1PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1padA00
3N3KA 1M6DA 3KW9A 1AIMA 3S3QA 2R9NA 3N4CA 2AVWA 1TLOA 4QRGA 2O6XA 1PADA 4BS5A 2ATOA 2P86A 2XU4A 3N3GA 2C0YA 1AECA 4PP2E 2NQAA 3BCNA 4FJCA 2AS8A 5CHVA 1PPNA 4X6IA 1YT7A 2VHFA 4BSQA 3WXGA 4I07A 4G54A 1POPA 1AU2A 3H8BA 2HD5A 3IMAA 2XU1A 2DJFB 2ARYA 2DZYA 3H7DA 2PREA 2R9CA 1NB3A 2XU5A 5PADA 2DC7A 1CS8A 1NL6A 3KWZA 4W5BA 3KX1A 2P7UA 3PBHA 4CDFB 1BP4A 4N8WA 1ITOA 4RY2A 3P5WA 1U9XA 3NHEA 2DCAA 2Y6EA 4PADA 2CB5A 1EWMA 3BWKA 3M99A 3WXEA 2R6NA 2B1NA 3DF0A 1F29A 2DJGB 4N4ZA 1Y08A 2B1MA 1TU6A 3IHPA 3RVVA 1NLJA 4X6JA 1GCBA 4YYVA 1BQIA 2YJBA 1KFUL 4P6GA 1TL9A 1F2CA 3QJ3A 4OELA 1ME3A 1SNKA 1ATKA 1U5IA 3H6SA 3H89A 1PIPA 2XU3A 1MEMA 3IUTA 4QH6A 1S4VA 4BQVA 5CVMA 8PCHA 1IWDA 3CBKA 4BPVA 4AXMA 3KWBX 2YJCA 4P6EA 3CBJA 3BPMA 2CIOA 2IPPB 3V6CA 2OULA 2R9OA 2FTDA 3IEJA 2AU1A 3I3TA 2E00A 4XR7A 1O0EA 1CPJA 1MIRA 4YYSA 6PADA 3OVXA 4FIPA 1EWOA 1ZCMA 4YYWA 2DCDA 4W5CA 2FO5A 4HWYA 2E02A 4YYUA 3O0UA 4QBBA 4MSXA 4AXLA 4I04A 3BPFA 1CB5A 3D6SA 4ZUXU 4W4UA 1QDQA 4BS6A 2PBHA 1PBHA 3QT4A 1AYWA 3HWNA 1CSBB 5JA7A 1QMYA 1SP4B 4PI3A 3RVXA 2DC9A 3ERVA 3OVZA 1ICFA 1PE6A 3P5XA 1CV8A 2AUZA 4YV8A 4CDCB 4YYRA 1NPZA 3USVA 2G8EA 3MORA 2OZ2A 2JQFR 3TNXA 5K16A 3S3RA 2FT2A 3HD3A 3H8CA 2PADA 4MZSA 2G6DA 1HUCB 1AYUA 2F7DA 2BDZA 2GFOA 3LFYA 4YYQA 3K24A 3U8EA 4WA6A 1Q6KA 3KFQA 2YJ9A 2HH5A 2NQGA 2F1GA 1CTEA 4CZWA 1VJVA 1PPOA 1YK7A 3MTNA 4DMYA 7PCKA 3BOWA 3O1GA 3P5VA 1PPPA 1YK8A 5A24A 2E03A 2R9FA 1CQDA 1CJLA 1VSNA 5CHTA 4DMXA 3IOQA 3P5UA 3OF9A 2HXZA 2DC8A 2YJ8A 3PW3A 4KLBA 3C9EA 3MHHA 2JQGR 4K7CA 4Q8GA 1GLOA 2FUDA 1CVZA 1F2BA 2GHUA 2R9MA 3CH3X 1U9QX 3LXSA 2FRAA 1NB5A 2G8JA 1XKGA 2DZZA 2DCBA 4N79A 5J94A 1AU3A 1PXVA 2AYOA 3QSDA 1Y4HA 4XUIA 2ACTA 2YJ2A 3HHIA 2FRQA 3B79A 2VHSA 4OEMA 1F2AA 2DCCA 1GMYA 5F02A 1KXRA 1U9VA 3OISA 3PNRA 1K3BB 3RVWA 4I05A 2FYEA 3BC3A 1MDWA 2AYNA 5JH3A 1BY8A 3KKUA 2NQIA 4PP1A 2HHNA 1U9WA 5CVNB 3I06A 3ZUAA 2AUXA 1GECE 1QOLA 3KSEA 1AU4A 2P0RA 4QRXA 1PCIA 1QXPA 1STFE 2AIMA 3F75A 2G7YA 1EF7A 1KHPA 4MZOA 1AYVA 1BGOA 3MHSA 1X9YA 1DF0A 2BDLA 2PNSA 1AU0A 3F5VA 1A6RA 3IV2A 1EWPA 4FK5A 3K9MA 4CDDB 1DEUA 3K8UA 1KFXL 5CVOB 4X6HA 1KHQA 1EWLA 1YALA 3OF8A 4Q8HA 2WBFX 3CH2X 5EGWA 9PAPA 4CDEB 2OP3A 3AI8A 1FH0A 5EF4A 2IBIA 2NQDB 2E01A 2FQ9A 1ME4A 2Y5BA 1MEGA 3GCBA 1NQCA 1PPDA 4YVAA 5FPWA 1MS6A 1THEA 3V6EA 1JQPA 4QRVA 1YVBA 3PDFA 3E1ZB 1ZIVA 3HHAA 2H7JA 2DC6A 3WXFA 1MHWA
chains in the Genus database with same CATH superfamily
3N3KA 1M6DA 3KW9A 1AIMA 3S3QA 2R9NA 3N4CA 4IUMA 2AVWA 1TLOA 4QRGA 2O6XA 1PADA 4BS5A 2ATOA 2P86A 2JTCA 2XU4A 3N3GA 2C0YA 1AECA 4OVZB 4PP2E 2NQAA 3BCNA 4FJCA 2BTWB 2AS8A 5CHVA 1PPNA 4X6IA 4BOQA 1YT7A 2VHFA 4BSQA 3WXGA 4I07A 4G54A 1POPA 1AU2A 3H8BA 2HD5A 3IMAA 2XU1A 3W31A 2DJFB 2ARYA 2DZYA 3H7DA 2PREA 2R9CA 1NB3A 2XU5A 5PADA 2DC7A 1CS8A 1NL6A 3KWZA 4W5BA 3KX1A 4BOPA 2P7UA 3PBHA 4CDFB 1BP4A 4N8WA 1ITOA 4RY2A 3P5WA 1U9XA 3NHEA 2DCAA 2Y6EA 5EZSA 4GUAA 4PADA 2CB5A 1EWMA 3BWKA 2AGAA 3M99A 3WXEA 2R6NA 2B1NA 3DF0A 1F29A 3E9SA 2DJGB 1Y08A 2B1MA 4N4ZA 1TU6A 3IHPA 3RVVA 1NLJA 4X6JA 1GCBA 4YYVA 1BQIA 2YJBA 1KFUL 4BOUA 4P6GA 1TL9A 1F2CA 3QJ3A 4OELA 1ME3A 4ZTBA 1SNKA 1ATKA 1U5IA 3H6SA 3H89A 1PIPA 2XU3A 1MEMA 3IUTA 4QH6A 4M0WA 1S4VA 4BQVA 5CVMA 8PCHA 1IWDA 3BB7A 3CBKA 4BPVA 3MP2A 4AXMA 3KWBX 5KO3A 2YJCA 4P6EA 3CBJA 3BPMA 2CIOA 2IPPB 3V6CA 2OULA 2R9OA 2FTDA 4D8BA 3IEJA 2AU1A 3I3TA 2E00A 3PHUA 4XR7A 1O0EA 1CPJA 1MIRA 5JZEA 4RNAA 4YYSA 6PADA 3OVXA 4FIPA 1EWOA 1ZCMA 4YYWA 2DCDA 4W5CA 2FO5A 4HWYA 2E02A 4YYUA 3O0UA 4QBBA 3PRPA 4MSXA 4AXLA 4BOSA 4I04A 3BPFA 1CB5A 3D6SA 2JRIA 4ZUXU 4W4UA 2BU3A 1QDQA 4BS6A 2PBHA 1PBHA 3QT4A 1AYWA 3HWNA 1CSBB 5JA7A 1QMYA 1SP4B 4PI3A 3RVXA 4HXDB 2DC9A 3ERVA 1UKFA 4RKXA 3OVZA 2FE8A 1ICFA 1PE6A 2Z84A 3P5XA 1CV8A 2AUZA 4YV8A 4CDCB 4YYRA 2J7QA 1NPZA 3USVA 2G8EA 3MORA 3OQCA 2OZ2A 1PVJA 2JQFR 3TNXA 2UZJA 3PSEA 5K16A 4RF0A 3S3RA 2FT2A 3HD3A 3H8CA 5E6JA 3W30A 2PADA 4MZSA 3TMPA 2G6DA 1HUCB 1AYUA 4R3DA 2F7DA 2BDZA 4IP3A 2GFOA 3LFYA 4YYQA 3BY4A 3K24A 3U8EA 4WA6A 1Q6KA 3KFQA 3TRKA 5EZQA 2YJ9A 2HH5A 2NQGA 2F1GA 1CTEA 4CZWA 1VJVA 1PPOA 1YK7A 3MTNA 3O65A 4DMYA 4OVZA 7PCKA 3BOWA 3O1GA 3P5VA 1PPPA 4P16A 2BTWA 1YK8A 5A24A 2E03A 2R9FA 1CQDA 1CJLA 3C0RA 1VSNA 5CHTA 3PHXA 4DMXA 4REZA 3IOQA 4OW0A 3P5UA 3OF9A 2HXZA 2DC8A 2YJ8A 3PW3A 3PHWA 4KLBA 3C9EA 3MHHA 2JQGR 4K7CA 4Q8GA 1GLOA 2FUDA 4BOZA 1CVZA 1F2BA 2GHUA 2R9MA 3CH3X 1U9QX 3LXSA 2FRAA 1NB5A 2G8JA 1XKGA 2DZZA 2DCBA 4N79A 5J94A 1AU3A 2HWKA 1PXVA 2AYOA 3QSDA 1Y4HA 4XUIA 2ACTA 2YJ2A 3HHIA 2FRQA 3B79A 2VHSA 4OEMA 2J7QC 1F2AA 2DCCA 1GMYA 5F02A 1KXRA 1U9VA 3OISA 3PNRA 1K3BB 3RVWA 4I05A 2FYEA 3BC3A 1MDWA 2AYNA 5JH3A 4PT5A 1BY8A 3KKUA 2NQIA 4PP1A 3B21A 2HHNA 1U9WA 5CVNB 3I06A 3ZUAA 2AUXA 1GECE 1QOLA 3KSEA 3BBAA 1AU4A 2P0RA 4QRXA 1PCIA 1QXPA 1STFE 2AIMA 3F75A 2G7YA 3RNVA 1EF7A 1KHPA 4MZOA 1AYVA 1BGOA 3MHSA 1X9YA 4RF1A 1DF0A 3IFUA 2BDLA 2PNSA 1AU0A 3F5VA 4XZXA 1A6RA 3IV2A 1EWPA 4FK5A 3K9MA 4CDDB 4WURA 1DEUA 4MM3B 3K8UA 1KFXL 5CVOB 1YZBA 4X6HA 1KHQA 1EWLA 1YALA 3OF8A 4Q8HA 2WBFX 3CH2X 2DOSA 5EGWA 9PAPA 3PRMA 4CDEB 2OP3A 3AI8A 4D8IA 3WXFA 1FH0A 5EF4A 3ZNHA 2IBIA 2NQDB 2E01A 3MTVA 2FQ9A 1ME4A 2Y5BA 1MEGA 3GCBA 3MJ5A 1NQCA 1PPDA 4YVAA 5FPWA 4MI7A 1MS6A 1THEA 3V6EA 1JQPA 1DKIA 4A5UA 4QRVA 1YVBA 4D8EA 3PDFA 3E1ZB 1ZIVA 3HHAA 2H7JA 2DC6A 3PT2A 1MHWA
chains in the Genus database with same CATH topology
3N3KA 1M6DA 3KW9A 1AIMA 3LTWA 3S3QA 2R9NA 3N4CA 2AVWA 1TLOA 4QRGA 2O6XA 1PADA 4BS5A 2ATOA 2P86A 2XU4A 3N3GA 2C0YA 1AECA 4PP2E 2NQAA 3BCNA 4FJCA 2AS8A 5CHVA 1PPNA 4X6IA 1YT7A 2VHFA 4BSQA 3WXGA 2VFCA 4I07A 4G54A 1POPA 1AU2A 3H8BA 2HD5A 3IMAA 2XU1A 1GX3A 1W6FA 2ARYA 2DJFB 2DZYA 3H7DA 2PREA 2R9CA 1NB3A 2XU5A 5PADA 2DC7A 1CS8A 1NL6A 3KWZA 4W5BA 3KX1A 2P7UA 3PBHA 4CDFB 1BP4A 4N8WA 1ITOA 4RY2A 3P5WA 2BSZA 1U9XA 3NHEA 2DCAA 2Y6EA 4PADA 2CB5A 1EWMA 3BWKA 3M99A 3WXEA 2R6NA 2B1NA 3DF0A 1F29A 2DJGB 4N4ZA 1Y08A 2B1MA 4NV7A 1TU6A 3IHPA 3RVVA 1NLJA 4X6JA 1GCBA 4YYVA 1BQIA 2YJBA 1KFUL 4P6GA 1TL9A 1F2CA 3QJ3A 4OELA 1ME3A 1SNKA 1ATKA 1U5IA 3H6SA 3H89A 1PIPA 2XU3A 1MEMA 3IUTA 4QH6A 1S4VA 4BQVA 5CVMA 4B55A 8PCHA 1IWDA 3CBKA 4BPVA 4AXMA 3KWBX 2YJCA 4P6EA 3CBJA 4C5PA 3BPMA 2CIOA 2IPPB 3V6CA 2OULA 2R9OA 2FTDA 3IEJA 2AU1A 3I3TA 2E00A 4XR7A 1O0EA 1CPJA 1MIRA 4YYSA 6PADA 3OVXA 4FIPA 1EWOA 1ZCMA 4YYWA 2DCDA 4W5CA 2FO5A 4HWYA 2E02A 4YYUA 3O0UA 4QBBA 4MSXA 4AXLA 4I04A 3BPFA 1CB5A 3D6SA 4ZUXU 4W4UA 1QDQA 4BS6A 2PBHA 1PBHA 3QT4A 1AYWA 3HWNA 4BGFA 1CSBB 5JA7A 1QMYA 1SP4B 4PI3A 3RVXA 2DC9A 3ERVA 3OVZA 1ICFA 1PE6A 3P5XA 1CV8A 2AUZA 4YV8A 4CDCB 4YYRA 1NPZA 3USVA 2G8EA 3MORA 2OZ2A 2JQFR 3TNXA 5K16A 3S3RA 2FT2A 3HD3A 3H8CA 2PADA 4MZSA 2G6DA 1HUCB 1AYUA 2F7DA 2BDZA 2GFOA 3LFYA 4YYQA 3K24A 3U8EA 4WA6A 1Q6KA 3D9WA 3KFQA 2YJ9A 2HH5A 2NQGA 2F1GA 1CTEA 4CZWA 1VJVA 1PPOA 1YK7A 3MTNA 4DMYA 7PCKA 3BOWA 3O1GA 3P5VA 1PPPA 1YK8A 5A24A 2E03A 2R9FA 4NV8A 1CQDA 1CJLA 1VSNA 5CHTA 4DMXA 3IOQA 3P5UA 3OF9A 2HXZA 2DC8A 2YJ8A 3PW3A 4KLBA 3C9EA 3MHHA 2JQGR 4K7CA 4Q8GA 1GLOA 2FUDA 1CVZA 1F2BA 2GHUA 2R9MA 3CH3X 1U9QX 3LXSA 2FRAA 1NB5A 2G8JA 1XKGA 2DZZA 2DCBA 4N79A 5J94A 1AU3A 1PXVA 2AYOA 3QSDA 1Y4HA 4XUIA 2ACTA 2YJ2A 3HHIA 2FRQA 3B79A 2VHSA 4OEMA 1F2AA 2DCCA 1GMYA 5F02A 1KXRA 1U9VA 3OISA 3PNRA 1K3BB 3RVWA 4I05A 2FYEA 3BC3A 1MDWA 2AYNA 5JH3A 1BY8A 3KKUA 2NQIA 4PP1A 2HHNA 1U9WA 5CVNB 3I06A 3ZUAA 2AUXA 1GECE 1QOLA 3KSEA 1AU4A 1W4TA 2P0RA 4QRXA 1PCIA 1QXPA 1STFE 2AIMA 3F75A 2G7YA 1EF7A 1KHPA 4MZOA 1AYVA 1BGOA 3MHSA 1X9YA 1DF0A 2BDLA 2PNSA 1AU0A 3F5VA 1W5RA 1A6RA 3IV2A 1EWPA 4FK5A 3K9MA 4CDDB 1DEUA 3K8UA 1KFXL 5CVOB 4X6HA 1KHQA 1EWLA 1YALA 3OF8A 4Q8HA 2WBFX 3CH2X 5EGWA 9PAPA 4CDEB 2OP3A 3AI8A 2VFBA 1FH0A 5EF4A 2IBIA 2NQDB 2E01A 2FQ9A 1ME4A 4GUZA 2Y5BA 1MEGA 3GCBA 1NQCA 1PPDA 4YVAA 5FPWA 1MS6A 1THEA 3V6EA 1JQPA 4QRVA 1YVBA 1E2TA 3PDFA 3E1ZB 1ZIVA 3HHAA 2H7JA 2DC6A 3WXFA 1MHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3K A;  1M6D A;  3KW9 A;  1AIM A;  3S3Q A;  2R9N A;  3N4C A;  2AVW A;  1TLO A;  4QRG A;  2O6X A;  1PAD A;  4BS5 A;  2ATO A;  2P86 A;  2XU4 A;  3N3G A;  2C0Y A;  1AEC A;  4PP2 E;  2NQA A;  3BCN A;  4FJC A;  2AS8 A;  5CHV A;  1PPN A;  4X6I A;  1YT7 A;  2VHF A;  4BSQ A;  3WXG A;  4I07 A;  4G54 A;  1POP A;  1AU2 A;  3H8B A;  2HD5 A;  3IMA A;  2XU1 A;  2DJF B;  2ARY A;  2DZY A;  3H7D A;  2PRE A;  2R9C A;  1NB3 A;  2XU5 A;  5PAD A;  2DC7 A;  1CS8 A;  1NL6 A;  3KWZ A;  4W5B A;  3KX1 A;  2P7U A;  3PBH A;  4CDF B;  1BP4 A;  4N8W A;  1ITO A;  4RY2 A;  3P5W A;  1U9X A;  3NHE A;  2DCA A;  2Y6E A;  4PAD A;  2CB5 A;  1EWM A;  3BWK A;  3M99 A;  3WXE A;  2R6N A;  2B1N A;  3DF0 A;  1F29 A;  2DJG B;  4N4Z A;  1Y08 A;  2B1M A;  1TU6 A;  3IHP A;  3RVV A;  1NLJ A;  4X6J A;  1GCB A;  4YYV A;  1BQI A;  2YJB A;  1KFU L;  4P6G A;  1TL9 A;  1F2C A;  3QJ3 A;  4OEL A;  1ME3 A;  1SNK A;  1ATK A;  1U5I A;  3H6S A;  3H89 A;  1PIP A;  2XU3 A;  1MEM A;  3IUT A;  4QH6 A;  1S4V A;  4BQV A;  5CVM A;  8PCH A;  1IWD A;  3CBK A;  4BPV A;  4AXM A;  3KWB X;  2YJC A;  4P6E A;  3CBJ A;  3BPM A;  2CIO A;  2IPP B;  3V6C A;  2OUL A;  2R9O A;  2FTD A;  3IEJ A;  2AU1 A;  3I3T A;  2E00 A;  4XR7 A;  1O0E A;  1CPJ A;  1MIR A;  4YYS A;  6PAD A;  3OVX A;  4FIP A;  1EWO A;  1ZCM A;  4YYW A;  2DCD A;  4W5C A;  2FO5 A;  4HWY A;  2E02 A;  4YYU A;  3O0U A;  4QBB A;  4MSX A;  4AXL A;  4I04 A;  3BPF A;  1CB5 A;  3D6S A;  4ZUX U;  4W4U A;  1QDQ A;  4BS6 A;  2PBH A;  1PBH A;  3QT4 A;  1AYW A;  3HWN A;  1CSB B;  5JA7 A;  1QMY A;  1SP4 B;  4PI3 A;  3RVX A;  2DC9 A;  3ERV A;  3OVZ A;  1ICF A;  1PE6 A;  3P5X A;  1CV8 A;  2AUZ A;  4YV8 A;  4CDC B;  4YYR A;  1NPZ A;  3USV A;  2G8E A;  3MOR A;  2OZ2 A;  2JQF R;  3TNX A;  5K16 A;  3S3R A;  2FT2 A;  3HD3 A;  3H8C A;  2PAD A;  4MZS A;  2G6D A;  1HUC B;  1AYU A;  2F7D A;  2BDZ A;  2GFO A;  3LFY A;  4YYQ A;  3K24 A;  3U8E A;  4WA6 A;  1Q6K A;  3KFQ A;  2YJ9 A;  2HH5 A;  2NQG A;  2F1G A;  1CTE A;  4CZW A;  1VJV A;  1PPO A;  1YK7 A;  3MTN A;  4DMY A;  7PCK A;  3BOW A;  3O1G A;  3P5V A;  1PPP A;  1YK8 A;  5A24 A;  2E03 A;  2R9F A;  1CQD A;  1CJL A;  1VSN A;  5CHT A;  4DMX A;  3IOQ A;  3P5U A;  3OF9 A;  2HXZ A;  2DC8 A;  2YJ8 A;  3PW3 A;  4KLB A;  3C9E A;  3MHH A;  2JQG R;  4K7C A;  4Q8G A;  1GLO A;  2FUD A;  1CVZ A;  1F2B A;  2GHU A;  2R9M A;  3CH3 X;  1U9Q X;  3LXS A;  2FRA A;  1NB5 A;  2G8J A;  1XKG A;  2DZZ A;  2DCB A;  4N79 A;  5J94 A;  1AU3 A;  1PXV A;  2AYO A;  3QSD A;  1Y4H A;  4XUI A;  2ACT A;  2YJ2 A;  3HHI A;  2FRQ A;  3B79 A;  2VHS A;  4OEM A;  1F2A A;  2DCC A;  1GMY A;  5F02 A;  1KXR A;  1U9V A;  3OIS A;  3PNR A;  1K3B B;  3RVW A;  4I05 A;  2FYE A;  3BC3 A;  1MDW A;  2AYN A;  5JH3 A;  1BY8 A;  3KKU A;  2NQI A;  4PP1 A;  2HHN A;  1U9W A;  5CVN B;  3I06 A;  3ZUA A;  2AUX A;  1GEC E;  1QOL A;  3KSE A;  1AU4 A;  2P0R A;  4QRX A;  1PCI A;  1QXP A;  1STF E;  2AIM A;  3F75 A;  2G7Y A;  1EF7 A;  1KHP A;  4MZO A;  1AYV A;  1BGO A;  3MHS A;  1X9Y A;  1DF0 A;  2BDL A;  2PNS A;  1AU0 A;  3F5V A;  1A6R A;  3IV2 A;  1EWP A;  4FK5 A;  3K9M A;  4CDD B;  1DEU A;  3K8U A;  1KFX L;  5CVO B;  4X6H A;  1KHQ A;  1EWL A;  1YAL A;  3OF8 A;  4Q8H A;  2WBF X;  3CH2 X;  5EGW A;  9PAP A;  4CDE B;  2OP3 A;  3AI8 A;  1FH0 A;  5EF4 A;  2IBI A;  2NQD B;  2E01 A;  2FQ9 A;  1ME4 A;  2Y5B A;  1MEG A;  3GCB A;  1NQC A;  1PPD A;  4YVA A;  5FPW A;  1MS6 A;  1THE A;  3V6E A;  1JQP A;  4QRV A;  1YVB A;  3PDF A;  3E1Z B;  1ZIV A;  3HHA A;  2H7J A;  2DC6 A;  3WXF A;  1MHW A; 
#chains in the Genus database with same CATH topology
 3N3K A;  1M6D A;  3KW9 A;  1AIM A;  3S3Q A;  2R9N A;  3N4C A;  4IUM A;  2AVW A;  1TLO A;  4QRG A;  2O6X A;  1PAD A;  4BS5 A;  2ATO A;  2P86 A;  2JTC A;  2XU4 A;  3N3G A;  2C0Y A;  1AEC A;  4OVZ B;  4PP2 E;  2NQA A;  3BCN A;  4FJC A;  2BTW B;  2AS8 A;  5CHV A;  1PPN A;  4X6I A;  4BOQ A;  1YT7 A;  2VHF A;  4BSQ A;  3WXG A;  4I07 A;  4G54 A;  1POP A;  1AU2 A;  3H8B A;  2HD5 A;  3IMA A;  2XU1 A;  3W31 A;  2DJF B;  2ARY A;  2DZY A;  3H7D A;  2PRE A;  2R9C A;  1NB3 A;  2XU5 A;  5PAD A;  2DC7 A;  1CS8 A;  1NL6 A;  3KWZ A;  4W5B A;  3KX1 A;  4BOP A;  2P7U A;  3PBH A;  4CDF B;  1BP4 A;  4N8W A;  1ITO A;  4RY2 A;  3P5W A;  1U9X A;  3NHE A;  2DCA A;  2Y6E A;  5EZS A;  4GUA A;  4PAD A;  2CB5 A;  1EWM A;  3BWK A;  2AGA A;  3M99 A;  3WXE A;  2R6N A;  2B1N A;  3DF0 A;  1F29 A;  3E9S A;  2DJG B;  1Y08 A;  2B1M A;  4N4Z A;  1TU6 A;  3IHP A;  3RVV A;  1NLJ A;  4X6J A;  1GCB A;  4YYV A;  1BQI A;  2YJB A;  1KFU L;  4BOU A;  4P6G A;  1TL9 A;  1F2C A;  3QJ3 A;  4OEL A;  1ME3 A;  4ZTB A;  1SNK A;  1ATK A;  1U5I A;  3H6S A;  3H89 A;  1PIP A;  2XU3 A;  1MEM A;  3IUT A;  4QH6 A;  4M0W A;  1S4V A;  4BQV A;  5CVM A;  8PCH A;  1IWD A;  3BB7 A;  3CBK A;  4BPV A;  3MP2 A;  4AXM A;  3KWB X;  5KO3 A;  2YJC A;  4P6E A;  3CBJ A;  3BPM A;  2CIO A;  2IPP B;  3V6C A;  2OUL A;  2R9O A;  2FTD A;  4D8B A;  3IEJ A;  2AU1 A;  3I3T A;  2E00 A;  3PHU A;  4XR7 A;  1O0E A;  1CPJ A;  1MIR A;  5JZE A;  4RNA A;  4YYS A;  6PAD A;  3OVX A;  4FIP A;  1EWO A;  1ZCM A;  4YYW A;  2DCD A;  4W5C A;  2FO5 A;  4HWY A;  2E02 A;  4YYU A;  3O0U A;  4QBB A;  3PRP A;  4MSX A;  4AXL A;  4BOS A;  4I04 A;  3BPF A;  1CB5 A;  3D6S A;  2JRI A;  4ZUX U;  4W4U A;  2BU3 A;  1QDQ A;  4BS6 A;  2PBH A;  1PBH A;  3QT4 A;  1AYW A;  3HWN A;  1CSB B;  5JA7 A;  1QMY A;  1SP4 B;  4PI3 A;  3RVX A;  4HXD B;  2DC9 A;  3ERV A;  1UKF A;  4RKX A;  3OVZ A;  2FE8 A;  1ICF A;  1PE6 A;  2Z84 A;  3P5X A;  1CV8 A;  2AUZ A;  4YV8 A;  4CDC B;  4YYR A;  2J7Q A;  1NPZ A;  3USV A;  2G8E A;  3MOR A;  3OQC A;  2OZ2 A;  1PVJ A;  2JQF R;  3TNX A;  2UZJ A;  3PSE A;  5K16 A;  4RF0 A;  3S3R A;  2FT2 A;  3HD3 A;  3H8C A;  5E6J A;  3W30 A;  2PAD A;  4MZS A;  3TMP A;  2G6D A;  1HUC B;  1AYU A;  4R3D A;  2F7D A;  2BDZ A;  4IP3 A;  2GFO A;  3LFY A;  4YYQ A;  3BY4 A;  3K24 A;  3U8E A;  4WA6 A;  1Q6K A;  3KFQ A;  3TRK A;  5EZQ A;  2YJ9 A;  2HH5 A;  2NQG A;  2F1G A;  1CTE A;  4CZW A;  1VJV A;  1PPO A;  1YK7 A;  3MTN A;  3O65 A;  4DMY A;  4OVZ A;  7PCK A;  3BOW A;  3O1G A;  3P5V A;  1PPP A;  4P16 A;  2BTW A;  1YK8 A;  5A24 A;  2E03 A;  2R9F A;  1CQD A;  1CJL A;  3C0R A;  1VSN A;  5CHT A;  3PHX A;  4DMX A;  4REZ A;  3IOQ A;  4OW0 A;  3P5U A;  3OF9 A;  2HXZ A;  2DC8 A;  2YJ8 A;  3PW3 A;  3PHW A;  4KLB A;  3C9E A;  3MHH A;  2JQG R;  4K7C A;  4Q8G A;  1GLO A;  2FUD A;  4BOZ A;  1CVZ A;  1F2B A;  2GHU A;  2R9M A;  3CH3 X;  1U9Q X;  3LXS A;  2FRA A;  1NB5 A;  2G8J A;  1XKG A;  2DZZ A;  2DCB A;  4N79 A;  5J94 A;  1AU3 A;  2HWK A;  1PXV A;  2AYO A;  3QSD A;  1Y4H A;  4XUI A;  2ACT A;  2YJ2 A;  3HHI A;  2FRQ A;  3B79 A;  2VHS A;  4OEM A;  2J7Q C;  1F2A A;  2DCC A;  1GMY A;  5F02 A;  1KXR A;  1U9V A;  3OIS A;  3PNR A;  1K3B B;  3RVW A;  4I05 A;  2FYE A;  3BC3 A;  1MDW A;  2AYN A;  5JH3 A;  4PT5 A;  1BY8 A;  3KKU A;  2NQI A;  4PP1 A;  3B21 A;  2HHN A;  1U9W A;  5CVN B;  3I06 A;  3ZUA A;  2AUX A;  1GEC E;  1QOL A;  3KSE A;  3BBA A;  1AU4 A;  2P0R A;  4QRX A;  1PCI A;  1QXP A;  1STF E;  2AIM A;  3F75 A;  2G7Y A;  3RNV A;  1EF7 A;  1KHP A;  4MZO A;  1AYV A;  1BGO A;  3MHS A;  1X9Y A;  4RF1 A;  1DF0 A;  3IFU A;  2BDL A;  2PNS A;  1AU0 A;  3F5V A;  4XZX A;  1A6R A;  3IV2 A;  1EWP A;  4FK5 A;  3K9M A;  4CDD B;  4WUR A;  1DEU A;  4MM3 B;  3K8U A;  1KFX L;  5CVO B;  1YZB A;  4X6H A;  1KHQ A;  1EWL A;  1YAL A;  3OF8 A;  4Q8H A;  2WBF X;  3CH2 X;  2DOS A;  5EGW A;  9PAP A;  3PRM A;  4CDE B;  2OP3 A;  3AI8 A;  4D8I A;  3WXF A;  1FH0 A;  5EF4 A;  3ZNH A;  2IBI A;  2NQD B;  2E01 A;  3MTV A;  2FQ9 A;  1ME4 A;  2Y5B A;  1MEG A;  3GCB A;  3MJ5 A;  1NQC A;  1PPD A;  4YVA A;  5FPW A;  4MI7 A;  1MS6 A;  1THE A;  3V6E A;  1JQP A;  1DKI A;  4A5U A;  4QRV A;  1YVB A;  4D8E A;  3PDF A;  3E1Z B;  1ZIV A;  3HHA A;  2H7J A;  2DC6 A;  3PT2 A;  1MHW A; 
#chains in the Genus database with same CATH homology
 3N3K A;  1M6D A;  3KW9 A;  1AIM A;  3LTW A;  3S3Q A;  2R9N A;  3N4C A;  2AVW A;  1TLO A;  4QRG A;  2O6X A;  1PAD A;  4BS5 A;  2ATO A;  2P86 A;  2XU4 A;  3N3G A;  2C0Y A;  1AEC A;  4PP2 E;  2NQA A;  3BCN A;  4FJC A;  2AS8 A;  5CHV A;  1PPN A;  4X6I A;  1YT7 A;  2VHF A;  4BSQ A;  3WXG A;  2VFC A;  4I07 A;  4G54 A;  1POP A;  1AU2 A;  3H8B A;  2HD5 A;  3IMA A;  2XU1 A;  1GX3 A;  1W6F A;  2ARY A;  2DJF B;  2DZY A;  3H7D A;  2PRE A;  2R9C A;  1NB3 A;  2XU5 A;  5PAD A;  2DC7 A;  1CS8 A;  1NL6 A;  3KWZ A;  4W5B A;  3KX1 A;  2P7U A;  3PBH A;  4CDF B;  1BP4 A;  4N8W A;  1ITO A;  4RY2 A;  3P5W A;  2BSZ A;  1U9X A;  3NHE A;  2DCA A;  2Y6E A;  4PAD A;  2CB5 A;  1EWM A;  3BWK A;  3M99 A;  3WXE A;  2R6N A;  2B1N A;  3DF0 A;  1F29 A;  2DJG B;  4N4Z A;  1Y08 A;  2B1M A;  4NV7 A;  1TU6 A;  3IHP A;  3RVV A;  1NLJ A;  4X6J A;  1GCB A;  4YYV A;  1BQI A;  2YJB A;  1KFU L;  4P6G A;  1TL9 A;  1F2C A;  3QJ3 A;  4OEL A;  1ME3 A;  1SNK A;  1ATK A;  1U5I A;  3H6S A;  3H89 A;  1PIP A;  2XU3 A;  1MEM A;  3IUT A;  4QH6 A;  1S4V A;  4BQV A;  5CVM A;  4B55 A;  8PCH A;  1IWD A;  3CBK A;  4BPV A;  4AXM A;  3KWB X;  2YJC A;  4P6E A;  3CBJ A;  4C5P A;  3BPM A;  2CIO A;  2IPP B;  3V6C A;  2OUL A;  2R9O A;  2FTD A;  3IEJ A;  2AU1 A;  3I3T A;  2E00 A;  4XR7 A;  1O0E A;  1CPJ A;  1MIR A;  4YYS A;  6PAD A;  3OVX A;  4FIP A;  1EWO A;  1ZCM A;  4YYW A;  2DCD A;  4W5C A;  2FO5 A;  4HWY A;  2E02 A;  4YYU A;  3O0U A;  4QBB A;  4MSX A;  4AXL A;  4I04 A;  3BPF A;  1CB5 A;  3D6S A;  4ZUX U;  4W4U A;  1QDQ A;  4BS6 A;  2PBH A;  1PBH A;  3QT4 A;  1AYW A;  3HWN A;  4BGF A;  1CSB B;  5JA7 A;  1QMY A;  1SP4 B;  4PI3 A;  3RVX A;  2DC9 A;  3ERV A;  3OVZ A;  1ICF A;  1PE6 A;  3P5X A;  1CV8 A;  2AUZ A;  4YV8 A;  4CDC B;  4YYR A;  1NPZ A;  3USV A;  2G8E A;  3MOR A;  2OZ2 A;  2JQF R;  3TNX A;  5K16 A;  3S3R A;  2FT2 A;  3HD3 A;  3H8C A;  2PAD A;  4MZS A;  2G6D A;  1HUC B;  1AYU A;  2F7D A;  2BDZ A;  2GFO A;  3LFY A;  4YYQ A;  3K24 A;  3U8E A;  4WA6 A;  1Q6K A;  3D9W A;  3KFQ A;  2YJ9 A;  2HH5 A;  2NQG A;  2F1G A;  1CTE A;  4CZW A;  1VJV A;  1PPO A;  1YK7 A;  3MTN A;  4DMY A;  7PCK A;  3BOW A;  3O1G A;  3P5V A;  1PPP A;  1YK8 A;  5A24 A;  2E03 A;  2R9F A;  4NV8 A;  1CQD A;  1CJL A;  1VSN A;  5CHT A;  4DMX A;  3IOQ A;  3P5U A;  3OF9 A;  2HXZ A;  2DC8 A;  2YJ8 A;  3PW3 A;  4KLB A;  3C9E A;  3MHH A;  2JQG R;  4K7C A;  4Q8G A;  1GLO A;  2FUD A;  1CVZ A;  1F2B A;  2GHU A;  2R9M A;  3CH3 X;  1U9Q X;  3LXS A;  2FRA A;  1NB5 A;  2G8J A;  1XKG A;  2DZZ A;  2DCB A;  4N79 A;  5J94 A;  1AU3 A;  1PXV A;  2AYO A;  3QSD A;  1Y4H A;  4XUI A;  2ACT A;  2YJ2 A;  3HHI A;  2FRQ A;  3B79 A;  2VHS A;  4OEM A;  1F2A A;  2DCC A;  1GMY A;  5F02 A;  1KXR A;  1U9V A;  3OIS A;  3PNR A;  1K3B B;  3RVW A;  4I05 A;  2FYE A;  3BC3 A;  1MDW A;  2AYN A;  5JH3 A;  1BY8 A;  3KKU A;  2NQI A;  4PP1 A;  2HHN A;  1U9W A;  5CVN B;  3I06 A;  3ZUA A;  2AUX A;  1GEC E;  1QOL A;  3KSE A;  1AU4 A;  1W4T A;  2P0R A;  4QRX A;  1PCI A;  1QXP A;  1STF E;  2AIM A;  3F75 A;  2G7Y A;  1EF7 A;  1KHP A;  4MZO A;  1AYV A;  1BGO A;  3MHS A;  1X9Y A;  1DF0 A;  2BDL A;  2PNS A;  1AU0 A;  3F5V A;  1W5R A;  1A6R A;  3IV2 A;  1EWP A;  4FK5 A;  3K9M A;  4CDD B;  1DEU A;  3K8U A;  1KFX L;  5CVO B;  4X6H A;  1KHQ A;  1EWL A;  1YAL A;  3OF8 A;  4Q8H A;  2WBF X;  3CH2 X;  5EGW A;  9PAP A;  4CDE B;  2OP3 A;  3AI8 A;  2VFB A;  1FH0 A;  5EF4 A;  2IBI A;  2NQD B;  2E01 A;  2FQ9 A;  1ME4 A;  4GUZ A;  2Y5B A;  1MEG A;  3GCB A;  1NQC A;  1PPD A;  4YVA A;  5FPW A;  1MS6 A;  1THE A;  3V6E A;  1JQP A;  4QRV A;  1YVB A;  1E2T A;  3PDF A;  3E1Z B;  1ZIV A;  3HHA A;  2H7J A;  2DC6 A;  3WXF A;  1MHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...