1PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Carica papaya
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1padA00
2BDLA 2OULA 4YYRA 1VSNA 1SNKA 2FYEA 1PXVA 1QDQA 4P6EA 4OEMA 1CB5A 1YVBA 3USVA 2DJFB 3MORA 1ME4A 1PCIA 2Y5BA 4QRXA 4BS5A 1QOLA 2F1GA 1NL6A 3HWNA 4PP1A 1GLOA 1EWLA 2FQ9A 4Q8GA 2IBIA 1MDWA 1U9WA 3LXSA 4RY2A 1DEUA 1PPPA 2XU1A 2FT2A 1EWOA 3BOWA 4BQVA 1PADA 3O0UA 4OELA 1PIPA 4N79A 2R6NA 2R9CA 2AU1A 1CPJA 4XR7A 2DCDA 4YYSA 1F2BA 3ERVA 3CH2X 3IHPA 1F29A 2WBFX 1CSBB 3BC3A 3C9EA 4AXLA 3IV2A 7PCKA 4K7CA 2R9FA 3U8EA 2ARYA 1HUCB 2AYNA 4BSQA 4ZUXU 2B1NA 4YV8A 2C0YA 3KFQA 2E02A 4FK5A 3H6SA 5EGWA 3CBKA 3H8CA 1KXRA 1TU6A 1GMYA 1U9QX 1YT7A 3BPFA 3CH3X 3MHHA 3IEJA 1F2AA 3WXEA 2E01A 1U9XA 1QMYA 3ZUAA 1YALA 1CV8A 1M6DA 4YYWA 3BCNA 3IUTA 2YJ9A 3I3TA 3OVXA 1NLJA 1GECE 4MSXA 4MZOA 2ACTA 3OF9A 5CHVA 2G8JA 2DZYA 1CJLA 3K8UA 1POPA 3KW9A 4YYQA 3KKUA 2HH5A 1KHPA 3MHSA 4G54A 3OISA 1FH0A 1MHWA 2P7UA 3PNRA 1X9YA 1SP4B 3MTNA 2AYOA 2XU4A 4QH6A 1Y4HA 1JQPA 1AYVA 2GHUA 3F75A 3PW3A 2XU5A 3WXGA 3F5VA 4I05A 1XKGA 2HHNA 4X6HA 3DF0A 1F2CA 1MIRA 1A6RA 2IPPB 4CZWA 1BQIA 4QBBA 3S3QA 2ATOA 4W5BA 1CQDA 4W5CA 2NQIA 4W4UA 1PE6A 2O6XA 5JA7A 2DJGB 4MZSA 1AU3A 1IWDA 2VHFA 4BPVA 3HHIA 1BGOA 2BDZA 4PP2E 2FO5A 1AYWA 1MEGA 3RVVA 2OZ2A 1AIMA 1U9VA 2YJCA 5F02A 4QRGA 2DC6A 1Q6KA 2P0RA 5A24A 3P5XA 2FTDA 2NQGA 3AI8A 1VJVA 3PBHA 3BPMA 2DC9A 1S4VA 2E00A 1AYUA 3OVZA 3H7DA 1ME3A 2PADA 3KSEA 2DCAA 3P5VA 2R9OA 4FIPA 2GFOA 1NPZA 1ICFA 3P5WA 2AVWA 4N4ZA 1AECA 3S3RA 1MS6A 1EWPA 4XUIA 2B1MA 2FRQA 1CTEA 1PBHA 1PPDA 6PADA 3CBJA 1AU2A 3QT4A 3H8BA 3NHEA 3H89A 3TNXA 3P5UA 3GCBA 4X6IA 9PAPA 2YJ8A 1BP4A 1KHQA 4DMXA 2XU3A 2CIOA 5CVMA 3KX1A 3N3GA 4CDDB 3N4CA 4FJCA 2PBHA 2AIMA 4YVAA 4PI3A 3OF8A 2DCCA 2R9MA 3RVWA 5CVNB 2DC7A 3B79A 1YK8A 4I07A 1CVZA 3BWKA 1THEA 1STFE 1BY8A 3HHAA 2HD5A 2R9NA 3N3KA 5K16A 3HD3A 3KWBX 1NQCA 3LFYA 2G8EA 2HXZA 4BS6A 3E1ZB 2VHSA 2PNSA 3WXFA 1KFXL 4CDFB 1ZCMA 2NQDB 1NB3A 1CS8A 4WA6A 5J94A 2FRAA 5EF4A 1PPOA 3IOQA 1ITOA 5JH3A 1NB5A 3KWZA 1TL9A 5PADA 2DZZA 1MEMA 1QXPA 4N8WA 1ATKA 3I06A 1KFUL 3IMAA 2YJ2A 1YK7A 1K3BB 5CVOB 4CDCB 1TLOA 2AUZA 2NQAA 1U5IA 2H7JA 2G7YA 3O1GA 3QSDA 4CDEB 5FPWA 2OP3A 5CHTA 2AS8A 1AU0A 1PPNA 1AU4A 1EWMA 2JQGR 1GCBA 2F7DA 1DF0A 4QRVA 2AUXA 4DMYA 3PDFA 4YYVA 4I04A 2Y6EA 2P86A 3D6SA 3K9MA 2YJBA 4KLBA 2E03A 2G6DA 1O0EA 4P6GA 1Y08A 4Q8HA 4YYUA 1EF7A 1ZIVA 4HWYA 3V6EA 2FUDA 3K24A 2JQFR 3RVXA 3QJ3A 2DCBA 3M99A 8PCHA 2DC8A 4PADA 2CB5A 2PREA 4AXMA 4X6JA 3V6CA
chains in the Genus database with same CATH superfamily
2BDLA 2OULA 4YYRA 1VSNA 1SNKA 3PHWA 2FYEA 1PXVA 2JRIA 1QDQA 4P6EA 4OEMA 1CB5A 1YVBA 3USVA 2DJFB 3MORA 1ME4A 1PCIA 2Y5BA 4QRXA 4XZXA 4BS5A 1QOLA 2F1GA 1NL6A 3HWNA 4PP1A 1GLOA 1EWLA 2FQ9A 4Q8GA 3ZNHA 2DOSA 1MDWA 1U9WA 2IBIA 3LXSA 4RY2A 3PHUA 1DEUA 3RNVA 3W30A 3OQCA 1PPPA 3IFUA 2XU1A 2FT2A 1EWOA 3BOWA 4BQVA 1PADA 3O0UA 4OELA 1PIPA 2HWKA 4N79A 4D8BA 2R6NA 2R9CA 2AU1A 4BOSA 1CPJA 4XR7A 2DCDA 4YYSA 1F2BA 4OVZA 3ERVA 3CH2X 3IHPA 1F29A 2WBFX 1CSBB 3BC3A 3C9EA 3C0RA 4AXLA 3IV2A 7PCKA 4K7CA 2R9FA 3U8EA 2BTWB 2ARYA 1HUCB 2AYNA 4BSQA 1DKIA 4ZUXU 2B1NA 4YV8A 2C0YA 3KFQA 2E02A 4FK5A 4OW0A 3H6SA 5EGWA 3CBKA 3H8CA 3TMPA 1KXRA 1TU6A 1GMYA 3MTVA 4BOUA 1U9QX 1YT7A 3BPFA 3CH3X 4HXDB 3MHHA 3IEJA 1F2AA 4REZA 3WXEA 2E01A 1U9XA 1QMYA 2FE8A 3ZUAA 1YALA 3MJ5A 1CV8A 1M6DA 4YYWA 3W31A 3BCNA 3IUTA 2YJ9A 4ZTBA 3I3TA 3OVXA 1NLJA 1GECE 4MSXA 4MZOA 2ACTA 3OF9A 5CHVA 2G8JA 2DZYA 1CJLA 4RF1A 3K8UA 1POPA 3KW9A 4YYQA 3KKUA 2HH5A 3TRKA 1KHPA 3MHSA 4G54A 4BOPA 3OISA 1FH0A 3MP2A 1MHWA 2P7UA 3PNRA 1X9YA 1SP4B 3MTNA 2AYOA 2XU4A 4QH6A 1Y4HA 1JQPA 1YZBA 4IP3A 3PRPA 3BY4A 1AYVA 2GHUA 3F75A 3PW3A 2XU5A 3WXGA 3F5VA 4I05A 1XKGA 2UZJA 2HHNA 4X6HA 2JTCA 3DF0A 1F2CA 1MIRA 3PHXA 1A6RA 4M0WA 2IPPB 4CZWA 1BQIA 4QBBA 4PT5A 3S3QA 2ATOA 4W5BA 1CQDA 4W5CA 2AGAA 4BOQA 2NQIA 4W4UA 1PE6A 2O6XA 5JA7A 2DJGB 4MZSA 1AU3A 1IWDA 2VHFA 4BPVA 3HHIA 1BGOA 3PT2A 2BDZA 4PP2E 2FO5A 1AYWA 1MEGA 5EZQA 3RVVA 2OZ2A 1AIMA 5KO3A 1U9VA 2YJCA 5F02A 4QRGA 2DC6A 1Q6KA 2P0RA 5A24A 3P5XA 2FTDA 2NQGA 3AI8A 1VJVA 3PBHA 3BPMA 2DC9A 1S4VA 2E00A 1AYUA 3OVZA 3H7DA 1ME3A 2PADA 3KSEA 4D8IA 2DCAA 3P5VA 2R9OA 4RF0A 4FIPA 2GFOA 1NPZA 1ICFA 3P5WA 2AVWA 4N4ZA 1AECA 3S3RA 1MS6A 1EWPA 2BU3A 4MM3B 4XUIA 2B1MA 2FRQA 1CTEA 1PBHA 1PPDA 6PADA 2J7QC 3CBJA 1AU2A 3QT4A 3H8BA 3NHEA 3H89A 3TNXA 3P5UA 3PSEA 3GCBA 4X6IA 9PAPA 4D8EA 2YJ8A 1BP4A 1KHQA 4DMXA 2XU3A 2CIOA 5CVMA 3KX1A 3N3GA 4CDDB 3N4CA 4FJCA 2PBHA 2AIMA 4YVAA 4PI3A 3OF8A 2Z84A 2DCCA 2R9MA 3RVWA 5CVNB 2DC7A 3B79A 1YK8A 2J7QA 4I07A 1CVZA 3BWKA 1THEA 1STFE 4IUMA 1BY8A 3HHAA 2HD5A 2R9NA 3N3KA 5K16A 4R3DA 3HD3A 3KWBX 5EZSA 1NQCA 3LFYA 3BB7A 2G8EA 2HXZA 4BS6A 3E1ZB 2VHSA 2PNSA 3WXFA 1KFXL 4CDFB 3E9SA 4RNAA 1ZCMA 4OVZB 2NQDB 1NB3A 1CS8A 4WA6A 5J94A 2FRAA 5EF4A 1PPOA 1UKFA 3IOQA 1ITOA 5JH3A 1NB5A 3KWZA 1TL9A 5PADA 2DZZA 1MEMA 1QXPA 4N8WA 1ATKA 3I06A 1KFUL 3IMAA 2YJ2A 1YK7A 1K3BB 5CVOB 4CDCB 1TLOA 2AUZA 2NQAA 1U5IA 4MI7A 2H7JA 4GUAA 3PRMA 2G7YA 3O1GA 3QSDA 4CDEB 5FPWA 2OP3A 5CHTA 2AS8A 4WURA 1AU0A 1PPNA 1AU4A 1EWMA 2JQGR 1PVJA 1GCBA 2F7DA 1DF0A 3BBAA 4QRVA 2AUXA 4DMYA 3PDFA 4YYVA 3B21A 4I04A 2Y6EA 4P16A 2P86A 3D6SA 3K9MA 5JZEA 2YJBA 4KLBA 2E03A 2G6DA 1O0EA 4P6GA 1Y08A 4A5UA 4Q8HA 4YYUA 1EF7A 1ZIVA 4HWYA 3V6EA 2FUDA 3K24A 3O65A 2JQFR 3RVXA 3QJ3A 2DCBA 3M99A 4RKXA 8PCHA 2DC8A 4PADA 2CB5A 2PREA 4AXMA 4BOZA 2BTWA 4X6JA 3V6CA 5E6JA
chains in the Genus database with same CATH topology
2BDLA 2OULA 4YYRA 1VSNA 1SNKA 2FYEA 1PXVA 1QDQA 4P6EA 4OEMA 1CB5A 1YVBA 3USVA 2DJFB 3MORA 1ME4A 1PCIA 2Y5BA 4QRXA 4BS5A 1QOLA 2F1GA 3HWNA 1NL6A 4PP1A 1GLOA 1EWLA 2FQ9A 1W5RA 4Q8GA 2VFCA 2IBIA 1MDWA 1U9WA 3LXSA 4RY2A 1DEUA 1PPPA 2XU1A 2FT2A 1EWOA 3BOWA 4BQVA 1PADA 3O0UA 4OELA 1PIPA 4N79A 2R6NA 2R9CA 2AU1A 1CPJA 4XR7A 2DCDA 4YYSA 1F2BA 3ERVA 3CH2X 3IHPA 1F29A 2WBFX 1CSBB 3BC3A 3C9EA 4AXLA 3IV2A 7PCKA 4K7CA 2R9FA 3U8EA 2ARYA 1HUCB 2AYNA 4BSQA 4ZUXU 2B1NA 4YV8A 2C0YA 3KFQA 2E02A 4FK5A 1GX3A 3H6SA 5EGWA 3CBKA 3H8CA 1KXRA 1TU6A 1GMYA 1U9QX 1YT7A 3BPFA 3CH3X 4GUZA 3MHHA 3IEJA 1F2AA 1E2TA 3WXEA 2E01A 1U9XA 1QMYA 3ZUAA 1YALA 1CV8A 1M6DA 4YYWA 3BCNA 3IUTA 2YJ9A 3I3TA 3OVXA 1NLJA 1GECE 4MSXA 4MZOA 2ACTA 3OF9A 5CHVA 2G8JA 2DZYA 1CJLA 3K8UA 1POPA 3KW9A 4YYQA 3KKUA 2HH5A 1KHPA 1W6FA 3MHSA 4G54A 3OISA 1FH0A 1MHWA 2P7UA 3PNRA 1X9YA 1SP4B 3MTNA 2AYOA 2XU4A 4QH6A 1Y4HA 1JQPA 1AYVA 2GHUA 4NV8A 3F75A 3PW3A 2XU5A 3WXGA 3F5VA 4I05A 1XKGA 2HHNA 4X6HA 3DF0A 1F2CA 1MIRA 1A6RA 2IPPB 4CZWA 1BQIA 4QBBA 3S3QA 2ATOA 4W5BA 1CQDA 4W5CA 2NQIA 4W4UA 1PE6A 2O6XA 5JA7A 2DJGB 4MZSA 1AU3A 1IWDA 2VHFA 4BPVA 3HHIA 1BGOA 2BDZA 4PP2E 2FO5A 1AYWA 1MEGA 3RVVA 2OZ2A 1AIMA 1U9VA 2YJCA 5F02A 4QRGA 4C5PA 2DC6A 1Q6KA 2P0RA 5A24A 3P5XA 2FTDA 2NQGA 3AI8A 1VJVA 3PBHA 3BPMA 2DC9A 1S4VA 2E00A 1AYUA 3OVZA 3H7DA 1ME3A 2PADA 3KSEA 2DCAA 3P5VA 2R9OA 4FIPA 2GFOA 1NPZA 2VFBA 1ICFA 3P5WA 2AVWA 4N4ZA 1AECA 3S3RA 1MS6A 1EWPA 4XUIA 2B1MA 2FRQA 1CTEA 1PBHA 1PPDA 6PADA 3CBJA 1AU2A 3QT4A 3H8BA 3NHEA 3H89A 3TNXA 3P5UA 3GCBA 4X6IA 9PAPA 2YJ8A 1BP4A 1KHQA 4DMXA 2XU3A 4BGFA 2CIOA 5CVMA 3KX1A 3N3GA 4CDDB 3N4CA 4FJCA 2PBHA 2AIMA 4YVAA 4PI3A 3OF8A 2DCCA 2R9MA 3RVWA 5CVNB 2DC7A 3B79A 1YK8A 4I07A 1CVZA 3BWKA 1THEA 1STFE 1BY8A 3HHAA 2HD5A 2R9NA 3N3KA 5K16A 3HD3A 3KWBX 1NQCA 3LFYA 2G8EA 2HXZA 4BS6A 3E1ZB 2VHSA 2PNSA 3WXFA 1KFXL 4CDFB 3D9WA 1ZCMA 2NQDB 1NB3A 1CS8A 4WA6A 5J94A 2FRAA 5EF4A 1PPOA 3IOQA 1ITOA 5JH3A 1NB5A 3KWZA 1TL9A 5PADA 2DZZA 1MEMA 1QXPA 4N8WA 1ATKA 3I06A 1KFUL 3IMAA 2YJ2A 4B55A 1YK7A 1K3BB 5CVOB 4CDCB 1TLOA 2AUZA 2NQAA 1U5IA 2H7JA 2G7YA 3O1GA 3QSDA 4CDEB 4NV7A 5FPWA 2OP3A 5CHTA 2AS8A 1AU0A 1PPNA 1AU4A 1EWMA 2JQGR 1GCBA 2F7DA 1DF0A 4QRVA 2AUXA 4DMYA 3PDFA 4YYVA 4I04A 2Y6EA 2P86A 3D6SA 3K9MA 1W4TA 2YJBA 4KLBA 2E03A 2G6DA 1O0EA 4P6GA 1Y08A 2BSZA 4Q8HA 4YYUA 1EF7A 1ZIVA 4HWYA 3V6EA 2FUDA 3K24A 2JQFR 3RVXA 3QJ3A 2DCBA 3M99A 8PCHA 2DC8A 4PADA 2CB5A 2PREA 4AXMA 3LTWA 4X6JA 3V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDL A;  2OUL A;  4YYR A;  1VSN A;  1SNK A;  2FYE A;  1PXV A;  1QDQ A;  4P6E A;  4OEM A;  1CB5 A;  1YVB A;  3USV A;  2DJF B;  3MOR A;  1ME4 A;  1PCI A;  2Y5B A;  4QRX A;  4BS5 A;  1QOL A;  2F1G A;  1NL6 A;  3HWN A;  4PP1 A;  1GLO A;  1EWL A;  2FQ9 A;  4Q8G A;  2IBI A;  1MDW A;  1U9W A;  3LXS A;  4RY2 A;  1DEU A;  1PPP A;  2XU1 A;  2FT2 A;  1EWO A;  3BOW A;  4BQV A;  1PAD A;  3O0U A;  4OEL A;  1PIP A;  4N79 A;  2R6N A;  2R9C A;  2AU1 A;  1CPJ A;  4XR7 A;  2DCD A;  4YYS A;  1F2B A;  3ERV A;  3CH2 X;  3IHP A;  1F29 A;  2WBF X;  1CSB B;  3BC3 A;  3C9E A;  4AXL A;  3IV2 A;  7PCK A;  4K7C A;  2R9F A;  3U8E A;  2ARY A;  1HUC B;  2AYN A;  4BSQ A;  4ZUX U;  2B1N A;  4YV8 A;  2C0Y A;  3KFQ A;  2E02 A;  4FK5 A;  3H6S A;  5EGW A;  3CBK A;  3H8C A;  1KXR A;  1TU6 A;  1GMY A;  1U9Q X;  1YT7 A;  3BPF A;  3CH3 X;  3MHH A;  3IEJ A;  1F2A A;  3WXE A;  2E01 A;  1U9X A;  1QMY A;  3ZUA A;  1YAL A;  1CV8 A;  1M6D A;  4YYW A;  3BCN A;  3IUT A;  2YJ9 A;  3I3T A;  3OVX A;  1NLJ A;  1GEC E;  4MSX A;  4MZO A;  2ACT A;  3OF9 A;  5CHV A;  2G8J A;  2DZY A;  1CJL A;  3K8U A;  1POP A;  3KW9 A;  4YYQ A;  3KKU A;  2HH5 A;  1KHP A;  3MHS A;  4G54 A;  3OIS A;  1FH0 A;  1MHW A;  2P7U A;  3PNR A;  1X9Y A;  1SP4 B;  3MTN A;  2AYO A;  2XU4 A;  4QH6 A;  1Y4H A;  1JQP A;  1AYV A;  2GHU A;  3F75 A;  3PW3 A;  2XU5 A;  3WXG A;  3F5V A;  4I05 A;  1XKG A;  2HHN A;  4X6H A;  3DF0 A;  1F2C A;  1MIR A;  1A6R A;  2IPP B;  4CZW A;  1BQI A;  4QBB A;  3S3Q A;  2ATO A;  4W5B A;  1CQD A;  4W5C A;  2NQI A;  4W4U A;  1PE6 A;  2O6X A;  5JA7 A;  2DJG B;  4MZS A;  1AU3 A;  1IWD A;  2VHF A;  4BPV A;  3HHI A;  1BGO A;  2BDZ A;  4PP2 E;  2FO5 A;  1AYW A;  1MEG A;  3RVV A;  2OZ2 A;  1AIM A;  1U9V A;  2YJC A;  5F02 A;  4QRG A;  2DC6 A;  1Q6K A;  2P0R A;  5A24 A;  3P5X A;  2FTD A;  2NQG A;  3AI8 A;  1VJV A;  3PBH A;  3BPM A;  2DC9 A;  1S4V A;  2E00 A;  1AYU A;  3OVZ A;  3H7D A;  1ME3 A;  2PAD A;  3KSE A;  2DCA A;  3P5V A;  2R9O A;  4FIP A;  2GFO A;  1NPZ A;  1ICF A;  3P5W A;  2AVW A;  4N4Z A;  1AEC A;  3S3R A;  1MS6 A;  1EWP A;  4XUI A;  2B1M A;  2FRQ A;  1CTE A;  1PBH A;  1PPD A;  6PAD A;  3CBJ A;  1AU2 A;  3QT4 A;  3H8B A;  3NHE A;  3H89 A;  3TNX A;  3P5U A;  3GCB A;  4X6I A;  9PAP A;  2YJ8 A;  1BP4 A;  1KHQ A;  4DMX A;  2XU3 A;  2CIO A;  5CVM A;  3KX1 A;  3N3G A;  4CDD B;  3N4C A;  4FJC A;  2PBH A;  2AIM A;  4YVA A;  4PI3 A;  3OF8 A;  2DCC A;  2R9M A;  3RVW A;  5CVN B;  2DC7 A;  3B79 A;  1YK8 A;  4I07 A;  1CVZ A;  3BWK A;  1THE A;  1STF E;  1BY8 A;  3HHA A;  2HD5 A;  2R9N A;  3N3K A;  5K16 A;  3HD3 A;  3KWB X;  1NQC A;  3LFY A;  2G8E A;  2HXZ A;  4BS6 A;  3E1Z B;  2VHS A;  2PNS A;  3WXF A;  1KFX L;  4CDF B;  1ZCM A;  2NQD B;  1NB3 A;  1CS8 A;  4WA6 A;  5J94 A;  2FRA A;  5EF4 A;  1PPO A;  3IOQ A;  1ITO A;  5JH3 A;  1NB5 A;  3KWZ A;  1TL9 A;  5PAD A;  2DZZ A;  1MEM A;  1QXP A;  4N8W A;  1ATK A;  3I06 A;  1KFU L;  3IMA A;  2YJ2 A;  1YK7 A;  1K3B B;  5CVO B;  4CDC B;  1TLO A;  2AUZ A;  2NQA A;  1U5I A;  2H7J A;  2G7Y A;  3O1G A;  3QSD A;  4CDE B;  5FPW A;  2OP3 A;  5CHT A;  2AS8 A;  1AU0 A;  1PPN A;  1AU4 A;  1EWM A;  2JQG R;  1GCB A;  2F7D A;  1DF0 A;  4QRV A;  2AUX A;  4DMY A;  3PDF A;  4YYV A;  4I04 A;  2Y6E A;  2P86 A;  3D6S A;  3K9M A;  2YJB A;  4KLB A;  2E03 A;  2G6D A;  1O0E A;  4P6G A;  1Y08 A;  4Q8H A;  4YYU A;  1EF7 A;  1ZIV A;  4HWY A;  3V6E A;  2FUD A;  3K24 A;  2JQF R;  3RVX A;  3QJ3 A;  2DCB A;  3M99 A;  8PCH A;  2DC8 A;  4PAD A;  2CB5 A;  2PRE A;  4AXM A;  4X6J A;  3V6C A; 
#chains in the Genus database with same CATH topology
 2BDL A;  2OUL A;  4YYR A;  1VSN A;  1SNK A;  3PHW A;  2FYE A;  1PXV A;  2JRI A;  1QDQ A;  4P6E A;  4OEM A;  1CB5 A;  1YVB A;  3USV A;  2DJF B;  3MOR A;  1ME4 A;  1PCI A;  2Y5B A;  4QRX A;  4XZX A;  4BS5 A;  1QOL A;  2F1G A;  1NL6 A;  3HWN A;  4PP1 A;  1GLO A;  1EWL A;  2FQ9 A;  4Q8G A;  3ZNH A;  2DOS A;  1MDW A;  1U9W A;  2IBI A;  3LXS A;  4RY2 A;  3PHU A;  1DEU A;  3RNV A;  3W30 A;  3OQC A;  1PPP A;  3IFU A;  2XU1 A;  2FT2 A;  1EWO A;  3BOW A;  4BQV A;  1PAD A;  3O0U A;  4OEL A;  1PIP A;  2HWK A;  4N79 A;  4D8B A;  2R6N A;  2R9C A;  2AU1 A;  4BOS A;  1CPJ A;  4XR7 A;  2DCD A;  4YYS A;  1F2B A;  4OVZ A;  3ERV A;  3CH2 X;  3IHP A;  1F29 A;  2WBF X;  1CSB B;  3BC3 A;  3C9E A;  3C0R A;  4AXL A;  3IV2 A;  7PCK A;  4K7C A;  2R9F A;  3U8E A;  2BTW B;  2ARY A;  1HUC B;  2AYN A;  4BSQ A;  1DKI A;  4ZUX U;  2B1N A;  4YV8 A;  2C0Y A;  3KFQ A;  2E02 A;  4FK5 A;  4OW0 A;  3H6S A;  5EGW A;  3CBK A;  3H8C A;  3TMP A;  1KXR A;  1TU6 A;  1GMY A;  3MTV A;  4BOU A;  1U9Q X;  1YT7 A;  3BPF A;  3CH3 X;  4HXD B;  3MHH A;  3IEJ A;  1F2A A;  4REZ A;  3WXE A;  2E01 A;  1U9X A;  1QMY A;  2FE8 A;  3ZUA A;  1YAL A;  3MJ5 A;  1CV8 A;  1M6D A;  4YYW A;  3W31 A;  3BCN A;  3IUT A;  2YJ9 A;  4ZTB A;  3I3T A;  3OVX A;  1NLJ A;  1GEC E;  4MSX A;  4MZO A;  2ACT A;  3OF9 A;  5CHV A;  2G8J A;  2DZY A;  1CJL A;  4RF1 A;  3K8U A;  1POP A;  3KW9 A;  4YYQ A;  3KKU A;  2HH5 A;  3TRK A;  1KHP A;  3MHS A;  4G54 A;  4BOP A;  3OIS A;  1FH0 A;  3MP2 A;  1MHW A;  2P7U A;  3PNR A;  1X9Y A;  1SP4 B;  3MTN A;  2AYO A;  2XU4 A;  4QH6 A;  1Y4H A;  1JQP A;  1YZB A;  4IP3 A;  3PRP A;  3BY4 A;  1AYV A;  2GHU A;  3F75 A;  3PW3 A;  2XU5 A;  3WXG A;  3F5V A;  4I05 A;  1XKG A;  2UZJ A;  2HHN A;  4X6H A;  2JTC A;  3DF0 A;  1F2C A;  1MIR A;  3PHX A;  1A6R A;  4M0W A;  2IPP B;  4CZW A;  1BQI A;  4QBB A;  4PT5 A;  3S3Q A;  2ATO A;  4W5B A;  1CQD A;  4W5C A;  2AGA A;  4BOQ A;  2NQI A;  4W4U A;  1PE6 A;  2O6X A;  5JA7 A;  2DJG B;  4MZS A;  1AU3 A;  1IWD A;  2VHF A;  4BPV A;  3HHI A;  1BGO A;  3PT2 A;  2BDZ A;  4PP2 E;  2FO5 A;  1AYW A;  1MEG A;  5EZQ A;  3RVV A;  2OZ2 A;  1AIM A;  5KO3 A;  1U9V A;  2YJC A;  5F02 A;  4QRG A;  2DC6 A;  1Q6K A;  2P0R A;  5A24 A;  3P5X A;  2FTD A;  2NQG A;  3AI8 A;  1VJV A;  3PBH A;  3BPM A;  2DC9 A;  1S4V A;  2E00 A;  1AYU A;  3OVZ A;  3H7D A;  1ME3 A;  2PAD A;  3KSE A;  4D8I A;  2DCA A;  3P5V A;  2R9O A;  4RF0 A;  4FIP A;  2GFO A;  1NPZ A;  1ICF A;  3P5W A;  2AVW A;  4N4Z A;  1AEC A;  3S3R A;  1MS6 A;  1EWP A;  2BU3 A;  4MM3 B;  4XUI A;  2B1M A;  2FRQ A;  1CTE A;  1PBH A;  1PPD A;  6PAD A;  2J7Q C;  3CBJ A;  1AU2 A;  3QT4 A;  3H8B A;  3NHE A;  3H89 A;  3TNX A;  3P5U A;  3PSE A;  3GCB A;  4X6I A;  9PAP A;  4D8E A;  2YJ8 A;  1BP4 A;  1KHQ A;  4DMX A;  2XU3 A;  2CIO A;  5CVM A;  3KX1 A;  3N3G A;  4CDD B;  3N4C A;  4FJC A;  2PBH A;  2AIM A;  4YVA A;  4PI3 A;  3OF8 A;  2Z84 A;  2DCC A;  2R9M A;  3RVW A;  5CVN B;  2DC7 A;  3B79 A;  1YK8 A;  2J7Q A;  4I07 A;  1CVZ A;  3BWK A;  1THE A;  1STF E;  4IUM A;  1BY8 A;  3HHA A;  2HD5 A;  2R9N A;  3N3K A;  5K16 A;  4R3D A;  3HD3 A;  3KWB X;  5EZS A;  1NQC A;  3LFY A;  3BB7 A;  2G8E A;  2HXZ A;  4BS6 A;  3E1Z B;  2VHS A;  2PNS A;  3WXF A;  1KFX L;  4CDF B;  3E9S A;  4RNA A;  1ZCM A;  4OVZ B;  2NQD B;  1NB3 A;  1CS8 A;  4WA6 A;  5J94 A;  2FRA A;  5EF4 A;  1PPO A;  1UKF A;  3IOQ A;  1ITO A;  5JH3 A;  1NB5 A;  3KWZ A;  1TL9 A;  5PAD A;  2DZZ A;  1MEM A;  1QXP A;  4N8W A;  1ATK A;  3I06 A;  1KFU L;  3IMA A;  2YJ2 A;  1YK7 A;  1K3B B;  5CVO B;  4CDC B;  1TLO A;  2AUZ A;  2NQA A;  1U5I A;  4MI7 A;  2H7J A;  4GUA A;  3PRM A;  2G7Y A;  3O1G A;  3QSD A;  4CDE B;  5FPW A;  2OP3 A;  5CHT A;  2AS8 A;  4WUR A;  1AU0 A;  1PPN A;  1AU4 A;  1EWM A;  2JQG R;  1PVJ A;  1GCB A;  2F7D A;  1DF0 A;  3BBA A;  4QRV A;  2AUX A;  4DMY A;  3PDF A;  4YYV A;  3B21 A;  4I04 A;  2Y6E A;  4P16 A;  2P86 A;  3D6S A;  3K9M A;  5JZE A;  2YJB A;  4KLB A;  2E03 A;  2G6D A;  1O0E A;  4P6G A;  1Y08 A;  4A5U A;  4Q8H A;  4YYU A;  1EF7 A;  1ZIV A;  4HWY A;  3V6E A;  2FUD A;  3K24 A;  3O65 A;  2JQF R;  3RVX A;  3QJ3 A;  2DCB A;  3M99 A;  4RKX A;  8PCH A;  2DC8 A;  4PAD A;  2CB5 A;  2PRE A;  4AXM A;  4BOZ A;  2BTW A;  4X6J A;  3V6C A;  5E6J A; 
#chains in the Genus database with same CATH homology
 2BDL A;  2OUL A;  4YYR A;  1VSN A;  1SNK A;  2FYE A;  1PXV A;  1QDQ A;  4P6E A;  4OEM A;  1CB5 A;  1YVB A;  3USV A;  2DJF B;  3MOR A;  1ME4 A;  1PCI A;  2Y5B A;  4QRX A;  4BS5 A;  1QOL A;  2F1G A;  3HWN A;  1NL6 A;  4PP1 A;  1GLO A;  1EWL A;  2FQ9 A;  1W5R A;  4Q8G A;  2VFC A;  2IBI A;  1MDW A;  1U9W A;  3LXS A;  4RY2 A;  1DEU A;  1PPP A;  2XU1 A;  2FT2 A;  1EWO A;  3BOW A;  4BQV A;  1PAD A;  3O0U A;  4OEL A;  1PIP A;  4N79 A;  2R6N A;  2R9C A;  2AU1 A;  1CPJ A;  4XR7 A;  2DCD A;  4YYS A;  1F2B A;  3ERV A;  3CH2 X;  3IHP A;  1F29 A;  2WBF X;  1CSB B;  3BC3 A;  3C9E A;  4AXL A;  3IV2 A;  7PCK A;  4K7C A;  2R9F A;  3U8E A;  2ARY A;  1HUC B;  2AYN A;  4BSQ A;  4ZUX U;  2B1N A;  4YV8 A;  2C0Y A;  3KFQ A;  2E02 A;  4FK5 A;  1GX3 A;  3H6S A;  5EGW A;  3CBK A;  3H8C A;  1KXR A;  1TU6 A;  1GMY A;  1U9Q X;  1YT7 A;  3BPF A;  3CH3 X;  4GUZ A;  3MHH A;  3IEJ A;  1F2A A;  1E2T A;  3WXE A;  2E01 A;  1U9X A;  1QMY A;  3ZUA A;  1YAL A;  1CV8 A;  1M6D A;  4YYW A;  3BCN A;  3IUT A;  2YJ9 A;  3I3T A;  3OVX A;  1NLJ A;  1GEC E;  4MSX A;  4MZO A;  2ACT A;  3OF9 A;  5CHV A;  2G8J A;  2DZY A;  1CJL A;  3K8U A;  1POP A;  3KW9 A;  4YYQ A;  3KKU A;  2HH5 A;  1KHP A;  1W6F A;  3MHS A;  4G54 A;  3OIS A;  1FH0 A;  1MHW A;  2P7U A;  3PNR A;  1X9Y A;  1SP4 B;  3MTN A;  2AYO A;  2XU4 A;  4QH6 A;  1Y4H A;  1JQP A;  1AYV A;  2GHU A;  4NV8 A;  3F75 A;  3PW3 A;  2XU5 A;  3WXG A;  3F5V A;  4I05 A;  1XKG A;  2HHN A;  4X6H A;  3DF0 A;  1F2C A;  1MIR A;  1A6R A;  2IPP B;  4CZW A;  1BQI A;  4QBB A;  3S3Q A;  2ATO A;  4W5B A;  1CQD A;  4W5C A;  2NQI A;  4W4U A;  1PE6 A;  2O6X A;  5JA7 A;  2DJG B;  4MZS A;  1AU3 A;  1IWD A;  2VHF A;  4BPV A;  3HHI A;  1BGO A;  2BDZ A;  4PP2 E;  2FO5 A;  1AYW A;  1MEG A;  3RVV A;  2OZ2 A;  1AIM A;  1U9V A;  2YJC A;  5F02 A;  4QRG A;  4C5P A;  2DC6 A;  1Q6K A;  2P0R A;  5A24 A;  3P5X A;  2FTD A;  2NQG A;  3AI8 A;  1VJV A;  3PBH A;  3BPM A;  2DC9 A;  1S4V A;  2E00 A;  1AYU A;  3OVZ A;  3H7D A;  1ME3 A;  2PAD A;  3KSE A;  2DCA A;  3P5V A;  2R9O A;  4FIP A;  2GFO A;  1NPZ A;  2VFB A;  1ICF A;  3P5W A;  2AVW A;  4N4Z A;  1AEC A;  3S3R A;  1MS6 A;  1EWP A;  4XUI A;  2B1M A;  2FRQ A;  1CTE A;  1PBH A;  1PPD A;  6PAD A;  3CBJ A;  1AU2 A;  3QT4 A;  3H8B A;  3NHE A;  3H89 A;  3TNX A;  3P5U A;  3GCB A;  4X6I A;  9PAP A;  2YJ8 A;  1BP4 A;  1KHQ A;  4DMX A;  2XU3 A;  4BGF A;  2CIO A;  5CVM A;  3KX1 A;  3N3G A;  4CDD B;  3N4C A;  4FJC A;  2PBH A;  2AIM A;  4YVA A;  4PI3 A;  3OF8 A;  2DCC A;  2R9M A;  3RVW A;  5CVN B;  2DC7 A;  3B79 A;  1YK8 A;  4I07 A;  1CVZ A;  3BWK A;  1THE A;  1STF E;  1BY8 A;  3HHA A;  2HD5 A;  2R9N A;  3N3K A;  5K16 A;  3HD3 A;  3KWB X;  1NQC A;  3LFY A;  2G8E A;  2HXZ A;  4BS6 A;  3E1Z B;  2VHS A;  2PNS A;  3WXF A;  1KFX L;  4CDF B;  3D9W A;  1ZCM A;  2NQD B;  1NB3 A;  1CS8 A;  4WA6 A;  5J94 A;  2FRA A;  5EF4 A;  1PPO A;  3IOQ A;  1ITO A;  5JH3 A;  1NB5 A;  3KWZ A;  1TL9 A;  5PAD A;  2DZZ A;  1MEM A;  1QXP A;  4N8W A;  1ATK A;  3I06 A;  1KFU L;  3IMA A;  2YJ2 A;  4B55 A;  1YK7 A;  1K3B B;  5CVO B;  4CDC B;  1TLO A;  2AUZ A;  2NQA A;  1U5I A;  2H7J A;  2G7Y A;  3O1G A;  3QSD A;  4CDE B;  4NV7 A;  5FPW A;  2OP3 A;  5CHT A;  2AS8 A;  1AU0 A;  1PPN A;  1AU4 A;  1EWM A;  2JQG R;  1GCB A;  2F7D A;  1DF0 A;  4QRV A;  2AUX A;  4DMY A;  3PDF A;  4YYV A;  4I04 A;  2Y6E A;  2P86 A;  3D6S A;  3K9M A;  1W4T A;  2YJB A;  4KLB A;  2E03 A;  2G6D A;  1O0E A;  4P6G A;  1Y08 A;  2BSZ A;  4Q8H A;  4YYU A;  1EF7 A;  1ZIV A;  4HWY A;  3V6E A;  2FUD A;  3K24 A;  2JQF R;  3RVX A;  3QJ3 A;  2DCB A;  3M99 A;  8PCH A;  2DC8 A;  4PAD A;  2CB5 A;  2PRE A;  4AXM A;  3LTW A;  4X6J A;  3V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...