4MZOA

Mouse cathepsin s with covalent ligand (3s,4s)-n-[(2e)-2-iminoethyl]-4-(morpholin-4-ylcarbonyl)-1-(phenylsulfonyl)pyrrolidine-3-carboxamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of potent and selective cathepsin S inhibitors containing different central cyclic scaffolds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4mzoA00
4BPVA 3IV2A 1EWPA 4MZSA 4P6GA 4PP1A 2OZ2A 3B79A 4BS5A 2DCBA 4FIPA 5K16A 1PPNA 2G7YA 4P6EA 5EGWA 2XU5A 1CV8A 2B1MA 2FO5A 4W5CA 3MHSA 3OISA 2PBHA 2AIMA 2YJ2A 1ZIVA 3H8BA 4N79A 1GMYA 1KHQA 5A24A 4BQVA 2OP3A 2DC7A 3BOWA 2XU3A 3USVA 1S4VA 3H89A 4YYUA 2NQDB 1YK8A 1SNKA 1TLOA 2PNSA 1M6DA 3HD3A 1MS6A 5JH3A 1DF0A 2R6NA 3QJ3A 4CDFB 4YYRA 3I3TA 4BSQA 1Q6KA 1NB3A 1PCIA 2GFOA 4RY2A 3OF9A 3LXSA 1EWLA 3IEJA 3DF0A 3M99A 1CTEA 1QXPA 1MEGA 1ZCMA 2R9CA 3HHIA 3H6SA 1KFUL 3RVWA 2FRAA 1QDQA 2P0RA 2R9FA 2IPPB 4G54A 2NQAA 1EWMA 1CJLA 4QBBA 1NB5A 3WXFA 1DEUA 3AI8A 2HD5A 3WXEA 2Y5BA 2AYNA 3QT4A 2HH5A 2IBIA 1X9YA 4X6JA 4YYSA 3RVVA 3H7DA 3BPMA 2DZYA 3C9EA 2PADA 4N8WA 1U9QX 4QRVA 3PBHA 1CVZA 2YJ8A 1A6RA 1KXRA 2DJFB 3MHHA 2AVWA 3ERVA 1CSBB 2C0YA 4W5BA 2AUXA 3BPFA 2JQFR 4XR7A 5FPWA 4I07A 2DC8A 3BWKA 1PADA 3HWNA 2FYEA 1VJVA 1YT7A 1U9VA 3IMAA 1PE6A 1AYWA 2E00A 2DZZA 4W4UA 4YV8A 3ZUAA 1FH0A 4MSXA 2HHNA 1GLOA 2AUZA 3O1GA 4CDEB 2E01A 2NQGA 2AYOA 1GCBA 4CDDB 3P5VA 3KFQA 2VHFA 2XU1A 1JQPA 3O0UA 4DMYA 3WXGA 4QRXA 3K8UA 1NQCA 2AS8A 3PW3A 2FQ9A 4X6HA 3P5WA 4QH6A 3IOQA 4I05A 1AYVA 1PBHA 1NL6A 2FTDA 2XU4A 4WA6A 2Y6EA 1QMYA 1BQIA 2NQIA 3E1ZB 1VSNA 2O6XA 1CQDA 3BCNA 4X6IA 2FRQA 1BP4A 4QRGA 1F2BA 1ATKA 4Q8HA 1CB5A 2ATOA 2VHSA 2WBFX 1QOLA 2H7JA 1MDWA 1EWOA 2BDZA 2P86A 4I04A 2DC6A 3KX1A 3MORA 4XUIA 1KFXL 4YYVA 1AU4A 1O0EA 3PDFA 7PCKA 4KLBA 3IHPA 4YYQA 1PPOA 2GHUA 3N4CA 3P5UA 1KHPA 3PNRA 5CVNB 1MEMA 3HHAA 1MHWA 3KW9A 2HXZA 4PP2E 2JQGR 6PADA 3CBJA 4HWYA 3D6SA 2OULA 1IWDA 1THEA 1AU3A 2CB5A 4PADA 1U5IA 1HUCB 2DJGB 4FJCA 3S3RA 1PPDA 3KKUA 2F1GA 4FK5A 4K7CA 1F29A 1AYUA 1PXVA 2FUDA 5CVOB 1AECA 1BGOA 3U8EA 4YVAA 2DCCA 3LFYA 5CVMA 1K3BB 1YVBA 3BC3A 1CPJA 5CHVA 1SP4B 1TL9A 4DMXA 4AXMA 1YK7A 2BDLA 4OEMA 2DC9A 3GCBA 2G6DA 1EF7A 1ME4A 1CS8A 3P5XA 1NPZA 1AU2A 3TNXA 1F2AA 3OVXA 2YJ9A 4N4ZA 3KWBX 2YJCA 5PADA 2AU1A 4AXLA 3K9MA 5JA7A 2FT2A 2P7UA 3OVZA 2E02A 3CH2X 4YYWA 4PI3A 1U9XA 3RVXA 1BY8A 1Y4HA 4CDCB 9PAPA 3N3KA 4ZUXU 1U9WA 1STFE 1Y08A 2R9MA 2CIOA 2F7DA 2G8JA 2R9OA 1GECE 5J94A 1ITOA 3V6CA 5EF4A 3CBKA 1YALA 2PREA 3CH3X 3NHEA 3IUTA 3V6EA 2G8EA 1XKGA 4CZWA 1ICFA 5CHTA 3KSEA 3I06A 2YJBA 2DCAA 5F02A 3N3GA 3KWZA 3OF8A 4OELA 1AIMA 1F2CA 3H8CA 1POPA 1PPPA 3QSDA 1TU6A 1PIPA 8PCHA 3MTNA 1MIRA 2R9NA 2DCDA 1ME3A 4MZOA 3K24A 4Q8GA 2ACTA 1NLJA 3F5VA 2B1NA 3S3QA 2E03A 4BS6A 1AU0A 3F75A 2ARYA
chains in the Genus database with same CATH superfamily
4BPVA 3IV2A 1EWPA 4MZSA 4P6GA 4PP1A 2OZ2A 3B79A 4BS5A 2DCBA 4FIPA 5K16A 3BY4A 1PPNA 4BOUA 2G7YA 4P6EA 5EGWA 2XU5A 1CV8A 2B1MA 4A5UA 2FO5A 4W5CA 3MHSA 3MJ5A 3OISA 2PBHA 2AIMA 2YJ2A 1ZIVA 3H8BA 4N79A 1GMYA 1KHQA 2FE8A 5A24A 4BQVA 2OP3A 2DC7A 3BOWA 2XU3A 3USVA 1S4VA 3H89A 4YYUA 2NQDB 1YK8A 3PHXA 1SNKA 3PRMA 1TLOA 2PNSA 3PHUA 1M6DA 3HD3A 3TRKA 1MS6A 5JH3A 1DF0A 2R6NA 3TMPA 3QJ3A 4CDFB 4M0WA 4YYRA 3I3TA 4BSQA 4OVZB 1Q6KA 1NB3A 1PCIA 2GFOA 4RY2A 3OF9A 3LXSA 1EWLA 3IEJA 3DF0A 3M99A 3PT2A 1CTEA 1QXPA 1MEGA 4MM3B 1ZCMA 2R9CA 3HHIA 3H6SA 1KFUL 3RVWA 2FRAA 1QDQA 2P0RA 3BB7A 2R9FA 4GUAA 2IPPB 4G54A 2NQAA 1EWMA 1CJLA 4BOQA 4QBBA 1NB5A 1DKIA 3WXFA 1DEUA 3AI8A 2HD5A 3WXEA 2Y5BA 2AYNA 4REZA 3QT4A 3PRPA 2HH5A 2IBIA 3MTVA 1X9YA 4X6JA 1PVJA 1YZBA 4YYSA 3RVVA 3H7DA 3BPMA 2DZYA 4PT5A 3C9EA 2PADA 2J7QC 3PHWA 4N8WA 1U9QX 4QRVA 3PBHA 3OQCA 1CVZA 3IFUA 4IP3A 2YJ8A 1A6RA 1KXRA 2DJFB 3MP2A 3MHHA 2AVWA 3ERVA 1CSBB 2C0YA 4W5BA 5EZSA 2AUXA 3BPFA 2JQFR 4XR7A 5FPWA 4I07A 2DC8A 3BWKA 1PADA 3HWNA 2FYEA 1VJVA 2HWKA 1YT7A 1U9VA 3IMAA 1PE6A 1AYWA 2E00A 4XZXA 2DZZA 4W4UA 4YV8A 3ZUAA 1FH0A 4MSXA 2HHNA 4D8EA 1GLOA 2AUZA 3O1GA 4CDEB 2E01A 2NQGA 2AYOA 3C0RA 3W31A 1GCBA 2Z84A 4CDDB 4MI7A 3P5VA 3KFQA 2VHFA 2XU1A 1JQPA 3O0UA 4DMYA 3WXGA 4QRXA 3K8UA 5E6JA 1NQCA 2AS8A 3PW3A 2FQ9A 4X6HA 3P5WA 4QH6A 4D8BA 3IOQA 4I05A 1AYVA 1PBHA 1NL6A 2FTDA 2XU4A 4WA6A 2Y6EA 1QMYA 1BQIA 2NQIA 3E1ZB 1VSNA 2O6XA 1CQDA 3BCNA 4X6IA 4ZTBA 5EZQA 2FRQA 1BP4A 4QRGA 1F2BA 1ATKA 4Q8HA 1CB5A 2ATOA 2VHSA 2WBFX 1QOLA 3W30A 2H7JA 1MDWA 1EWOA 3O65A 2BDZA 2P86A 4I04A 2DC6A 3KX1A 3MORA 4BOPA 4XUIA 1KFXL 4YYVA 1AU4A 1O0EA 3PDFA 7PCKA 4KLBA 3IHPA 4YYQA 1PPOA 2GHUA 3N4CA 3P5UA 1KHPA 4BOZA 3PNRA 5CVNB 1MEMA 3HHAA 1MHWA 3KW9A 2HXZA 4PP2E 4WURA 2AGAA 2JQGR 6PADA 3CBJA 4RF0A 2BTWA 3RNVA 5KO3A 4D8IA 4HWYA 3D6SA 2OULA 1IWDA 1THEA 1AU3A 2CB5A 4PADA 1U5IA 1HUCB 2DJGB 4FJCA 3S3RA 1PPDA 3KKUA 4BOSA 2F1GA 4FK5A 4K7CA 1F29A 1AYUA 1PXVA 4RNAA 2FUDA 5CVOB 1AECA 1BGOA 3U8EA 4YVAA 3B21A 2DCCA 3LFYA 5CVMA 1K3BB 1YVBA 2DOSA 3BC3A 3BBAA 1CPJA 5CHVA 4RKXA 1SP4B 1TL9A 4DMXA 4AXMA 1YK7A 4P16A 2BDLA 4OEMA 2UZJA 2DC9A 3GCBA 2G6DA 1EF7A 1ME4A 1CS8A 3P5XA 1NPZA 1AU2A 3TNXA 1F2AA 3OVXA 5JZEA 2YJ9A 4N4ZA 3KWBX 2YJCA 5PADA 2AU1A 3PSEA 3ZNHA 4AXLA 3K9MA 5JA7A 2FT2A 2P7UA 3OVZA 2E02A 3E9SA 3CH2X 4YYWA 4PI3A 1U9XA 3RVXA 1BY8A 1Y4HA 4OW0A 4OVZA 4CDCB 9PAPA 3N3KA 4ZUXU 1U9WA 1STFE 1Y08A 2R9MA 2CIOA 2F7DA 2G8JA 2R9OA 1GECE 5J94A 1ITOA 3V6CA 2J7QA 5EF4A 2BU3A 3CBKA 1YALA 2PREA 4R3DA 3CH3X 3NHEA 3IUTA 3V6EA 2G8EA 1XKGA 4CZWA 1ICFA 5CHTA 1UKFA 3KSEA 3I06A 2BTWB 2JTCA 2YJBA 4RF1A 2DCAA 5F02A 3N3GA 3KWZA 3OF8A 4OELA 1AIMA 1F2CA 3H8CA 1POPA 1PPPA 4IUMA 3QSDA 1TU6A 1PIPA 8PCHA 3MTNA 1MIRA 4HXDB 2R9NA 2DCDA 1ME3A 4MZOA 3K24A 4Q8GA 2ACTA 1NLJA 3F5VA 2B1NA 3S3QA 2JRIA 2E03A 4BS6A 1AU0A 3F75A 2ARYA
chains in the Genus database with same CATH topology
4BPVA 3IV2A 1EWPA 4MZSA 4P6GA 4PP1A 2OZ2A 3B79A 4BS5A 2DCBA 4FIPA 5K16A 1PPNA 2G7YA 4P6EA 5EGWA 2XU5A 1CV8A 2B1MA 2FO5A 4W5CA 3MHSA 3OISA 2PBHA 2AIMA 2YJ2A 1ZIVA 3H8BA 4N79A 1GMYA 1KHQA 5A24A 4BQVA 2OP3A 2DC7A 3BOWA 2XU3A 3USVA 1S4VA 3H89A 4YYUA 2NQDB 1YK8A 1SNKA 1TLOA 2PNSA 1M6DA 3HD3A 1MS6A 5JH3A 1DF0A 2R6NA 4BGFA 3QJ3A 4CDFB 4YYRA 3I3TA 4BSQA 1W4TA 1Q6KA 1NB3A 1PCIA 2GFOA 4RY2A 3OF9A 3LXSA 1EWLA 3IEJA 3DF0A 3M99A 1CTEA 1QXPA 1MEGA 1ZCMA 2R9CA 3HHIA 3H6SA 1KFUL 3RVWA 2FRAA 1QDQA 2P0RA 2R9FA 2IPPB 4G54A 2NQAA 1EWMA 1CJLA 4QBBA 1NB5A 3WXFA 1DEUA 3AI8A 2HD5A 3WXEA 2Y5BA 2AYNA 3QT4A 2HH5A 2IBIA 1X9YA 4X6JA 4YYSA 3RVVA 3H7DA 3BPMA 2DZYA 4B55A 3C9EA 2PADA 4NV7A 4N8WA 1U9QX 4QRVA 3PBHA 1CVZA 2YJ8A 1A6RA 1KXRA 2DJFB 3MHHA 2AVWA 3ERVA 1CSBB 2C0YA 4W5BA 2AUXA 3BPFA 2JQFR 4XR7A 5FPWA 4I07A 2DC8A 3BWKA 1PADA 3HWNA 2FYEA 1VJVA 1YT7A 1U9VA 2BSZA 3IMAA 1PE6A 1AYWA 2E00A 2DZZA 4W4UA 4YV8A 3ZUAA 1FH0A 4MSXA 2HHNA 1GX3A 1GLOA 2AUZA 3O1GA 4CDEB 2E01A 2NQGA 2AYOA 1GCBA 4CDDB 3P5VA 3KFQA 2VHFA 2XU1A 1JQPA 3O0UA 4DMYA 3WXGA 4QRXA 3K8UA 1NQCA 2AS8A 3PW3A 2FQ9A 4X6HA 3P5WA 4QH6A 3IOQA 4I05A 1AYVA 1PBHA 1NL6A 2FTDA 1E2TA 2XU4A 4WA6A 2Y6EA 1QMYA 1BQIA 3LTWA 2NQIA 3E1ZB 1VSNA 2O6XA 1CQDA 3BCNA 4X6IA 2FRQA 1BP4A 4QRGA 1F2BA 1ATKA 4Q8HA 1CB5A 2ATOA 2VHSA 2WBFX 1QOLA 2H7JA 1MDWA 1EWOA 2BDZA 2P86A 4I04A 2DC6A 3KX1A 3MORA 4XUIA 1KFXL 4YYVA 1AU4A 1W5RA 1O0EA 1W6FA 3PDFA 7PCKA 4KLBA 3IHPA 4YYQA 1PPOA 2GHUA 3N4CA 3P5UA 1KHPA 3PNRA 5CVNB 1MEMA 3HHAA 1MHWA 3KW9A 2HXZA 4PP2E 4NV8A 2JQGR 6PADA 3CBJA 4HWYA 3D6SA 2OULA 1IWDA 1THEA 1AU3A 2CB5A 4PADA 1U5IA 1HUCB 2DJGB 4FJCA 3S3RA 1PPDA 3KKUA 2F1GA 4FK5A 4K7CA 1F29A 1AYUA 1PXVA 2FUDA 5CVOB 1AECA 1BGOA 3U8EA 4YVAA 2DCCA 3LFYA 5CVMA 1K3BB 1YVBA 2VFBA 3BC3A 1CPJA 5CHVA 1SP4B 1TL9A 4DMXA 4AXMA 1YK7A 2BDLA 4OEMA 2DC9A 3GCBA 2G6DA 1EF7A 1ME4A 1CS8A 3P5XA 1NPZA 1AU2A 3TNXA 1F2AA 3OVXA 4C5PA 2YJ9A 4N4ZA 3KWBX 2YJCA 5PADA 2AU1A 4AXLA 3K9MA 5JA7A 2FT2A 2P7UA 3OVZA 2E02A 3CH2X 4YYWA 4PI3A 1U9XA 3RVXA 1BY8A 1Y4HA 4CDCB 9PAPA 3N3KA 4ZUXU 4GUZA 1U9WA 1STFE 1Y08A 2R9MA 2CIOA 2F7DA 2G8JA 2R9OA 1GECE 5J94A 1ITOA 3V6CA 5EF4A 3CBKA 1YALA 2PREA 3CH3X 3NHEA 3IUTA 3V6EA 2G8EA 1XKGA 4CZWA 1ICFA 5CHTA 3KSEA 3I06A 2YJBA 2DCAA 5F02A 3N3GA 3KWZA 3OF8A 4OELA 1AIMA 1F2CA 3H8CA 1POPA 1PPPA 3QSDA 1TU6A 1PIPA 8PCHA 3MTNA 1MIRA 2R9NA 2DCDA 1ME3A 4MZOA 3K24A 2VFCA 4Q8GA 2ACTA 1NLJA 3D9WA 3F5VA 2B1NA 3S3QA 2E03A 4BS6A 1AU0A 3F75A 2ARYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPV A;  3IV2 A;  1EWP A;  4MZS A;  4P6G A;  4PP1 A;  2OZ2 A;  3B79 A;  4BS5 A;  2DCB A;  4FIP A;  5K16 A;  1PPN A;  2G7Y A;  4P6E A;  5EGW A;  2XU5 A;  1CV8 A;  2B1M A;  2FO5 A;  4W5C A;  3MHS A;  3OIS A;  2PBH A;  2AIM A;  2YJ2 A;  1ZIV A;  3H8B A;  4N79 A;  1GMY A;  1KHQ A;  5A24 A;  4BQV A;  2OP3 A;  2DC7 A;  3BOW A;  2XU3 A;  3USV A;  1S4V A;  3H89 A;  4YYU A;  2NQD B;  1YK8 A;  1SNK A;  1TLO A;  2PNS A;  1M6D A;  3HD3 A;  1MS6 A;  5JH3 A;  1DF0 A;  2R6N A;  3QJ3 A;  4CDF B;  4YYR A;  3I3T A;  4BSQ A;  1Q6K A;  1NB3 A;  1PCI A;  2GFO A;  4RY2 A;  3OF9 A;  3LXS A;  1EWL A;  3IEJ A;  3DF0 A;  3M99 A;  1CTE A;  1QXP A;  1MEG A;  1ZCM A;  2R9C A;  3HHI A;  3H6S A;  1KFU L;  3RVW A;  2FRA A;  1QDQ A;  2P0R A;  2R9F A;  2IPP B;  4G54 A;  2NQA A;  1EWM A;  1CJL A;  4QBB A;  1NB5 A;  3WXF A;  1DEU A;  3AI8 A;  2HD5 A;  3WXE A;  2Y5B A;  2AYN A;  3QT4 A;  2HH5 A;  2IBI A;  1X9Y A;  4X6J A;  4YYS A;  3RVV A;  3H7D A;  3BPM A;  2DZY A;  3C9E A;  2PAD A;  4N8W A;  1U9Q X;  4QRV A;  3PBH A;  1CVZ A;  2YJ8 A;  1A6R A;  1KXR A;  2DJF B;  3MHH A;  2AVW A;  3ERV A;  1CSB B;  2C0Y A;  4W5B A;  2AUX A;  3BPF A;  2JQF R;  4XR7 A;  5FPW A;  4I07 A;  2DC8 A;  3BWK A;  1PAD A;  3HWN A;  2FYE A;  1VJV A;  1YT7 A;  1U9V A;  3IMA A;  1PE6 A;  1AYW A;  2E00 A;  2DZZ A;  4W4U A;  4YV8 A;  3ZUA A;  1FH0 A;  4MSX A;  2HHN A;  1GLO A;  2AUZ A;  3O1G A;  4CDE B;  2E01 A;  2NQG A;  2AYO A;  1GCB A;  4CDD B;  3P5V A;  3KFQ A;  2VHF A;  2XU1 A;  1JQP A;  3O0U A;  4DMY A;  3WXG A;  4QRX A;  3K8U A;  1NQC A;  2AS8 A;  3PW3 A;  2FQ9 A;  4X6H A;  3P5W A;  4QH6 A;  3IOQ A;  4I05 A;  1AYV A;  1PBH A;  1NL6 A;  2FTD A;  2XU4 A;  4WA6 A;  2Y6E A;  1QMY A;  1BQI A;  2NQI A;  3E1Z B;  1VSN A;  2O6X A;  1CQD A;  3BCN A;  4X6I A;  2FRQ A;  1BP4 A;  4QRG A;  1F2B A;  1ATK A;  4Q8H A;  1CB5 A;  2ATO A;  2VHS A;  2WBF X;  1QOL A;  2H7J A;  1MDW A;  1EWO A;  2BDZ A;  2P86 A;  4I04 A;  2DC6 A;  3KX1 A;  3MOR A;  4XUI A;  1KFX L;  4YYV A;  1AU4 A;  1O0E A;  3PDF A;  7PCK A;  4KLB A;  3IHP A;  4YYQ A;  1PPO A;  2GHU A;  3N4C A;  3P5U A;  1KHP A;  3PNR A;  5CVN B;  1MEM A;  3HHA A;  1MHW A;  3KW9 A;  2HXZ A;  4PP2 E;  2JQG R;  6PAD A;  3CBJ A;  4HWY A;  3D6S A;  2OUL A;  1IWD A;  1THE A;  1AU3 A;  2CB5 A;  4PAD A;  1U5I A;  1HUC B;  2DJG B;  4FJC A;  3S3R A;  1PPD A;  3KKU A;  2F1G A;  4FK5 A;  4K7C A;  1F29 A;  1AYU A;  1PXV A;  2FUD A;  5CVO B;  1AEC A;  1BGO A;  3U8E A;  4YVA A;  2DCC A;  3LFY A;  5CVM A;  1K3B B;  1YVB A;  3BC3 A;  1CPJ A;  5CHV A;  1SP4 B;  1TL9 A;  4DMX A;  4AXM A;  1YK7 A;  2BDL A;  4OEM A;  2DC9 A;  3GCB A;  2G6D A;  1EF7 A;  1ME4 A;  1CS8 A;  3P5X A;  1NPZ A;  1AU2 A;  3TNX A;  1F2A A;  3OVX A;  2YJ9 A;  4N4Z A;  3KWB X;  2YJC A;  5PAD A;  2AU1 A;  4AXL A;  3K9M A;  5JA7 A;  2FT2 A;  2P7U A;  3OVZ A;  2E02 A;  3CH2 X;  4YYW A;  4PI3 A;  1U9X A;  3RVX A;  1BY8 A;  1Y4H A;  4CDC B;  9PAP A;  3N3K A;  4ZUX U;  1U9W A;  1STF E;  1Y08 A;  2R9M A;  2CIO A;  2F7D A;  2G8J A;  2R9O A;  1GEC E;  5J94 A;  1ITO A;  3V6C A;  5EF4 A;  3CBK A;  1YAL A;  2PRE A;  3CH3 X;  3NHE A;  3IUT A;  3V6E A;  2G8E A;  1XKG A;  4CZW A;  1ICF A;  5CHT A;  3KSE A;  3I06 A;  2YJB A;  2DCA A;  5F02 A;  3N3G A;  3KWZ A;  3OF8 A;  4OEL A;  1AIM A;  1F2C A;  3H8C A;  1POP A;  1PPP A;  3QSD A;  1TU6 A;  1PIP A;  8PCH A;  3MTN A;  1MIR A;  2R9N A;  2DCD A;  1ME3 A;  4MZO A;  3K24 A;  4Q8G A;  2ACT A;  1NLJ A;  3F5V A;  2B1N A;  3S3Q A;  2E03 A;  4BS6 A;  1AU0 A;  3F75 A;  2ARY A; 
#chains in the Genus database with same CATH topology
 4BPV A;  3IV2 A;  1EWP A;  4MZS A;  4P6G A;  4PP1 A;  2OZ2 A;  3B79 A;  4BS5 A;  2DCB A;  4FIP A;  5K16 A;  3BY4 A;  1PPN A;  4BOU A;  2G7Y A;  4P6E A;  5EGW A;  2XU5 A;  1CV8 A;  2B1M A;  4A5U A;  2FO5 A;  4W5C A;  3MHS A;  3MJ5 A;  3OIS A;  2PBH A;  2AIM A;  2YJ2 A;  1ZIV A;  3H8B A;  4N79 A;  1GMY A;  1KHQ A;  2FE8 A;  5A24 A;  4BQV A;  2OP3 A;  2DC7 A;  3BOW A;  2XU3 A;  3USV A;  1S4V A;  3H89 A;  4YYU A;  2NQD B;  1YK8 A;  3PHX A;  1SNK A;  3PRM A;  1TLO A;  2PNS A;  3PHU A;  1M6D A;  3HD3 A;  3TRK A;  1MS6 A;  5JH3 A;  1DF0 A;  2R6N A;  3TMP A;  3QJ3 A;  4CDF B;  4M0W A;  4YYR A;  3I3T A;  4BSQ A;  4OVZ B;  1Q6K A;  1NB3 A;  1PCI A;  2GFO A;  4RY2 A;  3OF9 A;  3LXS A;  1EWL A;  3IEJ A;  3DF0 A;  3M99 A;  3PT2 A;  1CTE A;  1QXP A;  1MEG A;  4MM3 B;  1ZCM A;  2R9C A;  3HHI A;  3H6S A;  1KFU L;  3RVW A;  2FRA A;  1QDQ A;  2P0R A;  3BB7 A;  2R9F A;  4GUA A;  2IPP B;  4G54 A;  2NQA A;  1EWM A;  1CJL A;  4BOQ A;  4QBB A;  1NB5 A;  1DKI A;  3WXF A;  1DEU A;  3AI8 A;  2HD5 A;  3WXE A;  2Y5B A;  2AYN A;  4REZ A;  3QT4 A;  3PRP A;  2HH5 A;  2IBI A;  3MTV A;  1X9Y A;  4X6J A;  1PVJ A;  1YZB A;  4YYS A;  3RVV A;  3H7D A;  3BPM A;  2DZY A;  4PT5 A;  3C9E A;  2PAD A;  2J7Q C;  3PHW A;  4N8W A;  1U9Q X;  4QRV A;  3PBH A;  3OQC A;  1CVZ A;  3IFU A;  4IP3 A;  2YJ8 A;  1A6R A;  1KXR A;  2DJF B;  3MP2 A;  3MHH A;  2AVW A;  3ERV A;  1CSB B;  2C0Y A;  4W5B A;  5EZS A;  2AUX A;  3BPF A;  2JQF R;  4XR7 A;  5FPW A;  4I07 A;  2DC8 A;  3BWK A;  1PAD A;  3HWN A;  2FYE A;  1VJV A;  2HWK A;  1YT7 A;  1U9V A;  3IMA A;  1PE6 A;  1AYW A;  2E00 A;  4XZX A;  2DZZ A;  4W4U A;  4YV8 A;  3ZUA A;  1FH0 A;  4MSX A;  2HHN A;  4D8E A;  1GLO A;  2AUZ A;  3O1G A;  4CDE B;  2E01 A;  2NQG A;  2AYO A;  3C0R A;  3W31 A;  1GCB A;  2Z84 A;  4CDD B;  4MI7 A;  3P5V A;  3KFQ A;  2VHF A;  2XU1 A;  1JQP A;  3O0U A;  4DMY A;  3WXG A;  4QRX A;  3K8U A;  5E6J A;  1NQC A;  2AS8 A;  3PW3 A;  2FQ9 A;  4X6H A;  3P5W A;  4QH6 A;  4D8B A;  3IOQ A;  4I05 A;  1AYV A;  1PBH A;  1NL6 A;  2FTD A;  2XU4 A;  4WA6 A;  2Y6E A;  1QMY A;  1BQI A;  2NQI A;  3E1Z B;  1VSN A;  2O6X A;  1CQD A;  3BCN A;  4X6I A;  4ZTB A;  5EZQ A;  2FRQ A;  1BP4 A;  4QRG A;  1F2B A;  1ATK A;  4Q8H A;  1CB5 A;  2ATO A;  2VHS A;  2WBF X;  1QOL A;  3W30 A;  2H7J A;  1MDW A;  1EWO A;  3O65 A;  2BDZ A;  2P86 A;  4I04 A;  2DC6 A;  3KX1 A;  3MOR A;  4BOP A;  4XUI A;  1KFX L;  4YYV A;  1AU4 A;  1O0E A;  3PDF A;  7PCK A;  4KLB A;  3IHP A;  4YYQ A;  1PPO A;  2GHU A;  3N4C A;  3P5U A;  1KHP A;  4BOZ A;  3PNR A;  5CVN B;  1MEM A;  3HHA A;  1MHW A;  3KW9 A;  2HXZ A;  4PP2 E;  4WUR A;  2AGA A;  2JQG R;  6PAD A;  3CBJ A;  4RF0 A;  2BTW A;  3RNV A;  5KO3 A;  4D8I A;  4HWY A;  3D6S A;  2OUL A;  1IWD A;  1THE A;  1AU3 A;  2CB5 A;  4PAD A;  1U5I A;  1HUC B;  2DJG B;  4FJC A;  3S3R A;  1PPD A;  3KKU A;  4BOS A;  2F1G A;  4FK5 A;  4K7C A;  1F29 A;  1AYU A;  1PXV A;  4RNA A;  2FUD A;  5CVO B;  1AEC A;  1BGO A;  3U8E A;  4YVA A;  3B21 A;  2DCC A;  3LFY A;  5CVM A;  1K3B B;  1YVB A;  2DOS A;  3BC3 A;  3BBA A;  1CPJ A;  5CHV A;  4RKX A;  1SP4 B;  1TL9 A;  4DMX A;  4AXM A;  1YK7 A;  4P16 A;  2BDL A;  4OEM A;  2UZJ A;  2DC9 A;  3GCB A;  2G6D A;  1EF7 A;  1ME4 A;  1CS8 A;  3P5X A;  1NPZ A;  1AU2 A;  3TNX A;  1F2A A;  3OVX A;  5JZE A;  2YJ9 A;  4N4Z A;  3KWB X;  2YJC A;  5PAD A;  2AU1 A;  3PSE A;  3ZNH A;  4AXL A;  3K9M A;  5JA7 A;  2FT2 A;  2P7U A;  3OVZ A;  2E02 A;  3E9S A;  3CH2 X;  4YYW A;  4PI3 A;  1U9X A;  3RVX A;  1BY8 A;  1Y4H A;  4OW0 A;  4OVZ A;  4CDC B;  9PAP A;  3N3K A;  4ZUX U;  1U9W A;  1STF E;  1Y08 A;  2R9M A;  2CIO A;  2F7D A;  2G8J A;  2R9O A;  1GEC E;  5J94 A;  1ITO A;  3V6C A;  2J7Q A;  5EF4 A;  2BU3 A;  3CBK A;  1YAL A;  2PRE A;  4R3D A;  3CH3 X;  3NHE A;  3IUT A;  3V6E A;  2G8E A;  1XKG A;  4CZW A;  1ICF A;  5CHT A;  1UKF A;  3KSE A;  3I06 A;  2BTW B;  2JTC A;  2YJB A;  4RF1 A;  2DCA A;  5F02 A;  3N3G A;  3KWZ A;  3OF8 A;  4OEL A;  1AIM A;  1F2C A;  3H8C A;  1POP A;  1PPP A;  4IUM A;  3QSD A;  1TU6 A;  1PIP A;  8PCH A;  3MTN A;  1MIR A;  4HXD B;  2R9N A;  2DCD A;  1ME3 A;  4MZO A;  3K24 A;  4Q8G A;  2ACT A;  1NLJ A;  3F5V A;  2B1N A;  3S3Q A;  2JRI A;  2E03 A;  4BS6 A;  1AU0 A;  3F75 A;  2ARY A; 
#chains in the Genus database with same CATH homology
 4BPV A;  3IV2 A;  1EWP A;  4MZS A;  4P6G A;  4PP1 A;  2OZ2 A;  3B79 A;  4BS5 A;  2DCB A;  4FIP A;  5K16 A;  1PPN A;  2G7Y A;  4P6E A;  5EGW A;  2XU5 A;  1CV8 A;  2B1M A;  2FO5 A;  4W5C A;  3MHS A;  3OIS A;  2PBH A;  2AIM A;  2YJ2 A;  1ZIV A;  3H8B A;  4N79 A;  1GMY A;  1KHQ A;  5A24 A;  4BQV A;  2OP3 A;  2DC7 A;  3BOW A;  2XU3 A;  3USV A;  1S4V A;  3H89 A;  4YYU A;  2NQD B;  1YK8 A;  1SNK A;  1TLO A;  2PNS A;  1M6D A;  3HD3 A;  1MS6 A;  5JH3 A;  1DF0 A;  2R6N A;  4BGF A;  3QJ3 A;  4CDF B;  4YYR A;  3I3T A;  4BSQ A;  1W4T A;  1Q6K A;  1NB3 A;  1PCI A;  2GFO A;  4RY2 A;  3OF9 A;  3LXS A;  1EWL A;  3IEJ A;  3DF0 A;  3M99 A;  1CTE A;  1QXP A;  1MEG A;  1ZCM A;  2R9C A;  3HHI A;  3H6S A;  1KFU L;  3RVW A;  2FRA A;  1QDQ A;  2P0R A;  2R9F A;  2IPP B;  4G54 A;  2NQA A;  1EWM A;  1CJL A;  4QBB A;  1NB5 A;  3WXF A;  1DEU A;  3AI8 A;  2HD5 A;  3WXE A;  2Y5B A;  2AYN A;  3QT4 A;  2HH5 A;  2IBI A;  1X9Y A;  4X6J A;  4YYS A;  3RVV A;  3H7D A;  3BPM A;  2DZY A;  4B55 A;  3C9E A;  2PAD A;  4NV7 A;  4N8W A;  1U9Q X;  4QRV A;  3PBH A;  1CVZ A;  2YJ8 A;  1A6R A;  1KXR A;  2DJF B;  3MHH A;  2AVW A;  3ERV A;  1CSB B;  2C0Y A;  4W5B A;  2AUX A;  3BPF A;  2JQF R;  4XR7 A;  5FPW A;  4I07 A;  2DC8 A;  3BWK A;  1PAD A;  3HWN A;  2FYE A;  1VJV A;  1YT7 A;  1U9V A;  2BSZ A;  3IMA A;  1PE6 A;  1AYW A;  2E00 A;  2DZZ A;  4W4U A;  4YV8 A;  3ZUA A;  1FH0 A;  4MSX A;  2HHN A;  1GX3 A;  1GLO A;  2AUZ A;  3O1G A;  4CDE B;  2E01 A;  2NQG A;  2AYO A;  1GCB A;  4CDD B;  3P5V A;  3KFQ A;  2VHF A;  2XU1 A;  1JQP A;  3O0U A;  4DMY A;  3WXG A;  4QRX A;  3K8U A;  1NQC A;  2AS8 A;  3PW3 A;  2FQ9 A;  4X6H A;  3P5W A;  4QH6 A;  3IOQ A;  4I05 A;  1AYV A;  1PBH A;  1NL6 A;  2FTD A;  1E2T A;  2XU4 A;  4WA6 A;  2Y6E A;  1QMY A;  1BQI A;  3LTW A;  2NQI A;  3E1Z B;  1VSN A;  2O6X A;  1CQD A;  3BCN A;  4X6I A;  2FRQ A;  1BP4 A;  4QRG A;  1F2B A;  1ATK A;  4Q8H A;  1CB5 A;  2ATO A;  2VHS A;  2WBF X;  1QOL A;  2H7J A;  1MDW A;  1EWO A;  2BDZ A;  2P86 A;  4I04 A;  2DC6 A;  3KX1 A;  3MOR A;  4XUI A;  1KFX L;  4YYV A;  1AU4 A;  1W5R A;  1O0E A;  1W6F A;  3PDF A;  7PCK A;  4KLB A;  3IHP A;  4YYQ A;  1PPO A;  2GHU A;  3N4C A;  3P5U A;  1KHP A;  3PNR A;  5CVN B;  1MEM A;  3HHA A;  1MHW A;  3KW9 A;  2HXZ A;  4PP2 E;  4NV8 A;  2JQG R;  6PAD A;  3CBJ A;  4HWY A;  3D6S A;  2OUL A;  1IWD A;  1THE A;  1AU3 A;  2CB5 A;  4PAD A;  1U5I A;  1HUC B;  2DJG B;  4FJC A;  3S3R A;  1PPD A;  3KKU A;  2F1G A;  4FK5 A;  4K7C A;  1F29 A;  1AYU A;  1PXV A;  2FUD A;  5CVO B;  1AEC A;  1BGO A;  3U8E A;  4YVA A;  2DCC A;  3LFY A;  5CVM A;  1K3B B;  1YVB A;  2VFB A;  3BC3 A;  1CPJ A;  5CHV A;  1SP4 B;  1TL9 A;  4DMX A;  4AXM A;  1YK7 A;  2BDL A;  4OEM A;  2DC9 A;  3GCB A;  2G6D A;  1EF7 A;  1ME4 A;  1CS8 A;  3P5X A;  1NPZ A;  1AU2 A;  3TNX A;  1F2A A;  3OVX A;  4C5P A;  2YJ9 A;  4N4Z A;  3KWB X;  2YJC A;  5PAD A;  2AU1 A;  4AXL A;  3K9M A;  5JA7 A;  2FT2 A;  2P7U A;  3OVZ A;  2E02 A;  3CH2 X;  4YYW A;  4PI3 A;  1U9X A;  3RVX A;  1BY8 A;  1Y4H A;  4CDC B;  9PAP A;  3N3K A;  4ZUX U;  4GUZ A;  1U9W A;  1STF E;  1Y08 A;  2R9M A;  2CIO A;  2F7D A;  2G8J A;  2R9O A;  1GEC E;  5J94 A;  1ITO A;  3V6C A;  5EF4 A;  3CBK A;  1YAL A;  2PRE A;  3CH3 X;  3NHE A;  3IUT A;  3V6E A;  2G8E A;  1XKG A;  4CZW A;  1ICF A;  5CHT A;  3KSE A;  3I06 A;  2YJB A;  2DCA A;  5F02 A;  3N3G A;  3KWZ A;  3OF8 A;  4OEL A;  1AIM A;  1F2C A;  3H8C A;  1POP A;  1PPP A;  3QSD A;  1TU6 A;  1PIP A;  8PCH A;  3MTN A;  1MIR A;  2R9N A;  2DCD A;  1ME3 A;  4MZO A;  3K24 A;  2VFC A;  4Q8G A;  2ACT A;  1NLJ A;  3D9W A;  3F5V A;  2B1N A;  3S3Q A;  2E03 A;  4BS6 A;  1AU0 A;  3F75 A;  2ARY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...