFX 1MIRA 3IFUA 1F29A 1F2BA 7PCKA 3CH2X 3NHEA 1Y4HA 2AS8A 1MS6A 1YZBA 1YVBA 2FUDA 2R6NA 3V6EA 2BU3A 1GLOA 2P7UA 3N3KA 1U9VA 3WXEA 5CVNB 2GFOA 4OEMA 1Q6KA 5K16A 4D8IA 3OVXA 2YJ9A 2UZJA 3ZUAA 2IBIA 2Z84A 3BBAA 2J7QA 2DC6A 3RNVA 2AUZA 4CDCB 3BOWA 2FRQA 3PHUA 4BOUA 4CDDB 4YVAA 1PCIA 3RVWA 4FJCA 4PP2E 1MDWA 1JQPA 1F2CA 3PSEA 4I05A 1PPPA 3WXGA 4MI7A 3TRKA 1ATKA 1UKFA 2DCBA 4W5BA 2FRAA 1NQCA 2HWKA 5CHVA 3H89A 3CBJA 3P5WA 4D8BA 1NLJA 9PAPA 1ITOA 1PVJA 1ME3A 3I06A 4DMYA 3BWKA 1ME4A 1AYVA 3KWZA 3BPMA 5KO3A 4W4UA 3QT4A 3GCBA 1KFUL 5JZEA 3M99A 3RVVA 2VHFA 3H8BA 3MTVA 3IMAA 4YYQA
chains in the Genus database with same CATH topology
2VFBA 4XR7A 1BQIA 1CS8A 1PXVA 3HD3A 1VSNA 1EWLA 3O0UA 1K3BB 4HWYA 5A24A 3USVA 4B55A 1E2TA 1PE6A 1CPJA 2JQGR 3MHSA 1TL9A 3U8EA 2HXZA 1NB3A 1FH0A 2E01A 5J94A 1YALA 1TU6A 1IWDA 2FT2A 2OULA 1EWMA 2PADA 3F75A 3HWNA 1POPA 2BDZA 2F1GA 1S4VA 2R9FA 4MZOA 1ZCMA 1CB5A 2FO5A 3P5VA 3K24A 1MEMA 3OF9A 3D6SA 3CH3X 1MEGA 2R9NA 4N8WA 3KWBX 3MTNA 2G8JA 1AIMA 1YK8A 4MSXA 4QRXA 2XU4A 1AECA 3IEJA 3KFQA 4CDFB 1U5IA 3D9WA 8PCHA 1X9YA 1U9WA 4G54A 2ACTA 3IOQA 4QBBA 3P5UA 2BSZA 1GX3A 1EWOA 1U9XA 1PADA 2G8EA 2E02A 1BY8A 2PREA 2FYEA 3KW9A 5EGWA 1SP4B 3F5VA 2R9OA 2CB5A 2FTDA 1PBHA 1CQDA 1W4TA 1PPNA 2E00A 3LTWA 1ZIVA 2AVWA 1DF0A 2DZYA 1YT7A 2NQAA 3IHPA 2H7JA 1DEUA 2F7DA 2XU3A 5CVOB 4FIPA 4N4ZA 1BP4A 2P86A 4YV8A 2DC7A 3S3RA 2O6XA 2DC8A 1CTEA 3K8UA 4X6JA 4KLBA 2ARYA 1HUCB 3HHIA 4FK5A 4X6HA 4CDEB 1AYUA 2B1NA 4XUIA 3BPFA 1PIPA 2GHUA 3HHAA 1MHWA 1KXRA 3H7DA 1QDQA 3KSEA 3V6CA 1EWPA 4PP1A 4BPVA 4AXLA 3O1GA 1A6RA 1KHPA 1PPDA 2DCAA 2HH5A 3OVZA 2IPPB 2YJ8A 1GCBA 2OZ2A 3H8CA 5PADA 4WA6A 3KX1A 3LFYA 2VHSA 3N3GA 6PADA 3KKUA 1PPOA 3PBHA 2AU1A 1U9QX 4RY2A 4YYWA 1F2AA 1KHQA 4OELA 3P5XA 4BS6A 4W5CA 1AU3A 3DF0A 3N4CA 2YJCA 1AU4A 1CSBB 1Y08A 4MZSA 2VFCA 4QH6A 3S3QA 2DCDA 1KFXL 3K9MA 4I04A 5CHTA 3WXFA 1SNKA 2XU1A 1STFE 1NPZA 3PW3A 2P0RA 1AU0A 1EF7A 3C9EA 3AI8A 2G7YA 1M6DA 3QJ3A 4YYSA 3I3TA 2DJFB 1W6FA 2AYOA 5JH3A 3IUTA 3E1ZB 2NQGA 4BS5A 3MORA 3LXSA 2R9CA 1QMYA 2G6DA 4CZWA 3H6SA 4BSQA 1TLOA 2Y5BA 1XKGA 1GMYA 3PDFA 1ICFA 2B1MA 2DZZA 2ATOA 5JA7A 2NQIA 4X6IA 5FPWA 4I07A 1VJVA 4BQVA 2DC9A 4AXMA 2FQ9A 4K7CA 3OF8A 2E03A 3BCNA 5F02A 2NQDB 1QOLA 1YK7A 4DMXA 2R9MA 1NL6A 1GECE 4YYRA 2DCCA 3MHHA 2DJGB 2AUXA 1CJLA 2BDLA 4QRVA 3OISA 2YJBA 2AYNA 4Q8HA 4ZUXU 5CVMA 3QSDA 1CV8A 4P6EA 3ERVA 4Q8GA 4PADA 3PNRA 1BGOA 1THEA 3BC3A 4N79A 1CVZA 4QRGA 4NV8A 3CBKA 2JQFR 1QXPA 2Y6EA 2PBHA 2PNSA 3B79A 2AIMA 3RVXA 3TNXA 2OP3A 5EF4A 2C0YA 4P6GA 3IV2A 1AU2A 1AYWA 2HHNA 4GUZA 4YYUA 2YJ2A 1O0EA 2XU5A 4PI3A 1NB5A 2CIOA 2HD5A 4YYVA 2WBFX 1MIRA 1F29A 1F2BA 1W5RA 7PCKA 3CH2X 3NHEA 1Y4HA 2AS8A 1MS6A 1YVBA 2FUDA 2R6NA 3V6EA 1GLOA 2P7UA 3N3KA 1U9VA 3WXEA 5CVNB 2GFOA 4OEMA 1Q6KA 4NV7A 5K16A 3OVXA 2YJ9A 3ZUAA 2IBIA 2DC6A 2AUZA 4CDCB 3BOWA 2FRQA 4YVAA 4CDDB 1PCIA 3RVWA 4FJCA 4PP2E 1MDWA 1JQPA 1F2CA 4I05A 1PPPA 3WXGA 1ATKA 2DCBA 4W5BA 2FRAA 1NQCA 5CHVA 3H89A 3CBJA 3P5WA 1NLJA 9PAPA 1ITOA 1ME3A 3I06A 4DMYA 3BWKA 1ME4A 1AYVA 3KWZA 3BPMA 4W4UA 3QT4A 3GCBA 1KFUL 3M99A 3RVVA 4BGFA 2VHFA 3H8BA 3IMAA 4YYQA 4C5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XR7 A;  1BQI A;  1CS8 A;  1PXV A;  3HD3 A;  1VSN A;  1EWL A;  3O0U A;  1K3B B;  4HWY A;  5A24 A;  3USV A;  1PE6 A;  1CPJ A;  2JQG R;  3MHS A;  1TL9 A;  3U8E A;  2HXZ A;  1NB3 A;  1FH0 A;  2E01 A;  5J94 A;  1YAL A;  1TU6 A;  1IWD A;  2FT2 A;  2OUL A;  1EWM A;  2PAD A;  3F75 A;  3HWN A;  1POP A;  2BDZ A;  2F1G A;  1S4V A;  2R9F A;  4MZO A;  1ZCM A;  1CB5 A;  2FO5 A;  3P5V A;  3K24 A;  1MEM A;  3OF9 A;  3D6S A;  3CH3 X;  1MEG A;  2R9N A;  4N8W A;  3KWB X;  3MTN A;  2G8J A;  1AIM A;  1YK8 A;  4MSX A;  4QRX A;  2XU4 A;  1AEC A;  3IEJ A;  3KFQ A;  4CDF B;  1U5I A;  8PCH A;  1X9Y A;  1U9W A;  4G54 A;  2ACT A;  3IOQ A;  4QBB A;  3P5U A;  1EWO A;  1U9X A;  1PAD A;  2G8E A;  2E02 A;  1BY8 A;  2PRE A;  2FYE A;  3KW9 A;  5EGW A;  1SP4 B;  3F5V A;  2R9O A;  2CB5 A;  2FTD A;  1PBH A;  1CQD A;  1PPN A;  2E00 A;  1ZIV A;  2AVW A;  1DF0 A;  2DZY A;  1YT7 A;  2NQA A;  3IHP A;  2H7J A;  1DEU A;  2F7D A;  2XU3 A;  5CVO B;  4FIP A;  4N4Z A;  1BP4 A;  2P86 A;  4YV8 A;  2DC7 A;  3S3R A;  2O6X A;  2DC8 A;  1CTE A;  3K8U A;  4X6J A;  4KLB A;  2ARY A;  1HUC B;  3HHI A;  4FK5 A;  4X6H A;  4CDE B;  1AYU A;  2B1N A;  4XUI A;  3BPF A;  1PIP A;  2GHU A;  3HHA A;  1MHW A;  1KXR A;  3H7D A;  1QDQ A;  3KSE A;  3V6C A;  1EWP A;  4PP1 A;  4BPV A;  4AXL A;  3O1G A;  1A6R A;  1KHP A;  1PPD A;  2DCA A;  2HH5 A;  3OVZ A;  2IPP B;  2YJ8 A;  1GCB A;  2OZ2 A;  3H8C A;  5PAD A;  4WA6 A;  3KX1 A;  3LFY A;  2VHS A;  3N3G A;  6PAD A;  3KKU A;  1PPO A;  3PBH A;  2AU1 A;  1U9Q X;  4RY2 A;  4YYW A;  1F2A A;  1KHQ A;  4OEL A;  3P5X A;  4BS6 A;  4W5C A;  1AU3 A;  3DF0 A;  3N4C A;  2YJC A;  1AU4 A;  1CSB B;  1Y08 A;  4MZS A;  4QH6 A;  3S3Q A;  2DCD A;  1KFX L;  3K9M A;  4I04 A;  5CHT A;  3WXF A;  1SNK A;  2XU1 A;  1STF E;  1NPZ A;  3PW3 A;  2P0R A;  1AU0 A;  1EF7 A;  3C9E A;  3AI8 A;  2G7Y A;  1M6D A;  3QJ3 A;  4YYS A;  3I3T A;  2DJF B;  2AYO A;  5JH3 A;  3IUT A;  3E1Z B;  2NQG A;  4BS5 A;  3MOR A;  3LXS A;  2R9C A;  1QMY A;  2G6D A;  4CZW A;  3H6S A;  4BSQ A;  1TLO A;  2Y5B A;  1XKG A;  1GMY A;  3PDF A;  1ICF A;  2B1M A;  2DZZ A;  2ATO A;  5JA7 A;  2NQI A;  4X6I A;  5FPW A;  4I07 A;  1VJV A;  4BQV A;  2DC9 A;  4AXM A;  2FQ9 A;  4K7C A;  3OF8 A;  2E03 A;  3BCN A;  5F02 A;  2NQD B;  1QOL A;  1YK7 A;  4DMX A;  2R9M A;  1NL6 A;  1GEC E;  4YYR A;  2DCC A;  3MHH A;  2DJG B;  2AUX A;  4QRV A;  1CJL A;  2BDL A;  3OIS A;  2YJB A;  2AYN A;  4Q8H A;  4ZUX U;  5CVM A;  3QSD A;  1CV8 A;  4P6E A;  3ERV A;  4Q8G A;  4PAD A;  3PNR A;  1BGO A;  1THE A;  3BC3 A;  4N79 A;  1CVZ A;  4QRG A;  3CBK A;  2JQF R;  1QXP A;  2Y6E A;  2PBH A;  2PNS A;  3B79 A;  2AIM A;  3RVX A;  3TNX A;  2OP3 A;  5EF4 A;  2C0Y A;  4P6G A;  3IV2 A;  1AU2 A;  1AYW A;  2HHN A;  4YYU A;  2YJ2 A;  1O0E A;  2XU5 A;  4PI3 A;  1NB5 A;  2CIO A;  2HD5 A;  4YYV A;  2WBF X;  1MIR A;  1F29 A;  1F2B A;  7PCK A;  3CH2 X;  3NHE A;  1Y4H A;  2AS8 A;  1MS6 A;  1YVB A;  2FUD A;  2R6N A;  3V6E A;  1GLO A;  2P7U A;  3N3K A;  1U9V A;  3WXE A;  5CVN B;  2GFO A;  4OEM A;  1Q6K A;  5K16 A;  3OVX A;  2YJ9 A;  3ZUA A;  2IBI A;  2DC6 A;  2AUZ A;  4CDC B;  3BOW A;  2FRQ A;  4YVA A;  4CDD B;  1PCI A;  3RVW A;  4FJC A;  4PP2 E;  1MDW A;  1JQP A;  1F2C A;  4I05 A;  1PPP A;  3WXG A;  1ATK A;  2DCB A;  4W5B A;  2FRA A;  1NQC A;  5CHV A;  3H89 A;  3CBJ A;  3P5W A;  1NLJ A;  9PAP A;  1ITO A;  1ME3 A;  3I06 A;  4DMY A;  3BWK A;  1ME4 A;  1AYV A;  3KWZ A;  3BPM A;  4W4U A;  3QT4 A;  3GCB A;  1KFU L;  3M99 A;  3RVV A;  2VHF A;  3H8B A;  3IMA A;  4YYQ A; 
#chains in the Genus database with same CATH topology
 4MM3 B;  4XR7 A;  1BQI A;  1CS8 A;  1PXV A;  3HD3 A;  1VSN A;  4PT5 A;  1EWL A;  3O0U A;  1K3B B;  4HWY A;  5A24 A;  3USV A;  3O65 A;  1PE6 A;  1CPJ A;  2JQG R;  3MHS A;  1TL9 A;  4ZTB A;  3U8E A;  2HXZ A;  4WUR A;  1NB3 A;  1FH0 A;  2E01 A;  5J94 A;  1YAL A;  1TU6 A;  3ZNH A;  1IWD A;  2FT2 A;  2OUL A;  3PT2 A;  1EWM A;  2PAD A;  3F75 A;  3HWN A;  1POP A;  2BDZ A;  2F1G A;  1S4V A;  2R9F A;  4MZO A;  1ZCM A;  1CB5 A;  2FO5 A;  4RNA A;  2FE8 A;  3P5V A;  3K24 A;  1MEM A;  3OF9 A;  2AGA A;  3D6S A;  3CH3 X;  1MEG A;  3B21 A;  2R9N A;  4N8W A;  3KWB X;  3MTN A;  2G8J A;  2JRI A;  1AIM A;  1YK8 A;  4MSX A;  4QRX A;  4BOS A;  2XU4 A;  1AEC A;  3IEJ A;  3KFQ A;  4CDF B;  1U5I A;  8PCH A;  1X9Y A;  4OW0 A;  1U9W A;  4G54 A;  2ACT A;  3IOQ A;  4QBB A;  3P5U A;  1EWO A;  1U9X A;  1PAD A;  4A5U A;  3PRP A;  2G8E A;  2E02 A;  1BY8 A;  4REZ A;  4IP3 A;  2PRE A;  2FYE A;  3KW9 A;  5EGW A;  1SP4 B;  3F5V A;  2R9O A;  2CB5 A;  2FTD A;  1PBH A;  1CQD A;  1PPN A;  2E00 A;  1ZIV A;  4RF0 A;  2AVW A;  4IUM A;  1DF0 A;  2DZY A;  3W31 A;  1YT7 A;  2NQA A;  3IHP A;  4GUA A;  4RKX A;  2H7J A;  4OVZ B;  1DEU A;  2F7D A;  2DOS A;  2XU3 A;  5CVO B;  4FIP A;  4N4Z A;  1BP4 A;  2P86 A;  4YV8 A;  2DC7 A;  3S3R A;  2O6X A;  2DC8 A;  1CTE A;  3K8U A;  4X6J A;  4KLB A;  2ARY A;  1HUC B;  3HHI A;  4FK5 A;  4X6H A;  4CDE B;  1AYU A;  3BY4 A;  2J7Q C;  2B1N A;  4XUI A;  3PHW A;  3BPF A;  1PIP A;  2GHU A;  3PHX A;  3HHA A;  1MHW A;  1KXR A;  3H7D A;  1QDQ A;  3KSE A;  3V6C A;  1EWP A;  4OVZ A;  4PP1 A;  4BPV A;  4AXL A;  3O1G A;  1A6R A;  1KHP A;  5EZQ A;  1PPD A;  2DCA A;  2HH5 A;  3OVZ A;  2IPP B;  4XZX A;  2YJ8 A;  1GCB A;  2OZ2 A;  3H8C A;  4BOP A;  5PAD A;  4WA6 A;  3KX1 A;  3LFY A;  2VHS A;  3N3G A;  6PAD A;  3KKU A;  1PPO A;  3PBH A;  2AU1 A;  1U9Q X;  4RY2 A;  4YYW A;  1F2A A;  4D8E A;  1KHQ A;  4OEL A;  3P5X A;  3C0R A;  4BS6 A;  4W5C A;  1AU3 A;  4RF1 A;  3DF0 A;  3E9S A;  3N4C A;  2YJC A;  1AU4 A;  1CSB B;  1Y08 A;  4MZS A;  4QH6 A;  3S3Q A;  2DCD A;  1KFX L;  4M0W A;  3K9M A;  4I04 A;  5CHT A;  3WXF A;  1SNK A;  2XU1 A;  1STF E;  3OQC A;  1NPZ A;  3PW3 A;  4BOZ A;  2P0R A;  1AU0 A;  1EF7 A;  3C9E A;  3AI8 A;  2G7Y A;  1M6D A;  3QJ3 A;  4YYS A;  3I3T A;  3MJ5 A;  3TMP A;  2DJF B;  2AYO A;  5JH3 A;  3IUT A;  3E1Z B;  2NQG A;  4BS5 A;  3MOR A;  3LXS A;  2R9C A;  1QMY A;  2G6D A;  4CZW A;  3H6S A;  4BSQ A;  1TLO A;  3W30 A;  2Y5B A;  1XKG A;  1GMY A;  3PDF A;  3MP2 A;  1ICF A;  2B1M A;  2DZZ A;  4R3D A;  2ATO A;  5JA7 A;  3PRM A;  2NQI A;  4X6I A;  5FPW A;  4I07 A;  1VJV A;  2BTW A;  4BQV A;  4P16 A;  2DC9 A;  4AXM A;  2FQ9 A;  4K7C A;  3OF8 A;  2E03 A;  3BCN A;  5F02 A;  2NQD B;  1QOL A;  1YK7 A;  4DMX A;  2JTC A;  2BTW B;  2R9M A;  1NL6 A;  1GEC E;  4YYR A;  2DCC A;  3MHH A;  2DJG B;  2AUX A;  1CJL A;  2BDL A;  4QRV A;  3OIS A;  2YJB A;  5E6J A;  2AYN A;  4Q8H A;  5EZS A;  4ZUX U;  5CVM A;  3QSD A;  1CV8 A;  4P6E A;  3ERV A;  4Q8G A;  4PAD A;  3PNR A;  1BGO A;  1THE A;  3BC3 A;  4N79 A;  1CVZ A;  4QRG A;  4BOQ A;  3CBK A;  2JQF R;  1QXP A;  2Y6E A;  2PBH A;  2PNS A;  3B79 A;  3BB7 A;  2AIM A;  3RVX A;  3TNX A;  2OP3 A;  5EF4 A;  2C0Y A;  4P6G A;  4HXD B;  3IV2 A;  1AU2 A;  1AYW A;  2HHN A;  1DKI A;  4YYU A;  2YJ2 A;  1O0E A;  2XU5 A;  4PI3 A;  1NB5 A;  2CIO A;  2HD5 A;  4YYV A;  2WBF X;  1MIR A;  3IFU A;  1F29 A;  1F2B A;  7PCK A;  3CH2 X;  3NHE A;  1Y4H A;  2AS8 A;  1MS6 A;  1YZB A;  1YVB A;  2FUD A;  2R6N A;  3V6E A;  2BU3 A;  1GLO A;  2P7U A;  3N3K A;  1U9V A;  3WXE A;  5CVN B;  2GFO A;  4OEM A;  1Q6K A;  5K16 A;  4D8I A;  3OVX A;  2YJ9 A;  2UZJ A;  3ZUA A;  2IBI A;  2Z84 A;  3BBA A;  2J7Q A;  2DC6 A;  3RNV A;  2AUZ A;  4CDC B;  3BOW A;  2FRQ A;  3PHU A;  4BOU A;  4CDD B;  4YVA A;  1PCI A;  3RVW A;  4FJC A;  4PP2 E;  1MDW A;  1JQP A;  1F2C A;  3PSE A;  4I05 A;  1PPP A;  3WXG A;  4MI7 A;  3TRK A;  1ATK A;  1UKF A;  2DCB A;  4W5B A;  2FRA A;  1NQC A;  2HWK A;  5CHV A;  3H89 A;  3CBJ A;  3P5W A;  4D8B A;  1NLJ A;  9PAP A;  1ITO A;  1PVJ A;  1ME3 A;  3I06 A;  4DMY A;  3BWK A;  1ME4 A;  1AYV A;  3KWZ A;  3BPM A;  5KO3 A;  4W4U A;  3QT4 A;  3GCB A;  1KFU L;  5JZE A;  3M99 A;  3RVV A;  2VHF A;  3H8B A;  3MTV A;  3IMA A;  4YYQ A; 
#chains in the Genus database with same CATH homology
 2VFB A;  4XR7 A;  1BQI A;  1CS8 A;  1PXV A;  3HD3 A;  1VSN A;  1EWL A;  3O0U A;  1K3B B;  4HWY A;  5A24 A;  3USV A;  4B55 A;  1E2T A;  1PE6 A;  1CPJ A;  2JQG R;  3MHS A;  1TL9 A;  3U8E A;  2HXZ A;  1NB3 A;  1FH0 A;  2E01 A;  5J94 A;  1YAL A;  1TU6 A;  1IWD A;  2FT2 A;  2OUL A;  1EWM A;  2PAD A;  3F75 A;  3HWN A;  1POP A;  2BDZ A;  2F1G A;  1S4V A;  2R9F A;  4MZO A;  1ZCM A;  1CB5 A;  2FO5 A;  3P5V A;  3K24 A;  1MEM A;  3OF9 A;  3D6S A;  3CH3 X;  1MEG A;  2R9N A;  4N8W A;  3KWB X;  3MTN A;  2G8J A;  1AIM A;  1YK8 A;  4MSX A;  4QRX A;  2XU4 A;  1AEC A;  3IEJ A;  3KFQ A;  4CDF B;  1U5I A;  3D9W A;  8PCH A;  1X9Y A;  1U9W A;  4G54 A;  2ACT A;  3IOQ A;  4QBB A;  3P5U A;  2BSZ A;  1GX3 A;  1EWO A;  1U9X A;  1PAD A;  2G8E A;  2E02 A;  1BY8 A;  2PRE A;  2FYE A;  3KW9 A;  5EGW A;  1SP4 B;  3F5V A;  2R9O A;  2CB5 A;  2FTD A;  1PBH A;  1CQD A;  1W4T A;  1PPN A;  2E00 A;  3LTW A;  1ZIV A;  2AVW A;  1DF0 A;  2DZY A;  1YT7 A;  2NQA A;  3IHP A;  2H7J A;  1DEU A;  2F7D A;  2XU3 A;  5CVO B;  4FIP A;  4N4Z A;  1BP4 A;  2P86 A;  4YV8 A;  2DC7 A;  3S3R A;  2O6X A;  2DC8 A;  1CTE A;  3K8U A;  4X6J A;  4KLB A;  2ARY A;  1HUC B;  3HHI A;  4FK5 A;  4X6H A;  4CDE B;  1AYU A;  2B1N A;  4XUI A;  3BPF A;  1PIP A;  2GHU A;  3HHA A;  1MHW A;  1KXR A;  3H7D A;  1QDQ A;  3KSE A;  3V6C A;  1EWP A;  4PP1 A;  4BPV A;  4AXL A;  3O1G A;  1A6R A;  1KHP A;  1PPD A;  2DCA A;  2HH5 A;  3OVZ A;  2IPP B;  2YJ8 A;  1GCB A;  2OZ2 A;  3H8C A;  5PAD A;  4WA6 A;  3KX1 A;  3LFY A;  2VHS A;  3N3G A;  6PAD A;  3KKU A;  1PPO A;  3PBH A;  2AU1 A;  1U9Q X;  4RY2 A;  4YYW A;  1F2A A;  1KHQ A;  4OEL A;  3P5X A;  4BS6 A;  4W5C A;  1AU3 A;  3DF0 A;  3N4C A;  2YJC A;  1AU4 A;  1CSB B;  1Y08 A;  4MZS A;  2VFC A;  4QH6 A;  3S3Q A;  2DCD A;  1KFX L;  3K9M A;  4I04 A;  5CHT A;  3WXF A;  1SNK A;  2XU1 A;  1STF E;  1NPZ A;  3PW3 A;  2P0R A;  1AU0 A;  1EF7 A;  3C9E A;  3AI8 A;  2G7Y A;  1M6D A;  3QJ3 A;  4YYS A;  3I3T A;  2DJF B;  1W6F A;  2AYO A;  5JH3 A;  3IUT A;  3E1Z B;  2NQG A;  4BS5 A;  3MOR A;  3LXS A;  2R9C A;  1QMY A;  2G6D A;  4CZW A;  3H6S A;  4BSQ A;  1TLO A;  2Y5B A;  1XKG A;  1GMY A;  3PDF A;  1ICF A;  2B1M A;  2DZZ A;  2ATO A;  5JA7 A;  2NQI A;  4X6I A;  5FPW A;  4I07 A;  1VJV A;  4BQV A;  2DC9 A;  4AXM A;  2FQ9 A;  4K7C A;  3OF8 A;  2E03 A;  3BCN A;  5F02 A;  2NQD B;  1QOL A;  1YK7 A;  4DMX A;  2R9M A;  1NL6 A;  1GEC E;  4YYR A;  2DCC A;  3MHH A;  2DJG B;  2AUX A;  1CJL A;  2BDL A;  4QRV A;  3OIS A;  2YJB A;  2AYN A;  4Q8H A;  4ZUX U;  5CVM A;  3QSD A;  1CV8 A;  4P6E A;  3ERV A;  4Q8G A;  4PAD A;  3PNR A;  1BGO A;  1THE A;  3BC3 A;  4N79 A;  1CVZ A;  4QRG A;  4NV8 A;  3CBK A;  2JQF R;  1QXP A;  2Y6E A;  2PBH A;  2PNS A;  3B79 A;  2AIM A;  3RVX A;  3TNX A;  2OP3 A;  5EF4 A;  2C0Y A;  4P6G A;  3IV2 A;  1AU2 A;  1AYW A;  2HHN A;  4GUZ A;  4YYU A;  2YJ2 A;  1O0E A;  2XU5 A;  4PI3 A;  1NB5 A;  2CIO A;  2HD5 A;  4YYV A;  2WBF X;  1MIR A;  1F29 A;  1F2B A;  1W5R A;  7PCK A;  3CH2 X;  3NHE A;  1Y4H A;  2AS8 A;  1MS6 A;  1YVB A;  2FUD A;  2R6N A;  3V6E A;  1GLO A;  2P7U A;  3N3K A;  1U9V A;  3WXE A;  5CVN B;  2GFO A;  4OEM A;  1Q6K A;  4NV7 A;  5K16 A;  3OVX A;  2YJ9 A;  3ZUA A;  2IBI A;  2DC6 A;  2AUZ A;  4CDC B;  3BOW A;  2FRQ A;  4YVA A;  4CDD B;  1PCI A;  3RVW A;  4FJC A;  4PP2 E;  1MDW A;  1JQP A;  1F2C A;  4I05 A;  1PPP A;  3WXG A;  1ATK A;  2DCB A;  4W5B A;  2FRA A;  1NQC A;  5CHV A;  3H89 A;  3CBJ A;  3P5W A;  1NLJ A;  9PAP A;  1ITO A;  1ME3 A;  3I06 A;  4DMY A;  3BWK A;  1ME4 A;  1AYV A;  3KWZ A;  3BPM A;  4W4U A;  3QT4 A;  3GCB A;  1KFU L;  3M99 A;  3RVV A;  4BGF A;  2VHF A;  3H8B A;  3IMA A;  4YYQ A;  4C5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...