4MZOA

Mouse cathepsin s with covalent ligand (3s,4s)-n-[(2e)-2-iminoethyl]-4-(morpholin-4-ylcarbonyl)-1-(phenylsulfonyl)pyrrolidine-3-carboxamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
publication title Identification of potent and selective cathepsin S inhibitors containing different central cyclic scaffolds.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4mzoA00
2IBIA 3LXSA 2JQGR 5J94A 3OVZA 1AYVA 1YALA 3N3GA 3ERVA 2YJ8A 4MSXA 2C0YA 2P0RA 2FT2A 3MORA 3KWBX 4OELA 2ACTA 4YYWA 2R6NA 1PPOA 4PP2E 1SP4B 2BDZA 3MHSA 2AS8A 1YK7A 1AU0A 1M6DA 3PBHA 3WXEA 5F02A 4CDEB 2AYNA 2H7JA 1MIRA 4YYUA 4P6EA 1NL6A 2FO5A 5JA7A 2G7YA 3CH3X 4W4UA 5CHVA 4RY2A 2R9FA 3V6EA 3BPFA 2E02A 4PI3A 4XR7A 4WA6A 2DC8A 1GLOA 1A6RA 2Y6EA 2AU1A 3HHIA 3O1GA 3OF9A 1VJVA 3H7DA 4BSQA 1KHQA 1Y08A 3KX1A 1AIMA 3MHHA 2DC7A 3I3TA 3C9EA 2GHUA 3BC3A 1NLJA 4MZOA 1F2CA 1BY8A 1PADA 1Q6KA 4QBBA 2VHFA 1THEA 1JQPA 4BPVA 4CZWA 3KFQA 1TU6A 4W5CA 1KXRA 4AXLA 4N4ZA 4OEMA 2FYEA 1PPDA 2R9NA 2R9CA 1F29A 4X6JA 3HHAA 4YYRA 2HHNA 1PPPA 3QJ3A 3BOWA 3GCBA 3PDFA 2CB5A 3H89A 2R9MA 2Y5BA 3BPMA 3D6SA 4Q8GA 5CVOB 1U9VA 2OP3A 1CV8A 1ATKA 4QRXA 3KSEA 1GCBA 1CTEA 2DCDA 2YJCA 1CS8A 3OISA 2E00A 1GMYA 4DMXA 4X6IA 2CIOA 2FTDA 2FRQA 1CB5A 1PPNA 1BP4A 4HWYA 3KW9A 2DJFB 3N3KA 1POPA 7PCKA 5EF4A 3IEJA 1X9YA 3F75A 3M99A 4X6HA 4CDDB 2HXZA 4Q8HA 3RVWA 4K7CA 2ATOA 3N4CA 3P5UA 1YVBA 4FIPA 1NQCA 3U8EA 2AIMA 4P6GA 2PADA 5FPWA 2PREA 4YYVA 2ARYA 3BCNA 3KKUA 4BS6A 3H6SA 1AYWA 3K8UA 2JQFR 3B79A 1IWDA 6PADA 2XU1A 1ME4A 1AYUA 1PXVA 3NHEA 1QDQA 3DF0A 1KFXL 2HD5A 1YK8A 2XU5A 4PADA 1F2AA 3RVVA 2HH5A 3E1ZB 1QOLA 5A24A 4FK5A 2G6DA 1SNKA 3H8CA 4BS5A 1ZIVA 2AUZA 1FH0A 4ZUXU 1DF0A 1EF7A 1EWMA 3RVXA 2AYOA 1CVZA 2DC9A 1ZCMA 9PAPA 2YJ9A 1KHPA 1MEMA 4N8WA 1K3BB 4DMYA 3BWKA 1U9WA 2XU4A 2G8JA 4QRGA 5JH3A 3WXFA 1CSBB 5K16A 2NQDB 1EWOA 3CH2X 1VSNA 1F2BA 1U9QX 2E01A 1BQIA 2PNSA 1DEUA 1ME3A 3HD3A 2P7UA 5CHTA 3WXGA 1ITOA 1NPZA 3H8BA 4BQVA 3IUTA 3F5VA 3IV2A 4CDFB 2DZYA 3MTNA 1EWLA 2FQ9A 3OF8A 2DCCA 5PADA 1MS6A 1BGOA 5CVNB 1NB3A 1PIPA 2DCBA 4I07A 3PW3A 4I04A 1YT7A 1TLOA 3IHPA 1PE6A 3IMAA 1MDWA 4YV8A 1PCIA 2P86A 3P5VA 3ZUAA 3AI8A 1QXPA 2FRAA 2F1GA 1TL9A 2NQAA 3O0UA 1QMYA 5CVMA 2OZ2A 3P5WA 3USVA 2R9OA 3TNXA 4YYQA 1S4VA 2B1MA 4QRVA 2B1NA 2YJ2A 2AUXA 3K24A 2O6XA 4XUIA 1PBHA 4MZSA 1ICFA 3CBKA 3IOQA 2NQGA 3V6CA 2WBFX 3QSDA 2GFOA 3S3RA 2F7DA 2NQIA 1CQDA 3S3QA 1AU4A 2OULA 1CPJA 3K9MA 3I06A 2DJGB 3KWZA 4AXMA 3QT4A 4G54A 1XKGA 3P5XA 2IPPB 1Y4HA 1U5IA 3PNRA 2BDLA 2DC6A 2PBHA 2FUDA 1NB5A 1KFUL 4KLBA 2G8EA 5EGWA 2DZZA 1U9XA 4PP1A 4YYSA 2XU3A 2VHSA 4W5BA 1EWPA 1AU3A 2YJBA 8PCHA 1STFE 2E03A 4CDCB 3CBJA 1GECE 4YVAA 4N79A 3HWNA 2DCAA 4FJCA 1MEGA 3OVXA 1AECA 2AVWA 4I05A 1HUCB 1AU2A 3LFYA 4QH6A 1O0EA 1CJLA 1MHWA
chains in the Genus database with same CATH superfamily
2IBIA 3LXSA 2JQGR 5J94A 3OVZA 1AYVA 1YALA 3N3GA 3ERVA 2YJ8A 4MSXA 2C0YA 2P0RA 2FT2A 2UZJA 3MORA 3KWBX 5KO3A 4OELA 3TRKA 2ACTA 4YYWA 2R6NA 1PPOA 4PP2E 1SP4B 2BDZA 3MHSA 5EZSA 2AS8A 1YK7A 1AU0A 1M6DA 3PBHA 3WXEA 5F02A 4CDEB 2AYNA 2H7JA 1MIRA 4YYUA 1NL6A 2FO5A 4P6EA 5JA7A 2G7YA 3CH3X 4W4UA 4MM3B 5CHVA 4RY2A 5JZEA 2R9FA 3MP2A 3V6EA 3PSEA 4XZXA 3BPFA 2E02A 4PI3A 4XR7A 3PRPA 4WA6A 4D8BA 4D8IA 2DC8A 1GLOA 1A6RA 2Y6EA 2AU1A 3HHIA 3O1GA 3OF9A 1VJVA 3H7DA 4BSQA 1KHQA 1Y08A 3KX1A 1AIMA 3MHHA 2DC7A 3I3TA 3C9EA 2GHUA 3BC3A 1NLJA 4MZOA 1F2CA 1BY8A 1PADA 1Q6KA 4QBBA 4M0WA 2VHFA 1THEA 1JQPA 4BPVA 3OQCA 4CZWA 4REZA 3KFQA 1TU6A 4W5CA 1KXRA 4AXLA 4PT5A 4GUAA 4N4ZA 4OEMA 3O65A 2FYEA 1PPDA 2R9NA 2R9CA 1F29A 4WURA 4X6JA 3C0RA 3HHAA 4YYRA 2HHNA 2FE8A 1PPPA 3BBAA 3QJ3A 3BOWA 3GCBA 3PDFA 2CB5A 3H89A 3ZNHA 2R9MA 2Y5BA 3BPMA 3D6SA 4Q8GA 5CVOB 4OVZB 3W30A 1U9VA 4P16A 2OP3A 3IFUA 1CV8A 1ATKA 4QRXA 3KSEA 1GCBA 1CTEA 2DCDA 4ZTBA 2YJCA 1PVJA 1CS8A 3OISA 2E00A 1GMYA 2J7QA 4DMXA 4X6IA 3RNVA 2CIOA 2FTDA 2FRQA 1CB5A 1PPNA 1BP4A 4HWYA 3KW9A 2DJFB 3N3KA 1POPA 7PCKA 5EF4A 3IEJA 1X9YA 1UKFA 3F75A 3M99A 4X6HA 4CDDB 2HXZA 4Q8HA 3RVWA 4K7CA 2ATOA 3N4CA 3P5UA 1YVBA 4FIPA 1NQCA 3U8EA 2AIMA 4P6GA 2PADA 5FPWA 2PREA 4YYVA 2HWKA 2ARYA 3BCNA 3KKUA 4BOUA 4BS6A 3H6SA 1AYWA 3K8UA 3TMPA 2JQFR 3B79A 1IWDA 6PADA 2XU1A 1ME4A 1AYUA 1PXVA 3MTVA 3NHEA 1QDQA 3DF0A 1KFXL 2HD5A 1YK8A 2XU5A 4PADA 1F2AA 3RVVA 2HH5A 3E1ZB 1QOLA 3PHWA 5A24A 1YZBA 4FK5A 2G6DA 1SNKA 3H8CA 4BS5A 1ZIVA 2AUZA 1FH0A 4BOZA 4ZUXU 1DF0A 3PRMA 1EF7A 1EWMA 4R3DA 3RVXA 2AYOA 1CVZA 4BOQA 2DC9A 2Z84A 4A5UA 1ZCMA 9PAPA 2YJ9A 1KHPA 1DKIA 1MEMA 4N8WA 1K3BB 4DMYA 3BWKA 1U9WA 2XU4A 2G8JA 4QRGA 5JH3A 3WXFA 1CSBB 5K16A 2NQDB 1EWOA 2BTWB 3CH2X 1VSNA 1F2BA 1U9QX 4BOSA 2E01A 1BQIA 2PNSA 1DEUA 1ME3A 3HD3A 2P7UA 5CHTA 3WXGA 1ITOA 1NPZA 3H8BA 4BQVA 3PHXA 3IUTA 3F5VA 3IV2A 4CDFB 2DZYA 3MTNA 1EWLA 3W31A 2FQ9A 3OF8A 2DCCA 5PADA 1MS6A 1BGOA 5CVNB 2DOSA 1NB3A 1PIPA 2DCBA 4I07A 3BB7A 3PW3A 4I04A 1YT7A 1TLOA 3IHPA 3PT2A 1PE6A 3IMAA 1MDWA 5E6JA 4YV8A 1PCIA 2P86A 2JTCA 3P5VA 3ZUAA 3AI8A 4BOPA 2BTWA 5EZQA 1QXPA 2FRAA 2F1GA 1TL9A 2NQAA 3O0UA 1QMYA 4OVZA 4RKXA 5CVMA 2OZ2A 3P5WA 3USVA 2R9OA 3TNXA 4YYQA 1S4VA 2B1MA 4QRVA 2B1NA 2YJ2A 2AUXA 3K24A 2O6XA 4D8EA 3BY4A 4XUIA 1PBHA 4MI7A 4MZSA 1ICFA 3CBKA 3IOQA 4RF0A 2NQGA 3V6CA 2WBFX 4RF1A 3QSDA 2GFOA 3S3RA 2F7DA 2NQIA 1CQDA 3S3QA 1AU4A 2OULA 1CPJA 3K9MA 3I06A 2DJGB 3KWZA 4AXMA 2JRIA 3MJ5A 3QT4A 4G54A 4OW0A 1XKGA 3PHUA 3P5XA 2IPPB 1Y4HA 1U5IA 3PNRA 2BDLA 2DC6A 2PBHA 2FUDA 1NB5A 1KFUL 4KLBA 2G8EA 5EGWA 2DZZA 1U9XA 4PP1A 4YYSA 2XU3A 2VHSA 4RNAA 4W5BA 4HXDB 1EWPA 1AU3A 2YJBA 3B21A 3E9SA 8PCHA 1STFE 2E03A 4CDCB 3CBJA 1GECE 4YVAA 4N79A 3HWNA 2DCAA 2AGAA 4FJCA 1MEGA 3OVXA 4IUMA 2J7QC 1AECA 2AVWA 4I05A 2BU3A 1HUCB 1AU2A 3LFYA 4QH6A 1O0EA 4IP3A 1CJLA 1MHWA
chains in the Genus database with same CATH topology
2IBIA 3LXSA 2JQGR 5J94A 3OVZA 1AYVA 1YALA 3N3GA 3ERVA 2YJ8A 4MSXA 2C0YA 2P0RA 2FT2A 3MORA 3KWBX 4OELA 2ACTA 4YYWA 2R6NA 1PPOA 4PP2E 1SP4B 2BDZA 3MHSA 2AS8A 1YK7A 1AU0A 1M6DA 3PBHA 3WXEA 5F02A 4CDEB 2AYNA 4B55A 2H7JA 1MIRA 4YYUA 1NL6A 2FO5A 4P6EA 5JA7A 2G7YA 3CH3X 4W4UA 5CHVA 4RY2A 2R9FA 3V6EA 2BSZA 3BPFA 2E02A 4PI3A 4XR7A 4WA6A 1W6FA 2DC8A 1GLOA 1A6RA 1W4TA 2Y6EA 2AU1A 3HHIA 3O1GA 3OF9A 1VJVA 1GX3A 3H7DA 4BSQA 1KHQA 1Y08A 3KX1A 1AIMA 3MHHA 2DC7A 3I3TA 3C9EA 2GHUA 3BC3A 1NLJA 4MZOA 1F2CA 1BY8A 1PADA 1Q6KA 4QBBA 2VHFA 1THEA 1JQPA 4BPVA 4CZWA 3KFQA 1TU6A 4W5CA 1KXRA 4AXLA 4N4ZA 4OEMA 2FYEA 1PPDA 2R9NA 2R9CA 1F29A 4X6JA 3D9WA 3HHAA 4YYRA 2HHNA 1PPPA 3QJ3A 3BOWA 3GCBA 3PDFA 2CB5A 3H89A 2R9MA 2Y5BA 3BPMA 3D6SA 4Q8GA 5CVOB 1U9VA 2OP3A 1CV8A 1ATKA 4QRXA 3KSEA 1GCBA 4C5PA 1CTEA 2DCDA 2YJCA 1CS8A 3OISA 2E00A 1GMYA 4DMXA 4X6IA 2CIOA 2FTDA 2FRQA 1CB5A 1PPNA 1BP4A 4HWYA 3KW9A 2DJFB 3N3KA 1POPA 7PCKA 5EF4A 3IEJA 1X9YA 3F75A 3M99A 4X6HA 4CDDB 2HXZA 4Q8HA 3RVWA 4K7CA 2ATOA 3N4CA 3P5UA 1YVBA 4FIPA 1NQCA 3U8EA 2AIMA 4P6GA 2PADA 5FPWA 2PREA 4YYVA 2ARYA 3BCNA 3KKUA 4BS6A 3H6SA 1AYWA 3K8UA 2JQFR 3B79A 1IWDA 6PADA 2XU1A 1ME4A 1AYUA 1PXVA 3NHEA 1QDQA 3DF0A 1KFXL 2HD5A 1YK8A 2XU5A 4PADA 1F2AA 3RVVA 2HH5A 3E1ZB 1QOLA 5A24A 4FK5A 2G6DA 1SNKA 3H8CA 4BS5A 3LTWA 1ZIVA 2AUZA 1FH0A 4ZUXU 1DF0A 1EF7A 1EWMA 3RVXA 2AYOA 1CVZA 2DC9A 1ZCMA 9PAPA 2YJ9A 1KHPA 1MEMA 4N8WA 1K3BB 4DMYA 3BWKA 1U9WA 2XU4A 2G8JA 4BGFA 4QRGA 5JH3A 4GUZA 1CSBB 5K16A 3WXFA 2NQDB 1EWOA 3CH2X 1VSNA 1F2BA 1U9QX 2E01A 1BQIA 2PNSA 1DEUA 1ME3A 3HD3A 2P7UA 5CHTA 3WXGA 1ITOA 1NPZA 3H8BA 4BQVA 3IUTA 3F5VA 3IV2A 4CDFB 2DZYA 3MTNA 1EWLA 2FQ9A 2VFCA 3OF8A 4NV8A 2DCCA 5PADA 1MS6A 1BGOA 5CVNB 1NB3A 1PIPA 2DCBA 4I07A 3PW3A 4I04A 1YT7A 1TLOA 3IHPA 1PE6A 2VFBA 1E2TA 3IMAA 1MDWA 4YV8A 1PCIA 2P86A 3P5VA 3ZUAA 3AI8A 1QXPA 2FRAA 2F1GA 1TL9A 2NQAA 3O0UA 1QMYA 5CVMA 2OZ2A 3P5WA 3USVA 2R9OA 3TNXA 4YYQA 1S4VA 2B1MA 4QRVA 2B1NA 2YJ2A 2AUXA 3K24A 2O6XA 4XUIA 1PBHA 4MZSA 1ICFA 3CBKA 3IOQA 2NQGA 3V6CA 2WBFX 3QSDA 2GFOA 3S3RA 2F7DA 2NQIA 1CQDA 3S3QA 1AU4A 2OULA 1CPJA 3K9MA 3I06A 2DJGB 3KWZA 4AXMA 3QT4A 4G54A 1XKGA 3P5XA 2IPPB 1Y4HA 1U5IA 1W5RA 3PNRA 2BDLA 2DC6A 2PBHA 2FUDA 1NB5A 1KFUL 4KLBA 2G8EA 5EGWA 2DZZA 1U9XA 4PP1A 4YYSA 2XU3A 2VHSA 4W5BA 1EWPA 1AU3A 2YJBA 8PCHA 1STFE 2E03A 4CDCB 3CBJA 1GECE 4YVAA 4N79A 3HWNA 4NV7A 2DCAA 4FJCA 1MEGA 3OVXA 1AECA 2AVWA 4I05A 1HUCB 1AU2A 3LFYA 4QH6A 1O0EA 1CJLA 1MHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBI A;  3LXS A;  2JQG R;  5J94 A;  3OVZ A;  1AYV A;  1YAL A;  3N3G A;  3ERV A;  2YJ8 A;  4MSX A;  2C0Y A;  2P0R A;  2FT2 A;  3MOR A;  3KWB X;  4OEL A;  2ACT A;  4YYW A;  2R6N A;  1PPO A;  4PP2 E;  1SP4 B;  2BDZ A;  3MHS A;  2AS8 A;  1YK7 A;  1AU0 A;  1M6D A;  3PBH A;  3WXE A;  5F02 A;  4CDE B;  2AYN A;  2H7J A;  1MIR A;  4YYU A;  4P6E A;  1NL6 A;  2FO5 A;  5JA7 A;  2G7Y A;  3CH3 X;  4W4U A;  5CHV A;  4RY2 A;  2R9F A;  3V6E A;  3BPF A;  2E02 A;  4PI3 A;  4XR7 A;  4WA6 A;  2DC8 A;  1GLO A;  1A6R A;  2Y6E A;  2AU1 A;  3HHI A;  3O1G A;  3OF9 A;  1VJV A;  3H7D A;  4BSQ A;  1KHQ A;  1Y08 A;  3KX1 A;  1AIM A;  3MHH A;  2DC7 A;  3I3T A;  3C9E A;  2GHU A;  3BC3 A;  1NLJ A;  4MZO A;  1F2C A;  1BY8 A;  1PAD A;  1Q6K A;  4QBB A;  2VHF A;  1THE A;  1JQP A;  4BPV A;  4CZW A;  3KFQ A;  1TU6 A;  4W5C A;  1KXR A;  4AXL A;  4N4Z A;  4OEM A;  2FYE A;  1PPD A;  2R9N A;  2R9C A;  1F29 A;  4X6J A;  3HHA A;  4YYR A;  2HHN A;  1PPP A;  3QJ3 A;  3BOW A;  3GCB A;  3PDF A;  2CB5 A;  3H89 A;  2R9M A;  2Y5B A;  3BPM A;  3D6S A;  4Q8G A;  5CVO B;  1U9V A;  2OP3 A;  1CV8 A;  1ATK A;  4QRX A;  3KSE A;  1GCB A;  1CTE A;  2DCD A;  2YJC A;  1CS8 A;  3OIS A;  2E00 A;  1GMY A;  4DMX A;  4X6I A;  2CIO A;  2FTD A;  2FRQ A;  1CB5 A;  1PPN A;  1BP4 A;  4HWY A;  3KW9 A;  2DJF B;  3N3K A;  1POP A;  7PCK A;  5EF4 A;  3IEJ A;  1X9Y A;  3F75 A;  3M99 A;  4X6H A;  4CDD B;  2HXZ A;  4Q8H A;  3RVW A;  4K7C A;  2ATO A;  3N4C A;  3P5U A;  1YVB A;  4FIP A;  1NQC A;  3U8E A;  2AIM A;  4P6G A;  2PAD A;  5FPW A;  2PRE A;  4YYV A;  2ARY A;  3BCN A;  3KKU A;  4BS6 A;  3H6S A;  1AYW A;  3K8U A;  2JQF R;  3B79 A;  1IWD A;  6PAD A;  2XU1 A;  1ME4 A;  1AYU A;  1PXV A;  3NHE A;  1QDQ A;  3DF0 A;  1KFX L;  2HD5 A;  1YK8 A;  2XU5 A;  4PAD A;  1F2A A;  3RVV A;  2HH5 A;  3E1Z B;  1QOL A;  5A24 A;  4FK5 A;  2G6D A;  1SNK A;  3H8C A;  4BS5 A;  1ZIV A;  2AUZ A;  1FH0 A;  4ZUX U;  1DF0 A;  1EF7 A;  1EWM A;  3RVX A;  2AYO A;  1CVZ A;  2DC9 A;  1ZCM A;  9PAP A;  2YJ9 A;  1KHP A;  1MEM A;  4N8W A;  1K3B B;  4DMY A;  3BWK A;  1U9W A;  2XU4 A;  2G8J A;  4QRG A;  5JH3 A;  3WXF A;  1CSB B;  5K16 A;  2NQD B;  1EWO A;  3CH2 X;  1VSN A;  1F2B A;  1U9Q X;  2E01 A;  1BQI A;  2PNS A;  1DEU A;  1ME3 A;  3HD3 A;  2P7U A;  5CHT A;  3WXG A;  1ITO A;  1NPZ A;  3H8B A;  4BQV A;  3IUT A;  3F5V A;  3IV2 A;  4CDF B;  2DZY A;  3MTN A;  1EWL A;  2FQ9 A;  3OF8 A;  2DCC A;  5PAD A;  1MS6 A;  1BGO A;  5CVN B;  1NB3 A;  1PIP A;  2DCB A;  4I07 A;  3PW3 A;  4I04 A;  1YT7 A;  1TLO A;  3IHP A;  1PE6 A;  3IMA A;  1MDW A;  4YV8 A;  1PCI A;  2P86 A;  3P5V A;  3ZUA A;  3AI8 A;  1QXP A;  2FRA A;  2F1G A;  1TL9 A;  2NQA A;  3O0U A;  1QMY A;  5CVM A;  2OZ2 A;  3P5W A;  3USV A;  2R9O A;  3TNX A;  4YYQ A;  1S4V A;  2B1M A;  4QRV A;  2B1N A;  2YJ2 A;  2AUX A;  3K24 A;  2O6X A;  4XUI A;  1PBH A;  4MZS A;  1ICF A;  3CBK A;  3IOQ A;  2NQG A;  3V6C A;  2WBF X;  3QSD A;  2GFO A;  3S3R A;  2F7D A;  2NQI A;  1CQD A;  3S3Q A;  1AU4 A;  2OUL A;  1CPJ A;  3K9M A;  3I06 A;  2DJG B;  3KWZ A;  4AXM A;  3QT4 A;  4G54 A;  1XKG A;  3P5X A;  2IPP B;  1Y4H A;  1U5I A;  3PNR A;  2BDL A;  2DC6 A;  2PBH A;  2FUD A;  1NB5 A;  1KFU L;  4KLB A;  2G8E A;  5EGW A;  2DZZ A;  1U9X A;  4PP1 A;  4YYS A;  2XU3 A;  2VHS A;  4W5B A;  1EWP A;  1AU3 A;  2YJB A;  8PCH A;  1STF E;  2E03 A;  4CDC B;  3CBJ A;  1GEC E;  4YVA A;  4N79 A;  3HWN A;  2DCA A;  4FJC A;  1MEG A;  3OVX A;  1AEC A;  2AVW A;  4I05 A;  1HUC B;  1AU2 A;  3LFY A;  4QH6 A;  1O0E A;  1CJL A;  1MHW A; 
#chains in the Genus database with same CATH topology
 2IBI A;  3LXS A;  2JQG R;  5J94 A;  3OVZ A;  1AYV A;  1YAL A;  3N3G A;  3ERV A;  2YJ8 A;  4MSX A;  2C0Y A;  2P0R A;  2FT2 A;  2UZJ A;  3MOR A;  3KWB X;  5KO3 A;  4OEL A;  3TRK A;  2ACT A;  4YYW A;  2R6N A;  1PPO A;  4PP2 E;  1SP4 B;  2BDZ A;  3MHS A;  5EZS A;  2AS8 A;  1YK7 A;  1AU0 A;  1M6D A;  3PBH A;  3WXE A;  5F02 A;  4CDE B;  2AYN A;  2H7J A;  1MIR A;  4YYU A;  1NL6 A;  2FO5 A;  4P6E A;  5JA7 A;  2G7Y A;  3CH3 X;  4W4U A;  4MM3 B;  5CHV A;  4RY2 A;  5JZE A;  2R9F A;  3MP2 A;  3V6E A;  3PSE A;  4XZX A;  3BPF A;  2E02 A;  4PI3 A;  4XR7 A;  3PRP A;  4WA6 A;  4D8B A;  4D8I A;  2DC8 A;  1GLO A;  1A6R A;  2Y6E A;  2AU1 A;  3HHI A;  3O1G A;  3OF9 A;  1VJV A;  3H7D A;  4BSQ A;  1KHQ A;  1Y08 A;  3KX1 A;  1AIM A;  3MHH A;  2DC7 A;  3I3T A;  3C9E A;  2GHU A;  3BC3 A;  1NLJ A;  4MZO A;  1F2C A;  1BY8 A;  1PAD A;  1Q6K A;  4QBB A;  4M0W A;  2VHF A;  1THE A;  1JQP A;  4BPV A;  3OQC A;  4CZW A;  4REZ A;  3KFQ A;  1TU6 A;  4W5C A;  1KXR A;  4AXL A;  4PT5 A;  4GUA A;  4N4Z A;  4OEM A;  3O65 A;  2FYE A;  1PPD A;  2R9N A;  2R9C A;  1F29 A;  4WUR A;  4X6J A;  3C0R A;  3HHA A;  4YYR A;  2HHN A;  2FE8 A;  1PPP A;  3BBA A;  3QJ3 A;  3BOW A;  3GCB A;  3PDF A;  2CB5 A;  3H89 A;  3ZNH A;  2R9M A;  2Y5B A;  3BPM A;  3D6S A;  4Q8G A;  5CVO B;  4OVZ B;  3W30 A;  1U9V A;  4P16 A;  2OP3 A;  3IFU A;  1CV8 A;  1ATK A;  4QRX A;  3KSE A;  1GCB A;  1CTE A;  2DCD A;  4ZTB A;  2YJC A;  1PVJ A;  1CS8 A;  3OIS A;  2E00 A;  1GMY A;  2J7Q A;  4DMX A;  4X6I A;  3RNV A;  2CIO A;  2FTD A;  2FRQ A;  1CB5 A;  1PPN A;  1BP4 A;  4HWY A;  3KW9 A;  2DJF B;  3N3K A;  1POP A;  7PCK A;  5EF4 A;  3IEJ A;  1X9Y A;  1UKF A;  3F75 A;  3M99 A;  4X6H A;  4CDD B;  2HXZ A;  4Q8H A;  3RVW A;  4K7C A;  2ATO A;  3N4C A;  3P5U A;  1YVB A;  4FIP A;  1NQC A;  3U8E A;  2AIM A;  4P6G A;  2PAD A;  5FPW A;  2PRE A;  4YYV A;  2HWK A;  2ARY A;  3BCN A;  3KKU A;  4BOU A;  4BS6 A;  3H6S A;  1AYW A;  3K8U A;  3TMP A;  2JQF R;  3B79 A;  1IWD A;  6PAD A;  2XU1 A;  1ME4 A;  1AYU A;  1PXV A;  3MTV A;  3NHE A;  1QDQ A;  3DF0 A;  1KFX L;  2HD5 A;  1YK8 A;  2XU5 A;  4PAD A;  1F2A A;  3RVV A;  2HH5 A;  3E1Z B;  1QOL A;  3PHW A;  5A24 A;  1YZB A;  4FK5 A;  2G6D A;  1SNK A;  3H8C A;  4BS5 A;  1ZIV A;  2AUZ A;  1FH0 A;  4BOZ A;  4ZUX U;  1DF0 A;  3PRM A;  1EF7 A;  1EWM A;  4R3D A;  3RVX A;  2AYO A;  1CVZ A;  4BOQ A;  2DC9 A;  2Z84 A;  4A5U A;  1ZCM A;  9PAP A;  2YJ9 A;  1KHP A;  1DKI A;  1MEM A;  4N8W A;  1K3B B;  4DMY A;  3BWK A;  1U9W A;  2XU4 A;  2G8J A;  4QRG A;  5JH3 A;  3WXF A;  1CSB B;  5K16 A;  2NQD B;  1EWO A;  2BTW B;  3CH2 X;  1VSN A;  1F2B A;  1U9Q X;  4BOS A;  2E01 A;  1BQI A;  2PNS A;  1DEU A;  1ME3 A;  3HD3 A;  2P7U A;  5CHT A;  3WXG A;  1ITO A;  1NPZ A;  3H8B A;  4BQV A;  3PHX A;  3IUT A;  3F5V A;  3IV2 A;  4CDF B;  2DZY A;  3MTN A;  1EWL A;  3W31 A;  2FQ9 A;  3OF8 A;  2DCC A;  5PAD A;  1MS6 A;  1BGO A;  5CVN B;  2DOS A;  1NB3 A;  1PIP A;  2DCB A;  4I07 A;  3BB7 A;  3PW3 A;  4I04 A;  1YT7 A;  1TLO A;  3IHP A;  3PT2 A;  1PE6 A;  3IMA A;  1MDW A;  5E6J A;  4YV8 A;  1PCI A;  2P86 A;  2JTC A;  3P5V A;  3ZUA A;  3AI8 A;  4BOP A;  2BTW A;  5EZQ A;  1QXP A;  2FRA A;  2F1G A;  1TL9 A;  2NQA A;  3O0U A;  1QMY A;  4OVZ A;  4RKX A;  5CVM A;  2OZ2 A;  3P5W A;  3USV A;  2R9O A;  3TNX A;  4YYQ A;  1S4V A;  2B1M A;  4QRV A;  2B1N A;  2YJ2 A;  2AUX A;  3K24 A;  2O6X A;  4D8E A;  3BY4 A;  4XUI A;  1PBH A;  4MI7 A;  4MZS A;  1ICF A;  3CBK A;  3IOQ A;  4RF0 A;  2NQG A;  3V6C A;  2WBF X;  4RF1 A;  3QSD A;  2GFO A;  3S3R A;  2F7D A;  2NQI A;  1CQD A;  3S3Q A;  1AU4 A;  2OUL A;  1CPJ A;  3K9M A;  3I06 A;  2DJG B;  3KWZ A;  4AXM A;  2JRI A;  3MJ5 A;  3QT4 A;  4G54 A;  4OW0 A;  1XKG A;  3PHU A;  3P5X A;  2IPP B;  1Y4H A;  1U5I A;  3PNR A;  2BDL A;  2DC6 A;  2PBH A;  2FUD A;  1NB5 A;  1KFU L;  4KLB A;  2G8E A;  5EGW A;  2DZZ A;  1U9X A;  4PP1 A;  4YYS A;  2XU3 A;  2VHS A;  4RNA A;  4W5B A;  4HXD B;  1EWP A;  1AU3 A;  2YJB A;  3B21 A;  3E9S A;  8PCH A;  1STF E;  2E03 A;  4CDC B;  3CBJ A;  1GEC E;  4YVA A;  4N79 A;  3HWN A;  2DCA A;  2AGA A;  4FJC A;  1MEG A;  3OVX A;  4IUM A;  2J7Q C;  1AEC A;  2AVW A;  4I05 A;  2BU3 A;  1HUC B;  1AU2 A;  3LFY A;  4QH6 A;  1O0E A;  4IP3 A;  1CJL A;  1MHW A; 
#chains in the Genus database with same CATH homology
 2IBI A;  3LXS A;  2JQG R;  5J94 A;  3OVZ A;  1AYV A;  1YAL A;  3N3G A;  3ERV A;  2YJ8 A;  4MSX A;  2C0Y A;  2P0R A;  2FT2 A;  3MOR A;  3KWB X;  4OEL A;  2ACT A;  4YYW A;  2R6N A;  1PPO A;  4PP2 E;  1SP4 B;  2BDZ A;  3MHS A;  2AS8 A;  1YK7 A;  1AU0 A;  1M6D A;  3PBH A;  3WXE A;  5F02 A;  4CDE B;  2AYN A;  4B55 A;  2H7J A;  1MIR A;  4YYU A;  1NL6 A;  2FO5 A;  4P6E A;  5JA7 A;  2G7Y A;  3CH3 X;  4W4U A;  5CHV A;  4RY2 A;  2R9F A;  3V6E A;  2BSZ A;  3BPF A;  2E02 A;  4PI3 A;  4XR7 A;  4WA6 A;  1W6F A;  2DC8 A;  1GLO A;  1A6R A;  1W4T A;  2Y6E A;  2AU1 A;  3HHI A;  3O1G A;  3OF9 A;  1VJV A;  1GX3 A;  3H7D A;  4BSQ A;  1KHQ A;  1Y08 A;  3KX1 A;  1AIM A;  3MHH A;  2DC7 A;  3I3T A;  3C9E A;  2GHU A;  3BC3 A;  1NLJ A;  4MZO A;  1F2C A;  1BY8 A;  1PAD A;  1Q6K A;  4QBB A;  2VHF A;  1THE A;  1JQP A;  4BPV A;  4CZW A;  3KFQ A;  1TU6 A;  4W5C A;  1KXR A;  4AXL A;  4N4Z A;  4OEM A;  2FYE A;  1PPD A;  2R9N A;  2R9C A;  1F29 A;  4X6J A;  3D9W A;  3HHA A;  4YYR A;  2HHN A;  1PPP A;  3QJ3 A;  3BOW A;  3GCB A;  3PDF A;  2CB5 A;  3H89 A;  2R9M A;  2Y5B A;  3BPM A;  3D6S A;  4Q8G A;  5CVO B;  1U9V A;  2OP3 A;  1CV8 A;  1ATK A;  4QRX A;  3KSE A;  1GCB A;  4C5P A;  1CTE A;  2DCD A;  2YJC A;  1CS8 A;  3OIS A;  2E00 A;  1GMY A;  4DMX A;  4X6I A;  2CIO A;  2FTD A;  2FRQ A;  1CB5 A;  1PPN A;  1BP4 A;  4HWY A;  3KW9 A;  2DJF B;  3N3K A;  1POP A;  7PCK A;  5EF4 A;  3IEJ A;  1X9Y A;  3F75 A;  3M99 A;  4X6H A;  4CDD B;  2HXZ A;  4Q8H A;  3RVW A;  4K7C A;  2ATO A;  3N4C A;  3P5U A;  1YVB A;  4FIP A;  1NQC A;  3U8E A;  2AIM A;  4P6G A;  2PAD A;  5FPW A;  2PRE A;  4YYV A;  2ARY A;  3BCN A;  3KKU A;  4BS6 A;  3H6S A;  1AYW A;  3K8U A;  2JQF R;  3B79 A;  1IWD A;  6PAD A;  2XU1 A;  1ME4 A;  1AYU A;  1PXV A;  3NHE A;  1QDQ A;  3DF0 A;  1KFX L;  2HD5 A;  1YK8 A;  2XU5 A;  4PAD A;  1F2A A;  3RVV A;  2HH5 A;  3E1Z B;  1QOL A;  5A24 A;  4FK5 A;  2G6D A;  1SNK A;  3H8C A;  4BS5 A;  3LTW A;  1ZIV A;  2AUZ A;  1FH0 A;  4ZUX U;  1DF0 A;  1EF7 A;  1EWM A;  3RVX A;  2AYO A;  1CVZ A;  2DC9 A;  1ZCM A;  9PAP A;  2YJ9 A;  1KHP A;  1MEM A;  4N8W A;  1K3B B;  4DMY A;  3BWK A;  1U9W A;  2XU4 A;  2G8J A;  4BGF A;  4QRG A;  5JH3 A;  4GUZ A;  1CSB B;  5K16 A;  3WXF A;  2NQD B;  1EWO A;  3CH2 X;  1VSN A;  1F2B A;  1U9Q X;  2E01 A;  1BQI A;  2PNS A;  1DEU A;  1ME3 A;  3HD3 A;  2P7U A;  5CHT A;  3WXG A;  1ITO A;  1NPZ A;  3H8B A;  4BQV A;  3IUT A;  3F5V A;  3IV2 A;  4CDF B;  2DZY A;  3MTN A;  1EWL A;  2FQ9 A;  2VFC A;  3OF8 A;  4NV8 A;  2DCC A;  5PAD A;  1MS6 A;  1BGO A;  5CVN B;  1NB3 A;  1PIP A;  2DCB A;  4I07 A;  3PW3 A;  4I04 A;  1YT7 A;  1TLO A;  3IHP A;  1PE6 A;  2VFB A;  1E2T A;  3IMA A;  1MDW A;  4YV8 A;  1PCI A;  2P86 A;  3P5V A;  3ZUA A;  3AI8 A;  1QXP A;  2FRA A;  2F1G A;  1TL9 A;  2NQA A;  3O0U A;  1QMY A;  5CVM A;  2OZ2 A;  3P5W A;  3USV A;  2R9O A;  3TNX A;  4YYQ A;  1S4V A;  2B1M A;  4QRV A;  2B1N A;  2YJ2 A;  2AUX A;  3K24 A;  2O6X A;  4XUI A;  1PBH A;  4MZS A;  1ICF A;  3CBK A;  3IOQ A;  2NQG A;  3V6C A;  2WBF X;  3QSD A;  2GFO A;  3S3R A;  2F7D A;  2NQI A;  1CQD A;  3S3Q A;  1AU4 A;  2OUL A;  1CPJ A;  3K9M A;  3I06 A;  2DJG B;  3KWZ A;  4AXM A;  3QT4 A;  4G54 A;  1XKG A;  3P5X A;  2IPP B;  1Y4H A;  1U5I A;  1W5R A;  3PNR A;  2BDL A;  2DC6 A;  2PBH A;  2FUD A;  1NB5 A;  1KFU L;  4KLB A;  2G8E A;  5EGW A;  2DZZ A;  1U9X A;  4PP1 A;  4YYS A;  2XU3 A;  2VHS A;  4W5B A;  1EWP A;  1AU3 A;  2YJB A;  8PCH A;  1STF E;  2E03 A;  4CDC B;  3CBJ A;  1GEC E;  4YVA A;  4N79 A;  3HWN A;  4NV7 A;  2DCA A;  4FJC A;  1MEG A;  3OVX A;  1AEC A;  2AVW A;  4I05 A;  1HUC B;  1AU2 A;  3LFY A;  4QH6 A;  1O0E A;  1CJL A;  1MHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...