1PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1padA00
4N4ZA 2FT2A 3U8EA 2FRAA 1AU4A 1F29A 1ZIVA 3BCNA 1TL9A 2PADA 3ZUAA 2VHSA 3HD3A 2GFOA 1CPJA 3CH3X 3OISA 2IBIA 2R9OA 4FIPA 4AXMA 2DJGB 4PP1A 1GLOA 3N4CA 3S3QA 2F1GA 2HHNA 1EWOA 3LFYA 3PDFA 3MHHA 1CB5A 4W5CA 3RVXA 6PADA 2OP3A 2R9CA 2R9FA 4CZWA 3NHEA 2PBHA 2DZZA 3B79A 3H8CA 5CVMA 4YVAA 2AS8A 2CB5A 2E00A 5CHVA 7PCKA 1F2AA 1THEA 1A6RA 1QDQA 2AYOA 4ZUXU 8PCHA 3S3RA 1ICFA 1EWPA 2B1NA 2DC6A 2G8JA 2DC8A 1F2BA 5CVNB 1NLJA 1ZCMA 4DMXA 1TLOA 2G7YA 4BPVA 3OF9A 4X6HA 1Y4HA 4Q8GA 1PCIA 3K8UA 4BS5A 1HUCB 3TNXA 4QRVA 2ATOA 5FPWA 1AU0A 1U9WA 1NL6A 3CBKA 3H89A 2FRQA 2YJCA 3PW3A 1ME4A 5A24A 3N3GA 3RVVA 2NQGA 3M99A 1ATKA 2AUZA 4XR7A 2P0RA 1QOLA 4XUIA 1POPA 3MTNA 2ARYA 3OF8A 4I04A 1NB5A 2OULA 1XKGA 2BDLA 5PADA 1PADA 3QT4A 4YYQA 3IHPA 1F2CA 1Q6KA 3BPFA 3WXGA 5CVOB 1PIPA 1EF7A 5K16A 4MSXA 4MZSA 2NQDB 4X6IA 2AUXA 1AYVA 2E02A 3N3KA 1SP4B 1JQPA 2H7JA 4PI3A 4BSQA 1MIRA 1KHPA 1MEMA 2DCCA 5JH3A 1CTEA 3WXFA 4YYUA 2R9MA 3O1GA 2AVWA 1AYWA 1DEUA 1STFE 1PPOA 4YYRA 1FH0A 4YYWA 1DF0A 3P5XA 1U9XA 2E03A 2YJ2A 3F5VA 1AU3A 2NQIA 4PADA 3HHIA 1U9VA 4P6EA 1BQIA 3PNRA 4OEMA 3P5VA 5EF4A 1TU6A 1NQCA 1PE6A 4Q8HA 4X6JA 2JQGR 2R6NA 3CBJA 1CJLA 2CIOA 5J94A 2XU4A 1KHQA 3I3TA 1KXRA 4OELA 1EWLA 2FO5A 3QJ3A 3AI8A 1CV8A 1S4VA 2P86A 3K9MA 3QSDA 4WA6A 1NB3A 1AECA 5EGWA 2DCDA 4N8WA 5F02A 3LXSA 3I06A 4YV8A 4RY2A 4AXLA 1ME3A 2BDZA 2G6DA 2DCAA 3V6CA 2AU1A 2HXZA 4W5BA 2XU3A 3IEJA 3PBHA 4MZOA 2FTDA 1CS8A 2DC9A 2PNSA 1NPZA 2GHUA 1BGOA 4K7CA 2AYNA 4QH6A 2IPPB 3KW9A 1QMYA 9PAPA 4KLBA 5CHTA 3KFQA 1MDWA 2YJ8A 1Y08A 2DJFB 3ERVA 2NQAA 3MORA 4FJCA 3P5WA 4DMYA 1K3BB 3F75A 3H7DA 1KFUL 1M6DA 3KSEA 3WXEA 2VHFA 1QXPA 1ITOA 1YK8A 3O0UA 3BWKA 4HWYA 2JQFR 3KWZA 1AU2A 2FYEA 1PBHA 2ACTA 4QBBA 3BC3A 3USVA 3HWNA 3OVZA 2HH5A 1AYUA 1SNKA 2Y5BA 3H8BA 5JA7A 2PREA 3IMAA 3V6EA 1GECE 4BS6A 1KFXL 2OZ2A 3KKUA 2YJBA 3BOWA 3C9EA 2AIMA 4YYVA 2XU1A 1IWDA 1U5IA 4BQVA 2XU5A 2FQ9A 3P5UA 3CH2X 3D6SA 2DC7A 1BY8A 2F7DA 3OVXA 1PPNA 3KX1A 1PPPA 3IUTA 2C0YA 4CDCB 3DF0A 2WBFX 4G54A 4N79A 1YK7A 2Y6EA 2R9NA 3GCBA 4YYSA 4I07A 1CSBB 1YVBA 1YT7A 3MHSA 2O6XA 4P6GA 4I05A 4CDEB 1VJVA 1CVZA 3E1ZB 1MEGA 1EWMA 1O0EA 1VSNA 2YJ9A 2DCBA 4QRGA 4CDDB 1GCBA 1PXVA 2HD5A 1CQDA 1MS6A 4CDFB 3HHAA 3IV2A 4PP2E 4QRXA 1MHWA 1YALA 4FK5A 2P7UA 3IOQA 1AIMA 3H6SA 1BP4A 1U9QX 3K24A 1X9YA 2B1MA 2E01A 2FUDA 3KWBX 3RVWA 1GMYA 4W4UA 1PPDA 3BPMA 2G8EA 2DZYA
chains in the Genus database with same CATH superfamily
4N4ZA 4MI7A 2FT2A 4HXDB 3U8EA 2FRAA 1AU4A 1F29A 1ZIVA 3BCNA 4BOQA 1TL9A 2PADA 3ZUAA 3ZNHA 2VHSA 3HD3A 2GFOA 3O65A 1CPJA 3CH3X 3OISA 2IBIA 3C0RA 2R9OA 4FIPA 4AXMA 2DJGB 4PP1A 2HWKA 1GLOA 3N4CA 3S3QA 2J7QA 2F1GA 2HHNA 1EWOA 3LFYA 3PDFA 3MHHA 4P16A 1CB5A 4W5CA 3RVXA 4WURA 6PADA 2OP3A 2J7QC 2R9CA 2R9FA 4CZWA 3NHEA 1UKFA 2PBHA 2DZZA 3B79A 3H8CA 4OW0A 5CVMA 4YVAA 2AS8A 2CB5A 2E00A 5CHVA 7PCKA 1F2AA 1THEA 1A6RA 1QDQA 2AYOA 4ZUXU 4OVZB 8PCHA 3S3RA 3W30A 1ICFA 1EWPA 2B1NA 4BOSA 2DC6A 2G8JA 2DC8A 1F2BA 1NLJA 5CVNB 1ZCMA 4DMXA 1TLOA 2G7YA 3PHUA 3PHXA 4BPVA 3MTVA 3OF9A 4X6HA 1Y4HA 4Q8GA 1PCIA 3K8UA 4BS5A 1HUCB 3TNXA 4QRVA 2ATOA 5FPWA 1AU0A 2JTCA 1U9WA 1NL6A 3CBKA 3H89A 2FRQA 2YJCA 3PW3A 1ME4A 5A24A 2AGAA 3N3GA 3RVVA 2NQGA 3M99A 1ATKA 2AUZA 4XR7A 2P0RA 1QOLA 4XUIA 1PVJA 1POPA 3MTNA 2ARYA 3OF8A 4I04A 3MP2A 1NB5A 2OULA 1XKGA 2BDLA 5PADA 1PADA 4XZXA 4D8BA 3QT4A 4YYQA 3IHPA 1F2CA 1Q6KA 4ZTBA 3BPFA 3WXGA 5CVOB 5JZEA 1PIPA 1EF7A 5K16A 4MSXA 4MZSA 2NQDB 4RNAA 4X6IA 2AUXA 1AYVA 2E02A 3N3KA 1SP4B 1JQPA 2H7JA 4PI3A 4BSQA 4R3DA 1MIRA 1KHPA 1MEMA 2DCCA 5JH3A 1CTEA 3WXFA 4YYUA 2R9MA 3O1GA 2AVWA 1AYWA 3IFUA 1DEUA 1STFE 1PPOA 4YYRA 1FH0A 4YYWA 1DF0A 3P5XA 1U9XA 2JRIA 2E03A 2YJ2A 3F5VA 4BOPA 1AU3A 2NQIA 4PADA 3HHIA 1U9VA 4P6EA 1BQIA 3E9SA 3PNRA 4OEMA 3P5VA 5EF4A 1TU6A 1NQCA 1PE6A 4Q8HA 1DKIA 3B21A 4X6JA 2UZJA 2JQGR 2R6NA 3CBJA 1CJLA 2CIOA 5J94A 2XU4A 1KHQA 3I3TA 1KXRA 4OELA 1EWLA 4D8IA 3TRKA 2FO5A 4MM3B 3QJ3A 3AI8A 1CV8A 1S4VA 2P86A 3K9MA 3QSDA 4WA6A 1NB3A 1AECA 5EGWA 3W31A 2DCDA 4N8WA 5F02A 4REZA 3LXSA 3I06A 4YV8A 4RY2A 4AXLA 1ME3A 2BDZA 2G6DA 2DCAA 3V6CA 2AU1A 2HXZA 4PT5A 4W5BA 2XU3A 3IEJA 3PHWA 3PBHA 4MZOA 2FTDA 1CS8A 2DC9A 2PNSA 1NPZA 2GHUA 1BGOA 4K7CA 2AYNA 4QH6A 2IPPB 3KW9A 1QMYA 2BTWA 3PSEA 9PAPA 3RNVA 4KLBA 5CHTA 3KFQA 1MDWA 2YJ8A 1Y08A 2DJFB 3ERVA 4A5UA 2NQAA 3MORA 4FJCA 3P5WA 4DMYA 1K3BB 3F75A 3H7DA 1KFUL 1M6DA 3KSEA 3WXEA 1YZBA 4IUMA 2VHFA 1QXPA 1ITOA 4IP3A 3BB7A 1YK8A 3O0UA 3BWKA 4HWYA 2JQFR 3KWZA 1AU2A 2FYEA 1PBHA 2ACTA 5KO3A 4QBBA 3BC3A 3USVA 3HWNA 3OVZA 3MJ5A 2HH5A 1AYUA 4BOZA 1SNKA 2Y5BA 3H8BA 4GUAA 5JA7A 2PREA 3IMAA 4RF0A 3V6EA 1GECE 4BS6A 1KFXL 2OZ2A 3KKUA 2YJBA 3BOWA 3C9EA 2AIMA 4YYVA 2XU1A 1IWDA 1U5IA 5EZSA 3TMPA 4BQVA 2XU5A 2FQ9A 3P5UA 3CH2X 3PRMA 3D6SA 2DC7A 3PRPA 1BY8A 2DOSA 2F7DA 5EZQA 3OVXA 2BTWB 1PPNA 3KX1A 1PPPA 4RKXA 3IUTA 4RF1A 2C0YA 4CDCB 2Z84A 3DF0A 2WBFX 4G54A 4N79A 1YK7A 2Y6EA 3PT2A 2R9NA 3GCBA 4YYSA 4I07A 1CSBB 1YVBA 3BBAA 1YT7A 3MHSA 2O6XA 4P6GA 4I05A 4CDEB 1VJVA 1CVZA 3E1ZB 3OQCA 4M0WA 5E6JA 1MEGA 1EWMA 1O0EA 1VSNA 2YJ9A 4BOUA 2DCBA 4QRGA 4CDDB 1GCBA 4OVZA 1PXVA 2HD5A 2BU3A 1CQDA 1MS6A 4CDFB 3HHAA 3IV2A 4PP2E 4QRXA 1MHWA 1YALA 2FE8A 4FK5A 4D8EA 2P7UA 3IOQA 1AIMA 3H6SA 1BP4A 1U9QX 3K24A 1X9YA 2B1MA 2E01A 2FUDA 3KWBX 3RVWA 1GMYA 4W4UA 3BY4A 1PPDA 3BPMA 2G8EA 2DZYA
chains in the Genus database with same CATH topology
4N4ZA 2FT2A 3U8EA 2FRAA 1AU4A 1F29A 1ZIVA 3BCNA 1TL9A 2PADA 3ZUAA 2VHSA 3HD3A 2GFOA 1CPJA 3CH3X 3OISA 2IBIA 2R9OA 4FIPA 4AXMA 2DJGB 4C5PA 4PP1A 1GLOA 3N4CA 3S3QA 2F1GA 2HHNA 1EWOA 3LFYA 3PDFA 3MHHA 1CB5A 4W5CA 3RVXA 6PADA 2OP3A 2R9CA 2R9FA 4CZWA 3NHEA 2PBHA 2DZZA 3B79A 3H8CA 5CVMA 4YVAA 2AS8A 2CB5A 2E00A 5CHVA 7PCKA 1F2AA 1THEA 1A6RA 1QDQA 2AYOA 4ZUXU 8PCHA 3S3RA 1ICFA 4NV8A 1EWPA 2B1NA 2DC6A 2G8JA 2DC8A 1F2BA 5CVNB 1NLJA 1ZCMA 4DMXA 1TLOA 2G7YA 4BPVA 3OF9A 4X6HA 1Y4HA 4Q8GA 4GUZA 1PCIA 3K8UA 4BS5A 1HUCB 3TNXA 4QRVA 2ATOA 5FPWA 1AU0A 1U9WA 1NL6A 3CBKA 3H89A 2FRQA 2YJCA 3PW3A 1ME4A 5A24A 3N3GA 3RVVA 2NQGA 3M99A 1ATKA 2AUZA 4XR7A 2P0RA 1QOLA 4XUIA 1POPA 3D9WA 3MTNA 2ARYA 3OF8A 4I04A 1NB5A 2OULA 1XKGA 2BDLA 5PADA 1PADA 3QT4A 4YYQA 3IHPA 1F2CA 1Q6KA 3BPFA 3WXGA 5CVOB 1PIPA 1EF7A 5K16A 4MSXA 4MZSA 2NQDB 4X6IA 2AUXA 1AYVA 2E02A 3N3KA 1SP4B 1JQPA 2H7JA 4PI3A 4BSQA 1MIRA 1KHPA 1MEMA 2DCCA 4NV7A 5JH3A 1CTEA 3WXFA 4YYUA 2R9MA 3O1GA 2AVWA 1AYWA 1DEUA 1STFE 1PPOA 4YYRA 1FH0A 4YYWA 1DF0A 3P5XA 1U9XA 2E03A 2VFBA 2YJ2A 3F5VA 1AU3A 2NQIA 4PADA 3HHIA 1U9VA 4P6EA 1BQIA 3PNRA 4OEMA 3P5VA 5EF4A 1TU6A 1NQCA 1PE6A 4Q8HA 4X6JA 2JQGR 2R6NA 3CBJA 1CJLA 2CIOA 5J94A 2XU4A 1KHQA 3I3TA 1KXRA 4OELA 1EWLA 2FO5A 3QJ3A 3AI8A 1CV8A 1S4VA 2P86A 3K9MA 3QSDA 4WA6A 1NB3A 1AECA 5EGWA 2DCDA 4N8WA 5F02A 3LXSA 3I06A 4YV8A 4RY2A 4AXLA 1ME3A 2BDZA 2G6DA 2VFCA 2DCAA 3V6CA 2AU1A 2HXZA 4W5BA 2XU3A 3IEJA 3PBHA 4MZOA 2FTDA 1CS8A 2DC9A 2PNSA 1NPZA 2GHUA 1BGOA 4K7CA 2AYNA 4QH6A 2IPPB 3KW9A 1QMYA 1E2TA 9PAPA 4KLBA 5CHTA 3KFQA 1MDWA 2YJ8A 1Y08A 2DJFB 4B55A 3ERVA 2NQAA 1W5RA 3MORA 4FJCA 3P5WA 4DMYA 1K3BB 3F75A 3H7DA 1KFUL 1M6DA 3KSEA 3WXEA 2VHFA 1QXPA 1ITOA 1YK8A 3O0UA 3BWKA 4HWYA 2JQFR 3KWZA 1AU2A 2FYEA 1PBHA 2ACTA 4QBBA 3BC3A 3USVA 3HWNA 3OVZA 2HH5A 1AYUA 1SNKA 2Y5BA 3H8BA 5JA7A 2PREA 3IMAA 3V6EA 1GECE 4BS6A 1KFXL 2OZ2A 2BSZA 3KKUA 2YJBA 3BOWA 3C9EA 3LTWA 2AIMA 4YYVA 1W4TA 2XU1A 1IWDA 1U5IA 4BQVA 1GX3A 2XU5A 2FQ9A 3P5UA 3CH2X 3D6SA 2DC7A 1BY8A 2F7DA 3OVXA 1PPNA 3KX1A 1PPPA 3IUTA 2C0YA 4CDCB 3DF0A 2WBFX 4G54A 4N79A 1YK7A 2Y6EA 2R9NA 3GCBA 4YYSA 1W6FA 4I07A 1CSBB 1YVBA 1YT7A 3MHSA 2O6XA 4P6GA 4I05A 4CDEB 1VJVA 1CVZA 3E1ZB 1MEGA 1EWMA 1O0EA 1VSNA 2YJ9A 2DCBA 4QRGA 4CDDB 1GCBA 1PXVA 2HD5A 1CQDA 1MS6A 4CDFB 3HHAA 3IV2A 4PP2E 4QRXA 1MHWA 1YALA 4FK5A 2P7UA 3IOQA 1AIMA 3H6SA 4BGFA 1BP4A 1U9QX 3K24A 1X9YA 2B1MA 2E01A 2FUDA 3KWBX 3RVWA 1GMYA 4W4UA 1PPDA 3BPMA 2G8EA 2DZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4Z A;  2FT2 A;  3U8E A;  2FRA A;  1AU4 A;  1F29 A;  1ZIV A;  3BCN A;  1TL9 A;  2PAD A;  3ZUA A;  2VHS A;  3HD3 A;  2GFO A;  1CPJ A;  3CH3 X;  3OIS A;  2IBI A;  2R9O A;  4FIP A;  4AXM A;  2DJG B;  4PP1 A;  1GLO A;  3N4C A;  3S3Q A;  2F1G A;  2HHN A;  1EWO A;  3LFY A;  3PDF A;  3MHH A;  1CB5 A;  4W5C A;  3RVX A;  6PAD A;  2OP3 A;  2R9C A;  2R9F A;  4CZW A;  3NHE A;  2PBH A;  2DZZ A;  3B79 A;  3H8C A;  5CVM A;  4YVA A;  2AS8 A;  2CB5 A;  2E00 A;  5CHV A;  7PCK A;  1F2A A;  1THE A;  1A6R A;  1QDQ A;  2AYO A;  4ZUX U;  8PCH A;  3S3R A;  1ICF A;  1EWP A;  2B1N A;  2DC6 A;  2G8J A;  2DC8 A;  1F2B A;  5CVN B;  1NLJ A;  1ZCM A;  4DMX A;  1TLO A;  2G7Y A;  4BPV A;  3OF9 A;  4X6H A;  1Y4H A;  4Q8G A;  1PCI A;  3K8U A;  4BS5 A;  1HUC B;  3TNX A;  4QRV A;  2ATO A;  5FPW A;  1AU0 A;  1U9W A;  1NL6 A;  3CBK A;  3H89 A;  2FRQ A;  2YJC A;  3PW3 A;  1ME4 A;  5A24 A;  3N3G A;  3RVV A;  2NQG A;  3M99 A;  1ATK A;  2AUZ A;  4XR7 A;  2P0R A;  1QOL A;  4XUI A;  1POP A;  3MTN A;  2ARY A;  3OF8 A;  4I04 A;  1NB5 A;  2OUL A;  1XKG A;  2BDL A;  5PAD A;  1PAD A;  3QT4 A;  4YYQ A;  3IHP A;  1F2C A;  1Q6K A;  3BPF A;  3WXG A;  5CVO B;  1PIP A;  1EF7 A;  5K16 A;  4MSX A;  4MZS A;  2NQD B;  4X6I A;  2AUX A;  1AYV A;  2E02 A;  3N3K A;  1SP4 B;  1JQP A;  2H7J A;  4PI3 A;  4BSQ A;  1MIR A;  1KHP A;  1MEM A;  2DCC A;  5JH3 A;  1CTE A;  3WXF A;  4YYU A;  2R9M A;  3O1G A;  2AVW A;  1AYW A;  1DEU A;  1STF E;  1PPO A;  4YYR A;  1FH0 A;  4YYW A;  1DF0 A;  3P5X A;  1U9X A;  2E03 A;  2YJ2 A;  3F5V A;  1AU3 A;  2NQI A;  4PAD A;  3HHI A;  1U9V A;  4P6E A;  1BQI A;  3PNR A;  4OEM A;  3P5V A;  5EF4 A;  1TU6 A;  1NQC A;  1PE6 A;  4Q8H A;  4X6J A;  2JQG R;  2R6N A;  3CBJ A;  1CJL A;  2CIO A;  5J94 A;  2XU4 A;  1KHQ A;  3I3T A;  1KXR A;  4OEL A;  1EWL A;  2FO5 A;  3QJ3 A;  3AI8 A;  1CV8 A;  1S4V A;  2P86 A;  3K9M A;  3QSD A;  4WA6 A;  1NB3 A;  1AEC A;  5EGW A;  2DCD A;  4N8W A;  5F02 A;  3LXS A;  3I06 A;  4YV8 A;  4RY2 A;  4AXL A;  1ME3 A;  2BDZ A;  2G6D A;  2DCA A;  3V6C A;  2AU1 A;  2HXZ A;  4W5B A;  2XU3 A;  3IEJ A;  3PBH A;  4MZO A;  2FTD A;  1CS8 A;  2DC9 A;  2PNS A;  1NPZ A;  2GHU A;  1BGO A;  4K7C A;  2AYN A;  4QH6 A;  2IPP B;  3KW9 A;  1QMY A;  9PAP A;  4KLB A;  5CHT A;  3KFQ A;  1MDW A;  2YJ8 A;  1Y08 A;  2DJF B;  3ERV A;  2NQA A;  3MOR A;  4FJC A;  3P5W A;  4DMY A;  1K3B B;  3F75 A;  3H7D A;  1KFU L;  1M6D A;  3KSE A;  3WXE A;  2VHF A;  1QXP A;  1ITO A;  1YK8 A;  3O0U A;  3BWK A;  4HWY A;  2JQF R;  3KWZ A;  1AU2 A;  2FYE A;  1PBH A;  2ACT A;  4QBB A;  3BC3 A;  3USV A;  3HWN A;  3OVZ A;  2HH5 A;  1AYU A;  1SNK A;  2Y5B A;  3H8B A;  5JA7 A;  2PRE A;  3IMA A;  3V6E A;  1GEC E;  4BS6 A;  1KFX L;  2OZ2 A;  3KKU A;  2YJB A;  3BOW A;  3C9E A;  2AIM A;  4YYV A;  2XU1 A;  1IWD A;  1U5I A;  4BQV A;  2XU5 A;  2FQ9 A;  3P5U A;  3CH2 X;  3D6S A;  2DC7 A;  1BY8 A;  2F7D A;  3OVX A;  1PPN A;  3KX1 A;  1PPP A;  3IUT A;  2C0Y A;  4CDC B;  3DF0 A;  2WBF X;  4G54 A;  4N79 A;  1YK7 A;  2Y6E A;  2R9N A;  3GCB A;  4YYS A;  4I07 A;  1CSB B;  1YVB A;  1YT7 A;  3MHS A;  2O6X A;  4P6G A;  4I05 A;  4CDE B;  1VJV A;  1CVZ A;  3E1Z B;  1MEG A;  1EWM A;  1O0E A;  1VSN A;  2YJ9 A;  2DCB A;  4QRG A;  4CDD B;  1GCB A;  1PXV A;  2HD5 A;  1CQD A;  1MS6 A;  4CDF B;  3HHA A;  3IV2 A;  4PP2 E;  4QRX A;  1MHW A;  1YAL A;  4FK5 A;  2P7U A;  3IOQ A;  1AIM A;  3H6S A;  1BP4 A;  1U9Q X;  3K24 A;  1X9Y A;  2B1M A;  2E01 A;  2FUD A;  3KWB X;  3RVW A;  1GMY A;  4W4U A;  1PPD A;  3BPM A;  2G8E A;  2DZY A; 
#chains in the Genus database with same CATH topology
 4N4Z A;  4MI7 A;  2FT2 A;  4HXD B;  3U8E A;  2FRA A;  1AU4 A;  1F29 A;  1ZIV A;  3BCN A;  4BOQ A;  1TL9 A;  2PAD A;  3ZUA A;  3ZNH A;  2VHS A;  3HD3 A;  2GFO A;  3O65 A;  1CPJ A;  3CH3 X;  3OIS A;  2IBI A;  3C0R A;  2R9O A;  4FIP A;  4AXM A;  2DJG B;  4PP1 A;  2HWK A;  1GLO A;  3N4C A;  3S3Q A;  2J7Q A;  2F1G A;  2HHN A;  1EWO A;  3LFY A;  3PDF A;  3MHH A;  4P16 A;  1CB5 A;  4W5C A;  3RVX A;  4WUR A;  6PAD A;  2OP3 A;  2J7Q C;  2R9C A;  2R9F A;  4CZW A;  3NHE A;  1UKF A;  2PBH A;  2DZZ A;  3B79 A;  3H8C A;  4OW0 A;  5CVM A;  4YVA A;  2AS8 A;  2CB5 A;  2E00 A;  5CHV A;  7PCK A;  1F2A A;  1THE A;  1A6R A;  1QDQ A;  2AYO A;  4ZUX U;  4OVZ B;  8PCH A;  3S3R A;  3W30 A;  1ICF A;  1EWP A;  2B1N A;  4BOS A;  2DC6 A;  2G8J A;  2DC8 A;  1F2B A;  1NLJ A;  5CVN B;  1ZCM A;  4DMX A;  1TLO A;  2G7Y A;  3PHU A;  3PHX A;  4BPV A;  3MTV A;  3OF9 A;  4X6H A;  1Y4H A;  4Q8G A;  1PCI A;  3K8U A;  4BS5 A;  1HUC B;  3TNX A;  4QRV A;  2ATO A;  5FPW A;  1AU0 A;  2JTC A;  1U9W A;  1NL6 A;  3CBK A;  3H89 A;  2FRQ A;  2YJC A;  3PW3 A;  1ME4 A;  5A24 A;  2AGA A;  3N3G A;  3RVV A;  2NQG A;  3M99 A;  1ATK A;  2AUZ A;  4XR7 A;  2P0R A;  1QOL A;  4XUI A;  1PVJ A;  1POP A;  3MTN A;  2ARY A;  3OF8 A;  4I04 A;  3MP2 A;  1NB5 A;  2OUL A;  1XKG A;  2BDL A;  5PAD A;  1PAD A;  4XZX A;  4D8B A;  3QT4 A;  4YYQ A;  3IHP A;  1F2C A;  1Q6K A;  4ZTB A;  3BPF A;  3WXG A;  5CVO B;  5JZE A;  1PIP A;  1EF7 A;  5K16 A;  4MSX A;  4MZS A;  2NQD B;  4RNA A;  4X6I A;  2AUX A;  1AYV A;  2E02 A;  3N3K A;  1SP4 B;  1JQP A;  2H7J A;  4PI3 A;  4BSQ A;  4R3D A;  1MIR A;  1KHP A;  1MEM A;  2DCC A;  5JH3 A;  1CTE A;  3WXF A;  4YYU A;  2R9M A;  3O1G A;  2AVW A;  1AYW A;  3IFU A;  1DEU A;  1STF E;  1PPO A;  4YYR A;  1FH0 A;  4YYW A;  1DF0 A;  3P5X A;  1U9X A;  2JRI A;  2E03 A;  2YJ2 A;  3F5V A;  4BOP A;  1AU3 A;  2NQI A;  4PAD A;  3HHI A;  1U9V A;  4P6E A;  1BQI A;  3E9S A;  3PNR A;  4OEM A;  3P5V A;  5EF4 A;  1TU6 A;  1NQC A;  1PE6 A;  4Q8H A;  1DKI A;  3B21 A;  4X6J A;  2UZJ A;  2JQG R;  2R6N A;  3CBJ A;  1CJL A;  2CIO A;  5J94 A;  2XU4 A;  1KHQ A;  3I3T A;  1KXR A;  4OEL A;  1EWL A;  4D8I A;  3TRK A;  2FO5 A;  4MM3 B;  3QJ3 A;  3AI8 A;  1CV8 A;  1S4V A;  2P86 A;  3K9M A;  3QSD A;  4WA6 A;  1NB3 A;  1AEC A;  5EGW A;  3W31 A;  2DCD A;  4N8W A;  5F02 A;  4REZ A;  3LXS A;  3I06 A;  4YV8 A;  4RY2 A;  4AXL A;  1ME3 A;  2BDZ A;  2G6D A;  2DCA A;  3V6C A;  2AU1 A;  2HXZ A;  4PT5 A;  4W5B A;  2XU3 A;  3IEJ A;  3PHW A;  3PBH A;  4MZO A;  2FTD A;  1CS8 A;  2DC9 A;  2PNS A;  1NPZ A;  2GHU A;  1BGO A;  4K7C A;  2AYN A;  4QH6 A;  2IPP B;  3KW9 A;  1QMY A;  2BTW A;  3PSE A;  9PAP A;  3RNV A;  4KLB A;  5CHT A;  3KFQ A;  1MDW A;  2YJ8 A;  1Y08 A;  2DJF B;  3ERV A;  4A5U A;  2NQA A;  3MOR A;  4FJC A;  3P5W A;  4DMY A;  1K3B B;  3F75 A;  3H7D A;  1KFU L;  1M6D A;  3KSE A;  3WXE A;  1YZB A;  4IUM A;  2VHF A;  1QXP A;  1ITO A;  4IP3 A;  3BB7 A;  1YK8 A;  3O0U A;  3BWK A;  4HWY A;  2JQF R;  3KWZ A;  1AU2 A;  2FYE A;  1PBH A;  2ACT A;  5KO3 A;  4QBB A;  3BC3 A;  3USV A;  3HWN A;  3OVZ A;  3MJ5 A;  2HH5 A;  1AYU A;  4BOZ A;  1SNK A;  2Y5B A;  3H8B A;  4GUA A;  5JA7 A;  2PRE A;  3IMA A;  4RF0 A;  3V6E A;  1GEC E;  4BS6 A;  1KFX L;  2OZ2 A;  3KKU A;  2YJB A;  3BOW A;  3C9E A;  2AIM A;  4YYV A;  2XU1 A;  1IWD A;  1U5I A;  5EZS A;  3TMP A;  4BQV A;  2XU5 A;  2FQ9 A;  3P5U A;  3CH2 X;  3PRM A;  3D6S A;  2DC7 A;  3PRP A;  1BY8 A;  2DOS A;  2F7D A;  5EZQ A;  3OVX A;  2BTW B;  1PPN A;  3KX1 A;  1PPP A;  4RKX A;  3IUT A;  4RF1 A;  2C0Y A;  4CDC B;  2Z84 A;  3DF0 A;  2WBF X;  4G54 A;  4N79 A;  1YK7 A;  2Y6E A;  3PT2 A;  2R9N A;  3GCB A;  4YYS A;  4I07 A;  1CSB B;  1YVB A;  3BBA A;  1YT7 A;  3MHS A;  2O6X A;  4P6G A;  4I05 A;  4CDE B;  1VJV A;  1CVZ A;  3E1Z B;  3OQC A;  4M0W A;  5E6J A;  1MEG A;  1EWM A;  1O0E A;  1VSN A;  2YJ9 A;  4BOU A;  2DCB A;  4QRG A;  4CDD B;  1GCB A;  4OVZ A;  1PXV A;  2HD5 A;  2BU3 A;  1CQD A;  1MS6 A;  4CDF B;  3HHA A;  3IV2 A;  4PP2 E;  4QRX A;  1MHW A;  1YAL A;  2FE8 A;  4FK5 A;  4D8E A;  2P7U A;  3IOQ A;  1AIM A;  3H6S A;  1BP4 A;  1U9Q X;  3K24 A;  1X9Y A;  2B1M A;  2E01 A;  2FUD A;  3KWB X;  3RVW A;  1GMY A;  4W4U A;  3BY4 A;  1PPD A;  3BPM A;  2G8E A;  2DZY A; 
#chains in the Genus database with same CATH homology
 4N4Z A;  2FT2 A;  3U8E A;  2FRA A;  1AU4 A;  1F29 A;  1ZIV A;  3BCN A;  1TL9 A;  2PAD A;  3ZUA A;  2VHS A;  3HD3 A;  2GFO A;  1CPJ A;  3CH3 X;  3OIS A;  2IBI A;  2R9O A;  4FIP A;  4AXM A;  2DJG B;  4C5P A;  4PP1 A;  1GLO A;  3N4C A;  3S3Q A;  2F1G A;  2HHN A;  1EWO A;  3LFY A;  3PDF A;  3MHH A;  1CB5 A;  4W5C A;  3RVX A;  6PAD A;  2OP3 A;  2R9C A;  2R9F A;  4CZW A;  3NHE A;  2PBH A;  2DZZ A;  3B79 A;  3H8C A;  5CVM A;  4YVA A;  2AS8 A;  2CB5 A;  2E00 A;  5CHV A;  7PCK A;  1F2A A;  1THE A;  1A6R A;  1QDQ A;  2AYO A;  4ZUX U;  8PCH A;  3S3R A;  1ICF A;  4NV8 A;  1EWP A;  2B1N A;  2DC6 A;  2G8J A;  2DC8 A;  1F2B A;  5CVN B;  1NLJ A;  1ZCM A;  4DMX A;  1TLO A;  2G7Y A;  4BPV A;  3OF9 A;  4X6H A;  1Y4H A;  4Q8G A;  4GUZ A;  1PCI A;  3K8U A;  4BS5 A;  1HUC B;  3TNX A;  4QRV A;  2ATO A;  5FPW A;  1AU0 A;  1U9W A;  1NL6 A;  3CBK A;  3H89 A;  2FRQ A;  2YJC A;  3PW3 A;  1ME4 A;  5A24 A;  3N3G A;  3RVV A;  2NQG A;  3M99 A;  1ATK A;  2AUZ A;  4XR7 A;  2P0R A;  1QOL A;  4XUI A;  1POP A;  3D9W A;  3MTN A;  2ARY A;  3OF8 A;  4I04 A;  1NB5 A;  2OUL A;  1XKG A;  2BDL A;  5PAD A;  1PAD A;  3QT4 A;  4YYQ A;  3IHP A;  1F2C A;  1Q6K A;  3BPF A;  3WXG A;  5CVO B;  1PIP A;  1EF7 A;  5K16 A;  4MSX A;  4MZS A;  2NQD B;  4X6I A;  2AUX A;  1AYV A;  2E02 A;  3N3K A;  1SP4 B;  1JQP A;  2H7J A;  4PI3 A;  4BSQ A;  1MIR A;  1KHP A;  1MEM A;  2DCC A;  4NV7 A;  5JH3 A;  1CTE A;  3WXF A;  4YYU A;  2R9M A;  3O1G A;  2AVW A;  1AYW A;  1DEU A;  1STF E;  1PPO A;  4YYR A;  1FH0 A;  4YYW A;  1DF0 A;  3P5X A;  1U9X A;  2E03 A;  2VFB A;  2YJ2 A;  3F5V A;  1AU3 A;  2NQI A;  4PAD A;  3HHI A;  1U9V A;  4P6E A;  1BQI A;  3PNR A;  4OEM A;  3P5V A;  5EF4 A;  1TU6 A;  1NQC A;  1PE6 A;  4Q8H A;  4X6J A;  2JQG R;  2R6N A;  3CBJ A;  1CJL A;  2CIO A;  5J94 A;  2XU4 A;  1KHQ A;  3I3T A;  1KXR A;  4OEL A;  1EWL A;  2FO5 A;  3QJ3 A;  3AI8 A;  1CV8 A;  1S4V A;  2P86 A;  3K9M A;  3QSD A;  4WA6 A;  1NB3 A;  1AEC A;  5EGW A;  2DCD A;  4N8W A;  5F02 A;  3LXS A;  3I06 A;  4YV8 A;  4RY2 A;  4AXL A;  1ME3 A;  2BDZ A;  2G6D A;  2VFC A;  2DCA A;  3V6C A;  2AU1 A;  2HXZ A;  4W5B A;  2XU3 A;  3IEJ A;  3PBH A;  4MZO A;  2FTD A;  1CS8 A;  2DC9 A;  2PNS A;  1NPZ A;  2GHU A;  1BGO A;  4K7C A;  2AYN A;  4QH6 A;  2IPP B;  3KW9 A;  1QMY A;  1E2T A;  9PAP A;  4KLB A;  5CHT A;  3KFQ A;  1MDW A;  2YJ8 A;  1Y08 A;  2DJF B;  4B55 A;  3ERV A;  2NQA A;  1W5R A;  3MOR A;  4FJC A;  3P5W A;  4DMY A;  1K3B B;  3F75 A;  3H7D A;  1KFU L;  1M6D A;  3KSE A;  3WXE A;  2VHF A;  1QXP A;  1ITO A;  1YK8 A;  3O0U A;  3BWK A;  4HWY A;  2JQF R;  3KWZ A;  1AU2 A;  2FYE A;  1PBH A;  2ACT A;  4QBB A;  3BC3 A;  3USV A;  3HWN A;  3OVZ A;  2HH5 A;  1AYU A;  1SNK A;  2Y5B A;  3H8B A;  5JA7 A;  2PRE A;  3IMA A;  3V6E A;  1GEC E;  4BS6 A;  1KFX L;  2OZ2 A;  2BSZ A;  3KKU A;  2YJB A;  3BOW A;  3C9E A;  3LTW A;  2AIM A;  4YYV A;  1W4T A;  2XU1 A;  1IWD A;  1U5I A;  4BQV A;  1GX3 A;  2XU5 A;  2FQ9 A;  3P5U A;  3CH2 X;  3D6S A;  2DC7 A;  1BY8 A;  2F7D A;  3OVX A;  1PPN A;  3KX1 A;  1PPP A;  3IUT A;  2C0Y A;  4CDC B;  3DF0 A;  2WBF X;  4G54 A;  4N79 A;  1YK7 A;  2Y6E A;  2R9N A;  3GCB A;  4YYS A;  1W6F A;  4I07 A;  1CSB B;  1YVB A;  1YT7 A;  3MHS A;  2O6X A;  4P6G A;  4I05 A;  4CDE B;  1VJV A;  1CVZ A;  3E1Z B;  1MEG A;  1EWM A;  1O0E A;  1VSN A;  2YJ9 A;  2DCB A;  4QRG A;  4CDD B;  1GCB A;  1PXV A;  2HD5 A;  1CQD A;  1MS6 A;  4CDF B;  3HHA A;  3IV2 A;  4PP2 E;  4QRX A;  1MHW A;  1YAL A;  4FK5 A;  2P7U A;  3IOQ A;  1AIM A;  3H6S A;  4BGF A;  1BP4 A;  1U9Q X;  3K24 A;  1X9Y A;  2B1M A;  2E01 A;  2FUD A;  3KWB X;  3RVW A;  1GMY A;  4W4U A;  1PPD A;  3BPM A;  2G8E A;  2DZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...