4MZOA

Mouse cathepsin s with covalent ligand (3s,4s)-n-[(2e)-2-iminoethyl]-4-(morpholin-4-ylcarbonyl)-1-(phenylsulfonyl)pyrrolidine-3-carboxamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
b'LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Identification of potent and selective cathepsin S inhibitors containing different central cyclic scaffolds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4mzoA00
4YYUA 2DC9A 4K7CA 4G54A 4YYVA 1BY8A 2FYEA 2R9CA 3GCBA 1S4VA 3QT4A 1DEUA 1Y4HA 2AVWA 2R9OA 2YJ8A 2G6DA 1F2BA 5JH3A 3KKUA 3HHIA 1BP4A 2HH5A 4BS5A 1PIPA 3ERVA 4QBBA 1PCIA 1PPOA 1YK8A 3S3RA 2FRQA 2AYOA 1MHWA 1KXRA 1GECE 2R9FA 3K24A 2AU1A 2DZYA 3KFQA 3USVA 3WXGA 2PBHA 1NLJA 2JQGR 3M99A 2NQDB 1F2CA 1ME3A 2YJ2A 3PW3A 1M6DA 4W4UA 1ZIVA 1EWOA 2FQ9A 1X9YA 3KWBX 3P5UA 1YK7A 1TU6A 3BC3A 3RVXA 1CTEA 4XUIA 3PDFA 4P6EA 1VSNA 1U9WA 1AU3A 3HHAA 3LFYA 1PPPA 2FRAA 1STFE 3KW9A 3IOQA 2DCCA 3OVZA 4QRGA 1ITOA 2AUZA 3PNRA 5CHVA 3I06A 4WA6A 4W5CA 4CZWA 2E03A 2OULA 1U5IA 4CDCB 3CH3X 5EF4A 1AYUA 3CBKA 2DCAA 2DC7A 3N4CA 3V6EA 4YVAA 3BWKA 1U9VA 3O1GA 6PADA 3K9MA 1TL9A 4BS6A 3IUTA 3D6SA 3H7DA 1PE6A 4PP1A 2XU3A 2XU5A 3F75A 3OF8A 2E01A 2G8JA 2YJCA 1CVZA 1MS6A 2BDZA 4Q8GA 4P6GA 2IPPB 3AI8A 2AYNA 4CDFB 1BGOA 1EWPA 1CSBB 5EGWA 5F02A 2DZZA 3B79A 3HD3A 3QJ3A 5CHTA 2NQGA 1AYVA 4PI3A 3F5VA 1EWLA 4BPVA 5CVNB 1IWDA 4X6JA 2R9MA 4PADA 3KSEA 4XR7A 2NQAA 2FO5A 1QXPA 1KFXL 1THEA 2E02A 5CVMA 1QMYA 4KLBA 2P0RA 3C9EA 1CQDA 2DC6A 2IBIA 4MZOA 3LXSA 1NQCA 4YYSA 3N3KA 2BDLA 4FK5A 2YJBA 1JQPA 3CBJA 3OF9A 1AU4A 4W5BA 8PCHA 5JA7A 3WXEA 4I05A 1SNKA 4N8WA 5CVOB 1A6RA 3WXFA 1AU0A 3BPFA 3CH2X 3OISA 1ZCMA 5K16A 2R6NA 2CIOA 2FT2A 2R9NA 1POPA 3RVVA 1TLOA 1U9XA 2AS8A 2CB5A 1KHPA 3DF0A 2ATOA 4PP2E 3MORA 2VHSA 3E1ZB 1MDWA 3H8BA 4N79A 1PPDA 4YV8A 1U9QX 2Y5BA 1MEGA 2HD5A 2H7JA 2DCDA 1KHQA 1NL6A 3IEJA 2B1NA 5J94A 2ARYA 3P5WA 2OZ2A 3KX1A 3P5VA 3MHHA 1CB5A 1PXVA 1KFUL 1YT7A 1F29A 1AIMA 3BPMA 2F7DA 2XU1A 3O0UA 1Q6KA 2YJ9A 4X6HA 1K3BB 4QH6A 3H8CA 3H6SA 1SP4B 2NQIA 4HWYA 4BSQA 1QOLA 1AU2A 1PBHA 2P86A 2PADA 4N4ZA 7PCKA 3I3TA 2DC8A 4RY2A 2AUXA 3U8EA 1DF0A 9PAPA 1EF7A 2O6XA 2GHUA 3IHPA 5PADA 1MEMA 3NHEA 4MSXA 1NB3A 1GMYA 1VJVA 1O0EA 1EWMA 2AIMA 2P7UA 3BOWA 4YYQA 1Y08A 3PBHA 4OEMA 3OVXA 3H89A 3ZUAA 1NPZA 2VHFA 3RVWA 4QRXA 4DMYA 1AYWA 1F2AA 3HWNA 3MHSA 1CPJA 1YALA 4DMXA 4BQVA 3QSDA 2WBFX 4AXLA 2HXZA 1CV8A 4FJCA 1CJLA 2DCBA 4OELA 2G8EA 3TNXA 2ACTA 1CS8A 4I04A 2Y6EA 2GFOA 1PADA 1AECA 3KWZA 2G7YA 1ME4A 5FPWA 2JQFR 2FUDA 2C0YA 4MZSA 1XKGA 1YVBA 3BCNA 1GCBA 4CDDB 3V6CA 4X6IA 2PNSA 1GLOA 4CDEB 4YYWA 1BQIA 1ATKA 2E00A 4I07A 3N3GA 1ICFA 4FIPA 2XU4A 2HHNA 3IMAA 4Q8HA 4AXMA 3IV2A 1HUCB 1MIRA 3S3QA 2B1MA 4ZUXU 1NB5A 3MTNA 2DJGB 2FTDA 1PPNA 5A24A 3K8UA 1FH0A 1QDQA 2F1GA 4QRVA 2OP3A 4YYRA 2PREA 3P5XA 2DJFB
chains in the Genus database with same CATH superfamily
4YYUA 2DC9A 4K7CA 4G54A 4YYVA 1BY8A 4OVZB 2FYEA 2R9CA 3GCBA 1S4VA 3QT4A 2FE8A 1DEUA 1Y4HA 2AVWA 2R9OA 2YJ8A 2G6DA 1F2BA 5JH3A 3KKUA 2J7QC 3HHIA 1BP4A 2HH5A 2Z84A 3TMPA 4D8BA 4BS5A 1PIPA 3ERVA 4QBBA 1PCIA 1PPOA 4D8EA 1YK8A 3S3RA 2FRQA 2AYOA 4IP3A 1MHWA 1KXRA 1GECE 2R9FA 3K24A 2AU1A 2DZYA 3KFQA 4RNAA 3USVA 3WXGA 4BOUA 2PBHA 1NLJA 2JQGR 3M99A 2NQDB 1F2CA 1ME3A 2YJ2A 4MI7A 3PW3A 4PT5A 1M6DA 4W4UA 1ZIVA 1EWOA 2FQ9A 1X9YA 3KWBX 3P5UA 1YK7A 1TU6A 3BC3A 3RVXA 1CTEA 4XUIA 3PDFA 4BOQA 4P6EA 1VSNA 1U9WA 1AU3A 2BTWB 3MJ5A 3HHAA 3LFYA 4D8IA 1PPPA 2FRAA 1STFE 3KW9A 3IOQA 4ZTBA 1DKIA 3PHXA 3O65A 2DCCA 3OVZA 4QRGA 4BOSA 2UZJA 1ITOA 2AUZA 3PNRA 5CHVA 3I06A 4WA6A 4W5CA 4CZWA 2E03A 2OULA 1U5IA 4CDCB 3CH3X 5EF4A 1AYUA 3CBKA 4RF1A 2DCAA 2DC7A 4P16A 3N4CA 3W30A 3V6EA 4YVAA 3BWKA 1U9VA 3MP2A 3O1GA 6PADA 3K9MA 1TL9A 4BS6A 3IUTA 3D6SA 3H7DA 1PE6A 4PP1A 2XU3A 2XU5A 3F75A 3OF8A 2E01A 2G8JA 2YJCA 4BOPA 1CVZA 1MS6A 2BDZA 4OW0A 4A5UA 4Q8GA 4P6GA 2IPPB 3AI8A 5EZSA 2AYNA 4CDFB 4OVZA 1BGOA 1EWPA 1CSBB 5EGWA 5F02A 2DZZA 4M0WA 3B79A 3HD3A 3QJ3A 5CHTA 2NQGA 1AYVA 4PI3A 3F5VA 1EWLA 4BPVA 5CVNB 1IWDA 4X6JA 2R9MA 4PADA 3KSEA 4XR7A 2NQAA 2FO5A 1QXPA 1KFXL 1THEA 5JZEA 2E02A 5CVMA 1QMYA 4KLBA 2JTCA 2P0RA 3C9EA 1CQDA 2DC6A 2IBIA 3PHWA 4IUMA 4MZOA 3LXSA 2J7QA 3PSEA 1NQCA 3PT2A 4YYSA 4XZXA 3N3KA 2BDLA 4FK5A 4WURA 3W31A 2YJBA 1JQPA 3CBJA 3OF9A 1AU4A 4W5BA 8PCHA 1PVJA 2HWKA 5JA7A 2DOSA 2BTWA 3WXEA 4I05A 1SNKA 4N8WA 5CVOB 1A6RA 3ZNHA 3WXFA 1AU0A 2AGAA 3BPFA 4R3DA 3CH2X 3OISA 1ZCMA 5K16A 3BBAA 2R6NA 2CIOA 2FT2A 2R9NA 1POPA 3RVVA 1TLOA 1U9XA 3RNVA 2AS8A 2CB5A 1KHPA 3DF0A 2BU3A 2ATOA 4PP2E 3MORA 2VHSA 3E1ZB 3B21A 5E6JA 1MDWA 3H8BA 4N79A 1PPDA 4YV8A 1U9QX 2Y5BA 1MEGA 2HD5A 2H7JA 2DCDA 1KHQA 1NL6A 3IEJA 2B1NA 5J94A 2ARYA 4RF0A 3P5WA 3OQCA 2OZ2A 3KX1A 3P5VA 3MHHA 1CB5A 1PXVA 1KFUL 1YT7A 1F29A 1YZBA 1AIMA 3BPMA 2F7DA 2XU1A 3O0UA 1Q6KA 2YJ9A 4X6HA 1K3BB 4QH6A 3H8CA 3H6SA 1SP4B 2NQIA 4HWYA 4BSQA 1QOLA 1AU2A 4GUAA 1PBHA 2P86A 2PADA 4N4ZA 7PCKA 3I3TA 2DC8A 4RY2A 2AUXA 3U8EA 1DF0A 9PAPA 1EF7A 2O6XA 2GHUA 3IHPA 5PADA 1MEMA 3E9SA 3NHEA 4MSXA 1NB3A 1GMYA 1VJVA 1O0EA 1EWMA 2AIMA 2P7UA 3BOWA 4YYQA 1Y08A 3PBHA 4OEMA 3OVXA 3H89A 3ZUAA 1NPZA 2VHFA 3RVWA 4QRXA 4DMYA 1AYWA 4HXDB 1F2AA 3HWNA 3MHSA 1CPJA 1YALA 4DMXA 4BQVA 3QSDA 5EZQA 2WBFX 4AXLA 2HXZA 1CV8A 3BB7A 4FJCA 1CJLA 2DCBA 3C0RA 4REZA 4OELA 2G8EA 3TNXA 2ACTA 1CS8A 4I04A 2Y6EA 2JRIA 2GFOA 1PADA 1AECA 3KWZA 2G7YA 1ME4A 4MM3B 5FPWA 2JQFR 2FUDA 2C0YA 4MZSA 1XKGA 1YVBA 3BCNA 1GCBA 4CDDB 4BOZA 3IFUA 3PHUA 3V6CA 4X6IA 1UKFA 2PNSA 1GLOA 4CDEB 4YYWA 1BQIA 1ATKA 2E00A 4I07A 3N3GA 4RKXA 5KO3A 1ICFA 4FIPA 2XU4A 2HHNA 3IMAA 4Q8HA 4AXMA 3IV2A 1HUCB 1MIRA 3S3QA 3TRKA 2B1MA 4ZUXU 3MTVA 3MTNA 2DJGB 1NB5A 2FTDA 1PPNA 5A24A 3BY4A 3K8UA 1FH0A 1QDQA 2F1GA 4QRVA 2OP3A 4YYRA 3PRPA 2PREA 3P5XA 2DJFB 3PRMA
chains in the Genus database with same CATH topology
4YYUA 2DC9A 4K7CA 4G54A 4YYVA 1BY8A 2FYEA 2R9CA 3GCBA 1E2TA 1S4VA 3QT4A 1DEUA 1Y4HA 2AVWA 2R9OA 2YJ8A 2G6DA 1F2BA 5JH3A 3KKUA 3HHIA 1BP4A 2HH5A 4BS5A 1PIPA 3ERVA 4QBBA 1PCIA 1PPOA 3D9WA 1YK8A 3S3RA 2FRQA 2AYOA 1MHWA 1KXRA 1GECE 2R9FA 3K24A 2AU1A 2DZYA 3KFQA 3USVA 3WXGA 2PBHA 1NLJA 2JQGR 3M99A 2NQDB 1F2CA 1ME3A 2YJ2A 3PW3A 1M6DA 4W4UA 1ZIVA 1EWOA 2FQ9A 1X9YA 3KWBX 3P5UA 1YK7A 1TU6A 3BC3A 4NV7A 1CTEA 3RVXA 4XUIA 3PDFA 4P6EA 1VSNA 1U9WA 1AU3A 3HHAA 3LFYA 1PPPA 2FRAA 1STFE 3KW9A 4NV8A 3IOQA 2DCCA 3OVZA 4QRGA 1ITOA 2AUZA 3PNRA 5CHVA 3I06A 4WA6A 4W5CA 4CZWA 2E03A 2OULA 1U5IA 4CDCB 3CH3X 5EF4A 1AYUA 3CBKA 2DCAA 2DC7A 3N4CA 3V6EA 4YVAA 3BWKA 1U9VA 3O1GA 6PADA 3K9MA 1TL9A 4BS6A 3IUTA 3D6SA 3H7DA 1PE6A 4PP1A 2XU3A 2XU5A 3F75A 3OF8A 2E01A 2G8JA 2YJCA 1CVZA 1MS6A 2BDZA 4Q8GA 4P6GA 2IPPB 3AI8A 2AYNA 4CDFB 4B55A 1BGOA 1EWPA 1CSBB 5EGWA 5F02A 2DZZA 3B79A 3HD3A 3QJ3A 5CHTA 2NQGA 1AYVA 4PI3A 3F5VA 1EWLA 4BPVA 5CVNB 1IWDA 4X6JA 2R9MA 4PADA 3KSEA 4XR7A 2NQAA 2FO5A 1QXPA 1KFXL 1THEA 2E02A 4GUZA 5CVMA 1QMYA 4KLBA 2P0RA 3C9EA 1CQDA 2DC6A 2IBIA 4MZOA 3LXSA 1NQCA 4YYSA 3N3KA 2BDLA 4FK5A 1W5RA 2YJBA 1JQPA 3CBJA 3OF9A 1AU4A 4W5BA 8PCHA 3LTWA 5JA7A 3WXEA 4I05A 1SNKA 4N8WA 5CVOB 1A6RA 3WXFA 1AU0A 3BPFA 3CH2X 3OISA 1ZCMA 5K16A 2R6NA 2CIOA 2FT2A 2R9NA 1POPA 3RVVA 1TLOA 1U9XA 2AS8A 2CB5A 1KHPA 3DF0A 2ATOA 4PP2E 3MORA 2VHSA 3E1ZB 1MDWA 3H8BA 4N79A 1PPDA 4YV8A 1U9QX 2Y5BA 1MEGA 2HD5A 2VFCA 2H7JA 2DCDA 1KHQA 1NL6A 3IEJA 2B1NA 2BSZA 5J94A 2ARYA 3P5WA 2OZ2A 3KX1A 3P5VA 3MHHA 1CB5A 1PXVA 1KFUL 1YT7A 1F29A 1AIMA 3BPMA 2F7DA 2XU1A 3O0UA 4BGFA 1Q6KA 2YJ9A 4X6HA 1K3BB 4QH6A 3H8CA 3H6SA 1SP4B 2NQIA 4HWYA 4BSQA 1QOLA 1AU2A 1PBHA 2P86A 2PADA 4N4ZA 7PCKA 3I3TA 2DC8A 4RY2A 1W4TA 2AUXA 3U8EA 1DF0A 9PAPA 1EF7A 2O6XA 2GHUA 3IHPA 5PADA 1MEMA 3NHEA 4MSXA 1NB3A 1GMYA 1VJVA 1O0EA 1EWMA 2AIMA 2P7UA 3BOWA 4YYQA 1Y08A 3PBHA 4OEMA 3OVXA 3H89A 3ZUAA 1NPZA 2VHFA 3RVWA 4QRXA 4DMYA 1AYWA 1F2AA 3HWNA 3MHSA 1CPJA 1YALA 4DMXA 4BQVA 3QSDA 2WBFX 4AXLA 2HXZA 1CV8A 4FJCA 1CJLA 2DCBA 4OELA 2VFBA 2G8EA 3TNXA 2ACTA 1CS8A 4I04A 2Y6EA 2GFOA 1PADA 1AECA 3KWZA 2G7YA 1ME4A 5FPWA 2JQFR 2FUDA 2C0YA 4MZSA 1XKGA 1YVBA 3BCNA 1GCBA 4CDDB 1W6FA 3V6CA 4X6IA 2PNSA 1GLOA 4CDEB 4YYWA 4C5PA 1BQIA 1ATKA 2E00A 4I07A 3N3GA 1ICFA 4FIPA 2XU4A 2HHNA 1GX3A 3IMAA 4Q8HA 4AXMA 3IV2A 1HUCB 1MIRA 3S3QA 2B1MA 4ZUXU 1NB5A 3MTNA 2DJGB 2FTDA 1PPNA 5A24A 3K8UA 1FH0A 1QDQA 2F1GA 4QRVA 2OP3A 4YYRA 2PREA 3P5XA 2DJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYU A;  2DC9 A;  4K7C A;  4G54 A;  4YYV A;  1BY8 A;  2FYE A;  2R9C A;  3GCB A;  1S4V A;  3QT4 A;  1DEU A;  1Y4H A;  2AVW A;  2R9O A;  2YJ8 A;  2G6D A;  1F2B A;  5JH3 A;  3KKU A;  3HHI A;  1BP4 A;  2HH5 A;  4BS5 A;  1PIP A;  3ERV A;  4QBB A;  1PCI A;  1PPO A;  1YK8 A;  3S3R A;  2FRQ A;  2AYO A;  1MHW A;  1KXR A;  1GEC E;  2R9F A;  3K24 A;  2AU1 A;  2DZY A;  3KFQ A;  3USV A;  3WXG A;  2PBH A;  1NLJ A;  2JQG R;  3M99 A;  2NQD B;  1F2C A;  1ME3 A;  2YJ2 A;  3PW3 A;  1M6D A;  4W4U A;  1ZIV A;  1EWO A;  2FQ9 A;  1X9Y A;  3KWB X;  3P5U A;  1YK7 A;  1TU6 A;  3BC3 A;  3RVX A;  1CTE A;  4XUI A;  3PDF A;  4P6E A;  1VSN A;  1U9W A;  1AU3 A;  3HHA A;  3LFY A;  1PPP A;  2FRA A;  1STF E;  3KW9 A;  3IOQ A;  2DCC A;  3OVZ A;  4QRG A;  1ITO A;  2AUZ A;  3PNR A;  5CHV A;  3I06 A;  4WA6 A;  4W5C A;  4CZW A;  2E03 A;  2OUL A;  1U5I A;  4CDC B;  3CH3 X;  5EF4 A;  1AYU A;  3CBK A;  2DCA A;  2DC7 A;  3N4C A;  3V6E A;  4YVA A;  3BWK A;  1U9V A;  3O1G A;  6PAD A;  3K9M A;  1TL9 A;  4BS6 A;  3IUT A;  3D6S A;  3H7D A;  1PE6 A;  4PP1 A;  2XU3 A;  2XU5 A;  3F75 A;  3OF8 A;  2E01 A;  2G8J A;  2YJC A;  1CVZ A;  1MS6 A;  2BDZ A;  4Q8G A;  4P6G A;  2IPP B;  3AI8 A;  2AYN A;  4CDF B;  1BGO A;  1EWP A;  1CSB B;  5EGW A;  5F02 A;  2DZZ A;  3B79 A;  3HD3 A;  3QJ3 A;  5CHT A;  2NQG A;  1AYV A;  4PI3 A;  3F5V A;  1EWL A;  4BPV A;  5CVN B;  1IWD A;  4X6J A;  2R9M A;  4PAD A;  3KSE A;  4XR7 A;  2NQA A;  2FO5 A;  1QXP A;  1KFX L;  1THE A;  2E02 A;  5CVM A;  1QMY A;  4KLB A;  2P0R A;  3C9E A;  1CQD A;  2DC6 A;  2IBI A;  4MZO A;  3LXS A;  1NQC A;  4YYS A;  3N3K A;  2BDL A;  4FK5 A;  2YJB A;  1JQP A;  3CBJ A;  3OF9 A;  1AU4 A;  4W5B A;  8PCH A;  5JA7 A;  3WXE A;  4I05 A;  1SNK A;  4N8W A;  5CVO B;  1A6R A;  3WXF A;  1AU0 A;  3BPF A;  3CH2 X;  3OIS A;  1ZCM A;  5K16 A;  2R6N A;  2CIO A;  2FT2 A;  2R9N A;  1POP A;  3RVV A;  1TLO A;  1U9X A;  2AS8 A;  2CB5 A;  1KHP A;  3DF0 A;  2ATO A;  4PP2 E;  3MOR A;  2VHS A;  3E1Z B;  1MDW A;  3H8B A;  4N79 A;  1PPD A;  4YV8 A;  1U9Q X;  2Y5B A;  1MEG A;  2HD5 A;  2H7J A;  2DCD A;  1KHQ A;  1NL6 A;  3IEJ A;  2B1N A;  5J94 A;  2ARY A;  3P5W A;  2OZ2 A;  3KX1 A;  3P5V A;  3MHH A;  1CB5 A;  1PXV A;  1KFU L;  1YT7 A;  1F29 A;  1AIM A;  3BPM A;  2F7D A;  2XU1 A;  3O0U A;  1Q6K A;  2YJ9 A;  4X6H A;  1K3B B;  4QH6 A;  3H8C A;  3H6S A;  1SP4 B;  2NQI A;  4HWY A;  4BSQ A;  1QOL A;  1AU2 A;  1PBH A;  2P86 A;  2PAD A;  4N4Z A;  7PCK A;  3I3T A;  2DC8 A;  4RY2 A;  2AUX A;  3U8E A;  1DF0 A;  9PAP A;  1EF7 A;  2O6X A;  2GHU A;  3IHP A;  5PAD A;  1MEM A;  3NHE A;  4MSX A;  1NB3 A;  1GMY A;  1VJV A;  1O0E A;  1EWM A;  2AIM A;  2P7U A;  3BOW A;  4YYQ A;  1Y08 A;  3PBH A;  4OEM A;  3OVX A;  3H89 A;  3ZUA A;  1NPZ A;  2VHF A;  3RVW A;  4QRX A;  4DMY A;  1AYW A;  1F2A A;  3HWN A;  3MHS A;  1CPJ A;  1YAL A;  4DMX A;  4BQV A;  3QSD A;  2WBF X;  4AXL A;  2HXZ A;  1CV8 A;  4FJC A;  1CJL A;  2DCB A;  4OEL A;  2G8E A;  3TNX A;  2ACT A;  1CS8 A;  4I04 A;  2Y6E A;  2GFO A;  1PAD A;  1AEC A;  3KWZ A;  2G7Y A;  1ME4 A;  5FPW A;  2JQF R;  2FUD A;  2C0Y A;  4MZS A;  1XKG A;  1YVB A;  3BCN A;  1GCB A;  4CDD B;  3V6C A;  4X6I A;  2PNS A;  1GLO A;  4CDE B;  4YYW A;  1BQI A;  1ATK A;  2E00 A;  4I07 A;  3N3G A;  1ICF A;  4FIP A;  2XU4 A;  2HHN A;  3IMA A;  4Q8H A;  4AXM A;  3IV2 A;  1HUC B;  1MIR A;  3S3Q A;  2B1M A;  4ZUX U;  1NB5 A;  3MTN A;  2DJG B;  2FTD A;  1PPN A;  5A24 A;  3K8U A;  1FH0 A;  1QDQ A;  2F1G A;  4QRV A;  2OP3 A;  4YYR A;  2PRE A;  3P5X A;  2DJF B; 
#chains in the Genus database with same CATH topology
 4YYU A;  2DC9 A;  4K7C A;  4G54 A;  4YYV A;  1BY8 A;  4OVZ B;  2FYE A;  2R9C A;  3GCB A;  1S4V A;  3QT4 A;  2FE8 A;  1DEU A;  1Y4H A;  2AVW A;  2R9O A;  2YJ8 A;  2G6D A;  1F2B A;  5JH3 A;  3KKU A;  2J7Q C;  3HHI A;  1BP4 A;  2HH5 A;  2Z84 A;  3TMP A;  4D8B A;  4BS5 A;  1PIP A;  3ERV A;  4QBB A;  1PCI A;  1PPO A;  4D8E A;  1YK8 A;  3S3R A;  2FRQ A;  2AYO A;  4IP3 A;  1MHW A;  1KXR A;  1GEC E;  2R9F A;  3K24 A;  2AU1 A;  2DZY A;  3KFQ A;  4RNA A;  3USV A;  3WXG A;  4BOU A;  2PBH A;  1NLJ A;  2JQG R;  3M99 A;  2NQD B;  1F2C A;  1ME3 A;  2YJ2 A;  4MI7 A;  3PW3 A;  4PT5 A;  1M6D A;  4W4U A;  1ZIV A;  1EWO A;  2FQ9 A;  1X9Y A;  3KWB X;  3P5U A;  1YK7 A;  1TU6 A;  3BC3 A;  3RVX A;  1CTE A;  4XUI A;  3PDF A;  4BOQ A;  4P6E A;  1VSN A;  1U9W A;  1AU3 A;  2BTW B;  3MJ5 A;  3HHA A;  3LFY A;  4D8I A;  1PPP A;  2FRA A;  1STF E;  3KW9 A;  3IOQ A;  4ZTB A;  1DKI A;  3PHX A;  3O65 A;  2DCC A;  3OVZ A;  4QRG A;  4BOS A;  2UZJ A;  1ITO A;  2AUZ A;  3PNR A;  5CHV A;  3I06 A;  4WA6 A;  4W5C A;  4CZW A;  2E03 A;  2OUL A;  1U5I A;  4CDC B;  3CH3 X;  5EF4 A;  1AYU A;  3CBK A;  4RF1 A;  2DCA A;  2DC7 A;  4P16 A;  3N4C A;  3W30 A;  3V6E A;  4YVA A;  3BWK A;  1U9V A;  3MP2 A;  3O1G A;  6PAD A;  3K9M A;  1TL9 A;  4BS6 A;  3IUT A;  3D6S A;  3H7D A;  1PE6 A;  4PP1 A;  2XU3 A;  2XU5 A;  3F75 A;  3OF8 A;  2E01 A;  2G8J A;  2YJC A;  4BOP A;  1CVZ A;  1MS6 A;  2BDZ A;  4OW0 A;  4A5U A;  4Q8G A;  4P6G A;  2IPP B;  3AI8 A;  5EZS A;  2AYN A;  4CDF B;  4OVZ A;  1BGO A;  1EWP A;  1CSB B;  5EGW A;  5F02 A;  2DZZ A;  4M0W A;  3B79 A;  3HD3 A;  3QJ3 A;  5CHT A;  2NQG A;  1AYV A;  4PI3 A;  3F5V A;  1EWL A;  4BPV A;  5CVN B;  1IWD A;  4X6J A;  2R9M A;  4PAD A;  3KSE A;  4XR7 A;  2NQA A;  2FO5 A;  1QXP A;  1KFX L;  1THE A;  5JZE A;  2E02 A;  5CVM A;  1QMY A;  4KLB A;  2JTC A;  2P0R A;  3C9E A;  1CQD A;  2DC6 A;  2IBI A;  3PHW A;  4IUM A;  4MZO A;  3LXS A;  2J7Q A;  3PSE A;  1NQC A;  3PT2 A;  4YYS A;  4XZX A;  3N3K A;  2BDL A;  4FK5 A;  4WUR A;  3W31 A;  2YJB A;  1JQP A;  3CBJ A;  3OF9 A;  1AU4 A;  4W5B A;  8PCH A;  1PVJ A;  2HWK A;  5JA7 A;  2DOS A;  2BTW A;  3WXE A;  4I05 A;  1SNK A;  4N8W A;  5CVO B;  1A6R A;  3ZNH A;  3WXF A;  1AU0 A;  2AGA A;  3BPF A;  4R3D A;  3CH2 X;  3OIS A;  1ZCM A;  5K16 A;  3BBA A;  2R6N A;  2CIO A;  2FT2 A;  2R9N A;  1POP A;  3RVV A;  1TLO A;  1U9X A;  3RNV A;  2AS8 A;  2CB5 A;  1KHP A;  3DF0 A;  2BU3 A;  2ATO A;  4PP2 E;  3MOR A;  2VHS A;  3E1Z B;  3B21 A;  5E6J A;  1MDW A;  3H8B A;  4N79 A;  1PPD A;  4YV8 A;  1U9Q X;  2Y5B A;  1MEG A;  2HD5 A;  2H7J A;  2DCD A;  1KHQ A;  1NL6 A;  3IEJ A;  2B1N A;  5J94 A;  2ARY A;  4RF0 A;  3P5W A;  3OQC A;  2OZ2 A;  3KX1 A;  3P5V A;  3MHH A;  1CB5 A;  1PXV A;  1KFU L;  1YT7 A;  1F29 A;  1YZB A;  1AIM A;  3BPM A;  2F7D A;  2XU1 A;  3O0U A;  1Q6K A;  2YJ9 A;  4X6H A;  1K3B B;  4QH6 A;  3H8C A;  3H6S A;  1SP4 B;  2NQI A;  4HWY A;  4BSQ A;  1QOL A;  1AU2 A;  4GUA A;  1PBH A;  2P86 A;  2PAD A;  4N4Z A;  7PCK A;  3I3T A;  2DC8 A;  4RY2 A;  2AUX A;  3U8E A;  1DF0 A;  9PAP A;  1EF7 A;  2O6X A;  2GHU A;  3IHP A;  5PAD A;  1MEM A;  3E9S A;  3NHE A;  4MSX A;  1NB3 A;  1GMY A;  1VJV A;  1O0E A;  1EWM A;  2AIM A;  2P7U A;  3BOW A;  4YYQ A;  1Y08 A;  3PBH A;  4OEM A;  3OVX A;  3H89 A;  3ZUA A;  1NPZ A;  2VHF A;  3RVW A;  4QRX A;  4DMY A;  1AYW A;  4HXD B;  1F2A A;  3HWN A;  3MHS A;  1CPJ A;  1YAL A;  4DMX A;  4BQV A;  3QSD A;  5EZQ A;  2WBF X;  4AXL A;  2HXZ A;  1CV8 A;  3BB7 A;  4FJC A;  1CJL A;  2DCB A;  3C0R A;  4REZ A;  4OEL A;  2G8E A;  3TNX A;  2ACT A;  1CS8 A;  4I04 A;  2Y6E A;  2JRI A;  2GFO A;  1PAD A;  1AEC A;  3KWZ A;  2G7Y A;  1ME4 A;  4MM3 B;  5FPW A;  2JQF R;  2FUD A;  2C0Y A;  4MZS A;  1XKG A;  1YVB A;  3BCN A;  1GCB A;  4CDD B;  4BOZ A;  3IFU A;  3PHU A;  3V6C A;  4X6I A;  1UKF A;  2PNS A;  1GLO A;  4CDE B;  4YYW A;  1BQI A;  1ATK A;  2E00 A;  4I07 A;  3N3G A;  4RKX A;  5KO3 A;  1ICF A;  4FIP A;  2XU4 A;  2HHN A;  3IMA A;  4Q8H A;  4AXM A;  3IV2 A;  1HUC B;  1MIR A;  3S3Q A;  3TRK A;  2B1M A;  4ZUX U;  3MTV A;  3MTN A;  2DJG B;  1NB5 A;  2FTD A;  1PPN A;  5A24 A;  3BY4 A;  3K8U A;  1FH0 A;  1QDQ A;  2F1G A;  4QRV A;  2OP3 A;  4YYR A;  3PRP A;  2PRE A;  3P5X A;  2DJF B;  3PRM A; 
#chains in the Genus database with same CATH homology
 4YYU A;  2DC9 A;  4K7C A;  4G54 A;  4YYV A;  1BY8 A;  2FYE A;  2R9C A;  3GCB A;  1E2T A;  1S4V A;  3QT4 A;  1DEU A;  1Y4H A;  2AVW A;  2R9O A;  2YJ8 A;  2G6D A;  1F2B A;  5JH3 A;  3KKU A;  3HHI A;  1BP4 A;  2HH5 A;  4BS5 A;  1PIP A;  3ERV A;  4QBB A;  1PCI A;  1PPO A;  3D9W A;  1YK8 A;  3S3R A;  2FRQ A;  2AYO A;  1MHW A;  1KXR A;  1GEC E;  2R9F A;  3K24 A;  2AU1 A;  2DZY A;  3KFQ A;  3USV A;  3WXG A;  2PBH A;  1NLJ A;  2JQG R;  3M99 A;  2NQD B;  1F2C A;  1ME3 A;  2YJ2 A;  3PW3 A;  1M6D A;  4W4U A;  1ZIV A;  1EWO A;  2FQ9 A;  1X9Y A;  3KWB X;  3P5U A;  1YK7 A;  1TU6 A;  3BC3 A;  4NV7 A;  1CTE A;  3RVX A;  4XUI A;  3PDF A;  4P6E A;  1VSN A;  1U9W A;  1AU3 A;  3HHA A;  3LFY A;  1PPP A;  2FRA A;  1STF E;  3KW9 A;  4NV8 A;  3IOQ A;  2DCC A;  3OVZ A;  4QRG A;  1ITO A;  2AUZ A;  3PNR A;  5CHV A;  3I06 A;  4WA6 A;  4W5C A;  4CZW A;  2E03 A;  2OUL A;  1U5I A;  4CDC B;  3CH3 X;  5EF4 A;  1AYU A;  3CBK A;  2DCA A;  2DC7 A;  3N4C A;  3V6E A;  4YVA A;  3BWK A;  1U9V A;  3O1G A;  6PAD A;  3K9M A;  1TL9 A;  4BS6 A;  3IUT A;  3D6S A;  3H7D A;  1PE6 A;  4PP1 A;  2XU3 A;  2XU5 A;  3F75 A;  3OF8 A;  2E01 A;  2G8J A;  2YJC A;  1CVZ A;  1MS6 A;  2BDZ A;  4Q8G A;  4P6G A;  2IPP B;  3AI8 A;  2AYN A;  4CDF B;  4B55 A;  1BGO A;  1EWP A;  1CSB B;  5EGW A;  5F02 A;  2DZZ A;  3B79 A;  3HD3 A;  3QJ3 A;  5CHT A;  2NQG A;  1AYV A;  4PI3 A;  3F5V A;  1EWL A;  4BPV A;  5CVN B;  1IWD A;  4X6J A;  2R9M A;  4PAD A;  3KSE A;  4XR7 A;  2NQA A;  2FO5 A;  1QXP A;  1KFX L;  1THE A;  2E02 A;  4GUZ A;  5CVM A;  1QMY A;  4KLB A;  2P0R A;  3C9E A;  1CQD A;  2DC6 A;  2IBI A;  4MZO A;  3LXS A;  1NQC A;  4YYS A;  3N3K A;  2BDL A;  4FK5 A;  1W5R A;  2YJB A;  1JQP A;  3CBJ A;  3OF9 A;  1AU4 A;  4W5B A;  8PCH A;  3LTW A;  5JA7 A;  3WXE A;  4I05 A;  1SNK A;  4N8W A;  5CVO B;  1A6R A;  3WXF A;  1AU0 A;  3BPF A;  3CH2 X;  3OIS A;  1ZCM A;  5K16 A;  2R6N A;  2CIO A;  2FT2 A;  2R9N A;  1POP A;  3RVV A;  1TLO A;  1U9X A;  2AS8 A;  2CB5 A;  1KHP A;  3DF0 A;  2ATO A;  4PP2 E;  3MOR A;  2VHS A;  3E1Z B;  1MDW A;  3H8B A;  4N79 A;  1PPD A;  4YV8 A;  1U9Q X;  2Y5B A;  1MEG A;  2HD5 A;  2VFC A;  2H7J A;  2DCD A;  1KHQ A;  1NL6 A;  3IEJ A;  2B1N A;  2BSZ A;  5J94 A;  2ARY A;  3P5W A;  2OZ2 A;  3KX1 A;  3P5V A;  3MHH A;  1CB5 A;  1PXV A;  1KFU L;  1YT7 A;  1F29 A;  1AIM A;  3BPM A;  2F7D A;  2XU1 A;  3O0U A;  4BGF A;  1Q6K A;  2YJ9 A;  4X6H A;  1K3B B;  4QH6 A;  3H8C A;  3H6S A;  1SP4 B;  2NQI A;  4HWY A;  4BSQ A;  1QOL A;  1AU2 A;  1PBH A;  2P86 A;  2PAD A;  4N4Z A;  7PCK A;  3I3T A;  2DC8 A;  4RY2 A;  1W4T A;  2AUX A;  3U8E A;  1DF0 A;  9PAP A;  1EF7 A;  2O6X A;  2GHU A;  3IHP A;  5PAD A;  1MEM A;  3NHE A;  4MSX A;  1NB3 A;  1GMY A;  1VJV A;  1O0E A;  1EWM A;  2AIM A;  2P7U A;  3BOW A;  4YYQ A;  1Y08 A;  3PBH A;  4OEM A;  3OVX A;  3H89 A;  3ZUA A;  1NPZ A;  2VHF A;  3RVW A;  4QRX A;  4DMY A;  1AYW A;  1F2A A;  3HWN A;  3MHS A;  1CPJ A;  1YAL A;  4DMX A;  4BQV A;  3QSD A;  2WBF X;  4AXL A;  2HXZ A;  1CV8 A;  4FJC A;  1CJL A;  2DCB A;  4OEL A;  2VFB A;  2G8E A;  3TNX A;  2ACT A;  1CS8 A;  4I04 A;  2Y6E A;  2GFO A;  1PAD A;  1AEC A;  3KWZ A;  2G7Y A;  1ME4 A;  5FPW A;  2JQF R;  2FUD A;  2C0Y A;  4MZS A;  1XKG A;  1YVB A;  3BCN A;  1GCB A;  4CDD B;  1W6F A;  3V6C A;  4X6I A;  2PNS A;  1GLO A;  4CDE B;  4YYW A;  4C5P A;  1BQI A;  1ATK A;  2E00 A;  4I07 A;  3N3G A;  1ICF A;  4FIP A;  2XU4 A;  2HHN A;  1GX3 A;  3IMA A;  4Q8H A;  4AXM A;  3IV2 A;  1HUC B;  1MIR A;  3S3Q A;  2B1M A;  4ZUX U;  1NB5 A;  3MTN A;  2DJG B;  2FTD A;  1PPN A;  5A24 A;  3K8U A;  1FH0 A;  1QDQ A;  2F1G A;  4QRV A;  2OP3 A;  4YYR A;  2PRE A;  3P5X A;  2DJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...