4MZOA

Mouse cathepsin s with covalent ligand (3s,4s)-n-[(2e)-2-iminoethyl]-4-(morpholin-4-ylcarbonyl)-1-(phenylsulfonyl)pyrrolidine-3-carboxamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Identification of potent and selective cathepsin S inhibitors containing different central cyclic scaffolds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4mzoA00
3MHSA 1MEMA 4BS6A 4RY2A 3MHHA 2AYOA 1F2AA 1KHPA 4CZWA 4WA6A 1VJVA 1AYWA 2DC8A 3F75A 4YYSA 1FH0A 4HWYA 2F1GA 3AI8A 2BDLA 1TL9A 1IWDA 3CH3X 4N8WA 1CTEA 2XU1A 1PPPA 3B79A 1XKGA 2DC7A 4CDCB 3PNRA 1A6RA 2G6DA 4DMXA 5CVNB 1DEUA 1BGOA 5CVOB 3K9MA 4BQVA 5PADA 2B1MA 3KKUA 3P5WA 5EF4A 1U9QX 4MZSA 3H89A 1ATKA 4PP1A 2G8JA 2HH5A 4OELA 3BCNA 2DC9A 5CHTA 3IMAA 3P5UA 2E00A 1JQPA 3RVVA 1SNKA 4X6IA 2Y6EA 3PW3A 1BY8A 1CSBB 1U9VA 4K7CA 3P5VA 3BPMA 2DJFB 2CIOA 3KW9A 4QRXA 3N3KA 1YK8A 4BPVA 4XUIA 4ZUXU 3HWNA 1NL6A 1NQCA 4X6JA 3HHIA 1ME3A 3IHPA 1YT7A 5K16A 2DJGB 2GHUA 4W4UA 3KWBX 2VHSA 2YJ2A 2FRQA 2AIMA 1BP4A 4N4ZA 4PI3A 3ZUAA 2XU4A 1PCIA 1AYVA 1SP4B 4CDFB 3H8CA 4XR7A 1MS6A 3S3QA 1ZCMA 2JQGR 4Q8HA 4YYVA 4YYRA 1MHWA 3I06A 9PAPA 3WXFA 1GLOA 4CDEB 2E02A 2E03A 1THEA 2FUDA 1HUCB 1ZIVA 3H6SA 4DMYA 4N79A 3QSDA 2B1NA 1EF7A 2AUXA 1GECE 3IEJA 3K24A 3HD3A 1CS8A 1MIRA 2G7YA 5EGWA 2HD5A 4KLBA 1NPZA 2NQIA 3PBHA 3F5VA 4CDDB 1EWOA 1NLJA 1CPJA 1PBHA 7PCKA 2NQDB 4PADA 1YALA 3IV2A 1GMYA 3IUTA 4MSXA 2ATOA 1PPDA 1PPNA 2FTDA 2DC6A 3U8EA 2WBFX 5F02A 3K8UA 1QXPA 3OF8A 1MDWA 1KXRA 2XU3A 2BDZA 2F7DA 3KSEA 6PADA 2JQFR 2G8EA 3V6CA 2DZZA 2OULA 1EWPA 1PIPA 5JA7A 2PNSA 3QT4A 4YV8A 2FRAA 3KFQA 1NB5A 2P7UA 2CB5A 2PBHA 5JH3A 5CVMA 4W5BA 4AXMA 3RVWA 3KWZA 1U9WA 1TLOA 3BPFA 2HXZA 2FT2A 4AXLA 4X6HA 2AUZA 1NB3A 3MTNA 1ICFA 4YYWA 2YJBA 4QBBA 3CBJA 2AU1A 4I04A 5J94A 1S4VA 8PCHA 3MORA 1Y08A 2YJCA 3OF9A 1CVZA 2R9FA 2VHFA 2FYEA 3WXGA 3E1ZB 1CJLA 3H8BA 2R9OA 1PXVA 1KFUL 3BC3A 5FPWA 2HHNA 2AYNA 3IOQA 5A24A 3OVZA 2R9NA 4YVAA 3WXEA 2DCCA 1ITOA 1M6DA 1U9XA 1POPA 2AS8A 1QOLA 1AYUA 4G54A 4W5CA 1GCBA 1CB5A 1ME4A 2C0YA 1EWMA 2DZYA 3CBKA 2ARYA 2YJ9A 3NHEA 3QJ3A 1Y4HA 3HHAA 3O1GA 2IBIA 2NQAA 3H7DA 1K3BB 2PREA 4FIPA 2R9CA 3S3RA 2XU5A 3KX1A 3I3TA 1BQIA 1QMYA 1YK7A 1AU3A 1DF0A 3CH2X 1PE6A 2GFOA 4MZOA 3RVXA 4P6EA 3LXSA 4OEMA 2P0RA 2H7JA 1AU0A 1CV8A 2FO5A 2Y5BA 3GCBA 3C9EA 3D6SA 3ERVA 3N4CA 4PP2E 3DF0A 3PDFA 4I07A 1VSNA 4BS5A 2P86A 3M99A 1U5IA 3BOWA 1AECA 3N3GA 2AVWA 4I05A 1KHQA 1X9YA 1EWLA 1AU2A 3P5XA 1PADA 1TU6A 3O0UA 2O6XA 2R9MA 3LFYA 2YJ8A 5CHVA 1MEGA 4QRGA 4YYUA 2E01A 3USVA 1Q6KA 2OP3A 4BSQA 4YYQA 1AU4A 2ACTA 2DCAA 2OZ2A 2DCBA 3BWKA 2NQGA 2DCDA 1F29A 4P6GA 2PADA 3OISA 3OVXA 3TNXA 2FQ9A 3V6EA 1YVBA 2R6NA 2IPPB 4QH6A 1F2BA 4FJCA 1F2CA 1STFE 1AIMA 1CQDA 1QDQA 1PPOA 1O0EA 1KFXL 4FK5A 4Q8GA 4QRVA
chains in the Genus database with same CATH superfamily
3MHSA 1MEMA 3ZNHA 4BS6A 4RY2A 3BY4A 3MHHA 2AYOA 1F2AA 1KHPA 4CZWA 4WA6A 1VJVA 1AYWA 2DC8A 3F75A 3C0RA 4YYSA 1FH0A 4HWYA 2F1GA 3AI8A 2BTWB 2BDLA 1TL9A 1IWDA 3CH3X 4N8WA 4OVZB 1CTEA 2XU1A 1PPPA 3B79A 1XKGA 2DC7A 4CDCB 4GUAA 3PNRA 1A6RA 2G6DA 4DMXA 5CVNB 1DEUA 1BGOA 2DOSA 5KO3A 5CVOB 3K9MA 4BQVA 5PADA 2B1MA 3MJ5A 2AGAA 3KKUA 3P5WA 5EF4A 1U9QX 3BBAA 4MZSA 4D8BA 3H89A 1ATKA 4PP1A 2G8JA 2HH5A 4OELA 4PT5A 3MTVA 3BCNA 2DC9A 5CHTA 3IMAA 3P5UA 2E00A 1JQPA 3RVVA 1SNKA 4X6IA 2Y6EA 5JZEA 3PW3A 3BB7A 1BY8A 1PVJA 1CSBB 1U9VA 4HXDB 4K7CA 3P5VA 3BPMA 2DJFB 2CIOA 3KW9A 4QRXA 3N3KA 1YK8A 4BPVA 4XUIA 4ZUXU 4OVZA 3HWNA 1NL6A 1NQCA 4X6JA 3HHIA 1ME3A 3IHPA 1YT7A 5K16A 2DJGB 2GHUA 4W4UA 3KWBX 2VHSA 1YZBA 2BU3A 2YJ2A 2FRQA 2AIMA 1BP4A 2UZJA 4N4ZA 4PI3A 3ZUAA 2XU4A 1PCIA 1AYVA 1SP4B 4CDFB 3H8CA 4XR7A 1MS6A 3S3QA 1ZCMA 2JQGR 4Q8HA 4YYVA 4YYRA 1MHWA 3I06A 9PAPA 3WXFA 1GLOA 4CDEB 2E02A 2E03A 1THEA 2FUDA 1HUCB 1ZIVA 3H6SA 4DMYA 4N79A 3QSDA 3PHXA 2B1NA 1EF7A 2AUXA 3TRKA 1GECE 3IEJA 3K24A 3HD3A 1CS8A 1MIRA 3E9SA 2G7YA 5EGWA 2HD5A 4KLBA 1NPZA 2NQIA 3RNVA 3PBHA 3F5VA 4CDDB 1EWOA 1NLJA 1CPJA 1PBHA 3TMPA 7PCKA 2NQDB 2J7QA 5EZQA 4PADA 1YALA 4M0WA 3IV2A 1GMYA 4XZXA 3IUTA 4MSXA 2ATOA 4BOZA 1PPDA 1PPNA 2FTDA 4OW0A 4D8EA 2DC6A 3U8EA 2WBFX 5F02A 3K8UA 1QXPA 3OF8A 1MDWA 1KXRA 2XU3A 2BDZA 2F7DA 3KSEA 4ZTBA 6PADA 2JQFR 2G8EA 3V6CA 2DZZA 2OULA 1EWPA 3OQCA 2Z84A 1PIPA 5JA7A 4RNAA 4R3DA 4BOQA 2PNSA 3QT4A 3PRMA 4YV8A 2FRAA 3PSEA 3KFQA 1NB5A 2P7UA 2CB5A 2PBHA 5JH3A 5CVMA 4W5BA 4AXMA 3RVWA 4MI7A 3KWZA 1U9WA 1TLOA 3BPFA 2HXZA 2FT2A 4AXLA 4X6HA 4P16A 2AUZA 1NB3A 3MTNA 1ICFA 4YYWA 2YJBA 3PRPA 2JTCA 4QBBA 3CBJA 2AU1A 4I04A 5J94A 1S4VA 2JRIA 8PCHA 3B21A 3MORA 1Y08A 2YJCA 3IFUA 3OF9A 1CVZA 2R9FA 2VHFA 2FYEA 3WXGA 3E1ZB 1CJLA 3H8BA 2R9OA 1PXVA 1KFUL 3BC3A 5FPWA 2HHNA 2AYNA 3MP2A 3IOQA 5A24A 3OVZA 2R9NA 4YVAA 3WXEA 2DCCA 1ITOA 1M6DA 5E6JA 4D8IA 1U9XA 3PHUA 1POPA 2AS8A 1QOLA 3W30A 1AYUA 4G54A 4W5CA 1GCBA 1CB5A 1ME4A 2C0YA 1DKIA 1EWMA 2DZYA 3CBKA 3PT2A 4RF0A 5EZSA 2ARYA 2YJ9A 3NHEA 3QJ3A 1Y4HA 3HHAA 3O1GA 2IBIA 2NQAA 3H7DA 1K3BB 2PREA 4FIPA 2R9CA 3S3RA 2XU5A 3KX1A 3I3TA 1BQIA 1QMYA 1YK7A 1AU3A 1DF0A 3CH2X 4WURA 1PE6A 2GFOA 4MZOA 3RVXA 4P6EA 3LXSA 4OEMA 2FE8A 2P0RA 2H7JA 4RF1A 4RKXA 1AU0A 1CV8A 3PHWA 4IUMA 2FO5A 2Y5BA 3GCBA 3C9EA 3O65A 3D6SA 3ERVA 3N4CA 4PP2E 3DF0A 3PDFA 4I07A 1VSNA 4BS5A 2HWKA 2P86A 3M99A 1U5IA 3BOWA 1AECA 3N3GA 2AVWA 4I05A 1KHQA 1X9YA 1EWLA 1AU2A 2BTWA 3P5XA 1PADA 1TU6A 3O0UA 2O6XA 2R9MA 4BOPA 4REZA 3LFYA 3W31A 2YJ8A 5CHVA 1MEGA 4QRGA 4YYUA 2E01A 3USVA 1Q6KA 2OP3A 2J7QC 4MM3B 4BSQA 4YYQA 1AU4A 2ACTA 4A5UA 2DCAA 2OZ2A 2DCBA 3BWKA 4IP3A 2NQGA 2DCDA 1F29A 4P6GA 2PADA 3OISA 4BOSA 3OVXA 3TNXA 2FQ9A 1UKFA 3V6EA 1YVBA 2R6NA 2IPPB 4QH6A 1F2BA 4FJCA 1F2CA 1STFE 1AIMA 1CQDA 1QDQA 4BOUA 1PPOA 1O0EA 1KFXL 4FK5A 4Q8GA 4QRVA
chains in the Genus database with same CATH topology
3MHSA 1MEMA 4BS6A 4RY2A 3MHHA 2AYOA 1F2AA 1KHPA 4CZWA 4WA6A 1VJVA 1AYWA 2DC8A 3F75A 4YYSA 1FH0A 4HWYA 2F1GA 3AI8A 2BDLA 1TL9A 1IWDA 3CH3X 4N8WA 1CTEA 2XU1A 1PPPA 3B79A 1XKGA 2DC7A 4CDCB 1GX3A 3PNRA 1A6RA 2G6DA 4DMXA 5CVNB 1DEUA 1BGOA 5CVOB 3K9MA 4BQVA 5PADA 2B1MA 3KKUA 2VFCA 3P5WA 5EF4A 1U9QX 4MZSA 3H89A 1ATKA 4PP1A 2G8JA 2HH5A 4OELA 3BCNA 2DC9A 5CHTA 3IMAA 3P5UA 2E00A 1JQPA 3RVVA 4C5PA 1SNKA 4X6IA 2Y6EA 3PW3A 1BY8A 1CSBB 1U9VA 4K7CA 3P5VA 3BPMA 2DJFB 2CIOA 3KW9A 4QRXA 3N3KA 1YK8A 4BPVA 4XUIA 4ZUXU 3HWNA 1NL6A 1NQCA 4X6JA 3HHIA 1ME3A 3IHPA 1YT7A 5K16A 2DJGB 2GHUA 4W4UA 3KWBX 2VHSA 2YJ2A 2FRQA 2AIMA 1BP4A 4N4ZA 4PI3A 3ZUAA 2XU4A 1PCIA 1AYVA 1SP4B 4CDFB 3H8CA 4XR7A 1MS6A 3S3QA 1ZCMA 2JQGR 4Q8HA 4YYVA 4YYRA 1MHWA 3I06A 9PAPA 3WXFA 1GLOA 4CDEB 2E02A 2E03A 1THEA 2FUDA 1HUCB 1ZIVA 3H6SA 4DMYA 4N79A 3QSDA 2B1NA 1EF7A 2AUXA 1GECE 3IEJA 3K24A 3HD3A 1CS8A 1MIRA 2G7YA 5EGWA 2HD5A 4KLBA 1NPZA 4GUZA 2NQIA 3PBHA 3F5VA 4CDDB 1EWOA 1NLJA 3D9WA 1CPJA 1PBHA 7PCKA 2NQDB 4PADA 1YALA 3IV2A 1GMYA 3IUTA 4MSXA 2ATOA 1PPDA 1PPNA 2FTDA 2DC6A 3U8EA 2WBFX 5F02A 3K8UA 1QXPA 3OF8A 1MDWA 1KXRA 2XU3A 1W4TA 2BDZA 2F7DA 3KSEA 6PADA 2JQFR 2G8EA 3V6CA 2DZZA 2OULA 1EWPA 1PIPA 5JA7A 2PNSA 3QT4A 4YV8A 2FRAA 3KFQA 1NB5A 2P7UA 2CB5A 2PBHA 5JH3A 5CVMA 4W5BA 4AXMA 3RVWA 3KWZA 1U9WA 1TLOA 3BPFA 1W5RA 2HXZA 2FT2A 4AXLA 4X6HA 2AUZA 1E2TA 1NB3A 3MTNA 1ICFA 4YYWA 2YJBA 4QBBA 3CBJA 2AU1A 4I04A 5J94A 1S4VA 8PCHA 3MORA 1Y08A 2YJCA 3OF9A 1CVZA 2R9FA 2VHFA 2FYEA 3WXGA 3E1ZB 1CJLA 3H8BA 2R9OA 1PXVA 1KFUL 3BC3A 5FPWA 2HHNA 2AYNA 3IOQA 5A24A 3OVZA 2R9NA 4YVAA 3WXEA 4B55A 2DCCA 1ITOA 1M6DA 1U9XA 1POPA 2AS8A 1QOLA 1AYUA 4G54A 4W5CA 1GCBA 1CB5A 1ME4A 2C0YA 2BSZA 1EWMA 2DZYA 3CBKA 2ARYA 2YJ9A 3NHEA 3QJ3A 1Y4HA 3HHAA 3O1GA 2IBIA 2NQAA 3H7DA 1K3BB 2PREA 4FIPA 2R9CA 3S3RA 2XU5A 3KX1A 3I3TA 1BQIA 4NV7A 1QMYA 1YK7A 1AU3A 1DF0A 3CH2X 1PE6A 2GFOA 4MZOA 4NV8A 3RVXA 4P6EA 3LXSA 4OEMA 2P0RA 2H7JA 1AU0A 1CV8A 2FO5A 2Y5BA 3GCBA 3C9EA 3D6SA 3ERVA 3N4CA 4PP2E 3DF0A 3PDFA 4I07A 1VSNA 4BS5A 3LTWA 2P86A 3M99A 1U5IA 3BOWA 1AECA 3N3GA 2AVWA 4I05A 1KHQA 1X9YA 1EWLA 1AU2A 3P5XA 1PADA 1TU6A 3O0UA 2O6XA 2R9MA 3LFYA 2YJ8A 5CHVA 1MEGA 4QRGA 4YYUA 1W6FA 2E01A 3USVA 1Q6KA 2OP3A 4BSQA 4YYQA 1AU4A 2ACTA 2DCAA 2OZ2A 4BGFA 2DCBA 3BWKA 2NQGA 2DCDA 1F29A 4P6GA 2PADA 3OISA 3OVXA 3TNXA 2FQ9A 3V6EA 1YVBA 2R6NA 2IPPB 4QH6A 1F2BA 4FJCA 1F2CA 1STFE 1AIMA 1CQDA 1QDQA 1PPOA 1O0EA 1KFXL 4FK5A 4Q8GA 2VFBA 4QRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS A;  1MEM A;  4BS6 A;  4RY2 A;  3MHH A;  2AYO A;  1F2A A;  1KHP A;  4CZW A;  4WA6 A;  1VJV A;  1AYW A;  2DC8 A;  3F75 A;  4YYS A;  1FH0 A;  4HWY A;  2F1G A;  3AI8 A;  2BDL A;  1TL9 A;  1IWD A;  3CH3 X;  4N8W A;  1CTE A;  2XU1 A;  1PPP A;  3B79 A;  1XKG A;  2DC7 A;  4CDC B;  3PNR A;  1A6R A;  2G6D A;  4DMX A;  5CVN B;  1DEU A;  1BGO A;  5CVO B;  3K9M A;  4BQV A;  5PAD A;  2B1M A;  3KKU A;  3P5W A;  5EF4 A;  1U9Q X;  4MZS A;  3H89 A;  1ATK A;  4PP1 A;  2G8J A;  2HH5 A;  4OEL A;  3BCN A;  2DC9 A;  5CHT A;  3IMA A;  3P5U A;  2E00 A;  1JQP A;  3RVV A;  1SNK A;  4X6I A;  2Y6E A;  3PW3 A;  1BY8 A;  1CSB B;  1U9V A;  4K7C A;  3P5V A;  3BPM A;  2DJF B;  2CIO A;  3KW9 A;  4QRX A;  3N3K A;  1YK8 A;  4BPV A;  4XUI A;  4ZUX U;  3HWN A;  1NL6 A;  1NQC A;  4X6J A;  3HHI A;  1ME3 A;  3IHP A;  1YT7 A;  5K16 A;  2DJG B;  2GHU A;  4W4U A;  3KWB X;  2VHS A;  2YJ2 A;  2FRQ A;  2AIM A;  1BP4 A;  4N4Z A;  4PI3 A;  3ZUA A;  2XU4 A;  1PCI A;  1AYV A;  1SP4 B;  4CDF B;  3H8C A;  4XR7 A;  1MS6 A;  3S3Q A;  1ZCM A;  2JQG R;  4Q8H A;  4YYV A;  4YYR A;  1MHW A;  3I06 A;  9PAP A;  3WXF A;  1GLO A;  4CDE B;  2E02 A;  2E03 A;  1THE A;  2FUD A;  1HUC B;  1ZIV A;  3H6S A;  4DMY A;  4N79 A;  3QSD A;  2B1N A;  1EF7 A;  2AUX A;  1GEC E;  3IEJ A;  3K24 A;  3HD3 A;  1CS8 A;  1MIR A;  2G7Y A;  5EGW A;  2HD5 A;  4KLB A;  1NPZ A;  2NQI A;  3PBH A;  3F5V A;  4CDD B;  1EWO A;  1NLJ A;  1CPJ A;  1PBH A;  7PCK A;  2NQD B;  4PAD A;  1YAL A;  3IV2 A;  1GMY A;  3IUT A;  4MSX A;  2ATO A;  1PPD A;  1PPN A;  2FTD A;  2DC6 A;  3U8E A;  2WBF X;  5F02 A;  3K8U A;  1QXP A;  3OF8 A;  1MDW A;  1KXR A;  2XU3 A;  2BDZ A;  2F7D A;  3KSE A;  6PAD A;  2JQF R;  2G8E A;  3V6C A;  2DZZ A;  2OUL A;  1EWP A;  1PIP A;  5JA7 A;  2PNS A;  3QT4 A;  4YV8 A;  2FRA A;  3KFQ A;  1NB5 A;  2P7U A;  2CB5 A;  2PBH A;  5JH3 A;  5CVM A;  4W5B A;  4AXM A;  3RVW A;  3KWZ A;  1U9W A;  1TLO A;  3BPF A;  2HXZ A;  2FT2 A;  4AXL A;  4X6H A;  2AUZ A;  1NB3 A;  3MTN A;  1ICF A;  4YYW A;  2YJB A;  4QBB A;  3CBJ A;  2AU1 A;  4I04 A;  5J94 A;  1S4V A;  8PCH A;  3MOR A;  1Y08 A;  2YJC A;  3OF9 A;  1CVZ A;  2R9F A;  2VHF A;  2FYE A;  3WXG A;  3E1Z B;  1CJL A;  3H8B A;  2R9O A;  1PXV A;  1KFU L;  3BC3 A;  5FPW A;  2HHN A;  2AYN A;  3IOQ A;  5A24 A;  3OVZ A;  2R9N A;  4YVA A;  3WXE A;  2DCC A;  1ITO A;  1M6D A;  1U9X A;  1POP A;  2AS8 A;  1QOL A;  1AYU A;  4G54 A;  4W5C A;  1GCB A;  1CB5 A;  1ME4 A;  2C0Y A;  1EWM A;  2DZY A;  3CBK A;  2ARY A;  2YJ9 A;  3NHE A;  3QJ3 A;  1Y4H A;  3HHA A;  3O1G A;  2IBI A;  2NQA A;  3H7D A;  1K3B B;  2PRE A;  4FIP A;  2R9C A;  3S3R A;  2XU5 A;  3KX1 A;  3I3T A;  1BQI A;  1QMY A;  1YK7 A;  1AU3 A;  1DF0 A;  3CH2 X;  1PE6 A;  2GFO A;  4MZO A;  3RVX A;  4P6E A;  3LXS A;  4OEM A;  2P0R A;  2H7J A;  1AU0 A;  1CV8 A;  2FO5 A;  2Y5B A;  3GCB A;  3C9E A;  3D6S A;  3ERV A;  3N4C A;  4PP2 E;  3DF0 A;  3PDF A;  4I07 A;  1VSN A;  4BS5 A;  2P86 A;  3M99 A;  1U5I A;  3BOW A;  1AEC A;  3N3G A;  2AVW A;  4I05 A;  1KHQ A;  1X9Y A;  1EWL A;  1AU2 A;  3P5X A;  1PAD A;  1TU6 A;  3O0U A;  2O6X A;  2R9M A;  3LFY A;  2YJ8 A;  5CHV A;  1MEG A;  4QRG A;  4YYU A;  2E01 A;  3USV A;  1Q6K A;  2OP3 A;  4BSQ A;  4YYQ A;  1AU4 A;  2ACT A;  2DCA A;  2OZ2 A;  2DCB A;  3BWK A;  2NQG A;  2DCD A;  1F29 A;  4P6G A;  2PAD A;  3OIS A;  3OVX A;  3TNX A;  2FQ9 A;  3V6E A;  1YVB A;  2R6N A;  2IPP B;  4QH6 A;  1F2B A;  4FJC A;  1F2C A;  1STF E;  1AIM A;  1CQD A;  1QDQ A;  1PPO A;  1O0E A;  1KFX L;  4FK5 A;  4Q8G A;  4QRV A; 
#chains in the Genus database with same CATH topology
 3MHS A;  1MEM A;  3ZNH A;  4BS6 A;  4RY2 A;  3BY4 A;  3MHH A;  2AYO A;  1F2A A;  1KHP A;  4CZW A;  4WA6 A;  1VJV A;  1AYW A;  2DC8 A;  3F75 A;  3C0R A;  4YYS A;  1FH0 A;  4HWY A;  2F1G A;  3AI8 A;  2BTW B;  2BDL A;  1TL9 A;  1IWD A;  3CH3 X;  4N8W A;  4OVZ B;  1CTE A;  2XU1 A;  1PPP A;  3B79 A;  1XKG A;  2DC7 A;  4CDC B;  4GUA A;  3PNR A;  1A6R A;  2G6D A;  4DMX A;  5CVN B;  1DEU A;  1BGO A;  2DOS A;  5KO3 A;  5CVO B;  3K9M A;  4BQV A;  5PAD A;  2B1M A;  3MJ5 A;  2AGA A;  3KKU A;  3P5W A;  5EF4 A;  1U9Q X;  3BBA A;  4MZS A;  4D8B A;  3H89 A;  1ATK A;  4PP1 A;  2G8J A;  2HH5 A;  4OEL A;  4PT5 A;  3MTV A;  3BCN A;  2DC9 A;  5CHT A;  3IMA A;  3P5U A;  2E00 A;  1JQP A;  3RVV A;  1SNK A;  4X6I A;  2Y6E A;  5JZE A;  3PW3 A;  3BB7 A;  1BY8 A;  1PVJ A;  1CSB B;  1U9V A;  4HXD B;  4K7C A;  3P5V A;  3BPM A;  2DJF B;  2CIO A;  3KW9 A;  4QRX A;  3N3K A;  1YK8 A;  4BPV A;  4XUI A;  4ZUX U;  4OVZ A;  3HWN A;  1NL6 A;  1NQC A;  4X6J A;  3HHI A;  1ME3 A;  3IHP A;  1YT7 A;  5K16 A;  2DJG B;  2GHU A;  4W4U A;  3KWB X;  2VHS A;  1YZB A;  2BU3 A;  2YJ2 A;  2FRQ A;  2AIM A;  1BP4 A;  2UZJ A;  4N4Z A;  4PI3 A;  3ZUA A;  2XU4 A;  1PCI A;  1AYV A;  1SP4 B;  4CDF B;  3H8C A;  4XR7 A;  1MS6 A;  3S3Q A;  1ZCM A;  2JQG R;  4Q8H A;  4YYV A;  4YYR A;  1MHW A;  3I06 A;  9PAP A;  3WXF A;  1GLO A;  4CDE B;  2E02 A;  2E03 A;  1THE A;  2FUD A;  1HUC B;  1ZIV A;  3H6S A;  4DMY A;  4N79 A;  3QSD A;  3PHX A;  2B1N A;  1EF7 A;  2AUX A;  3TRK A;  1GEC E;  3IEJ A;  3K24 A;  3HD3 A;  1CS8 A;  1MIR A;  3E9S A;  2G7Y A;  5EGW A;  2HD5 A;  4KLB A;  1NPZ A;  2NQI A;  3RNV A;  3PBH A;  3F5V A;  4CDD B;  1EWO A;  1NLJ A;  1CPJ A;  1PBH A;  3TMP A;  7PCK A;  2NQD B;  2J7Q A;  5EZQ A;  4PAD A;  1YAL A;  4M0W A;  3IV2 A;  1GMY A;  4XZX A;  3IUT A;  4MSX A;  2ATO A;  4BOZ A;  1PPD A;  1PPN A;  2FTD A;  4OW0 A;  4D8E A;  2DC6 A;  3U8E A;  2WBF X;  5F02 A;  3K8U A;  1QXP A;  3OF8 A;  1MDW A;  1KXR A;  2XU3 A;  2BDZ A;  2F7D A;  3KSE A;  4ZTB A;  6PAD A;  2JQF R;  2G8E A;  3V6C A;  2DZZ A;  2OUL A;  1EWP A;  3OQC A;  2Z84 A;  1PIP A;  5JA7 A;  4RNA A;  4R3D A;  4BOQ A;  2PNS A;  3QT4 A;  3PRM A;  4YV8 A;  2FRA A;  3PSE A;  3KFQ A;  1NB5 A;  2P7U A;  2CB5 A;  2PBH A;  5JH3 A;  5CVM A;  4W5B A;  4AXM A;  3RVW A;  4MI7 A;  3KWZ A;  1U9W A;  1TLO A;  3BPF A;  2HXZ A;  2FT2 A;  4AXL A;  4X6H A;  4P16 A;  2AUZ A;  1NB3 A;  3MTN A;  1ICF A;  4YYW A;  2YJB A;  3PRP A;  2JTC A;  4QBB A;  3CBJ A;  2AU1 A;  4I04 A;  5J94 A;  1S4V A;  2JRI A;  8PCH A;  3B21 A;  3MOR A;  1Y08 A;  2YJC A;  3IFU A;  3OF9 A;  1CVZ A;  2R9F A;  2VHF A;  2FYE A;  3WXG A;  3E1Z B;  1CJL A;  3H8B A;  2R9O A;  1PXV A;  1KFU L;  3BC3 A;  5FPW A;  2HHN A;  2AYN A;  3MP2 A;  3IOQ A;  5A24 A;  3OVZ A;  2R9N A;  4YVA A;  3WXE A;  2DCC A;  1ITO A;  1M6D A;  5E6J A;  4D8I A;  1U9X A;  3PHU A;  1POP A;  2AS8 A;  1QOL A;  3W30 A;  1AYU A;  4G54 A;  4W5C A;  1GCB A;  1CB5 A;  1ME4 A;  2C0Y A;  1DKI A;  1EWM A;  2DZY A;  3CBK A;  3PT2 A;  4RF0 A;  5EZS A;  2ARY A;  2YJ9 A;  3NHE A;  3QJ3 A;  1Y4H A;  3HHA A;  3O1G A;  2IBI A;  2NQA A;  3H7D A;  1K3B B;  2PRE A;  4FIP A;  2R9C A;  3S3R A;  2XU5 A;  3KX1 A;  3I3T A;  1BQI A;  1QMY A;  1YK7 A;  1AU3 A;  1DF0 A;  3CH2 X;  4WUR A;  1PE6 A;  2GFO A;  4MZO A;  3RVX A;  4P6E A;  3LXS A;  4OEM A;  2FE8 A;  2P0R A;  2H7J A;  4RF1 A;  4RKX A;  1AU0 A;  1CV8 A;  3PHW A;  4IUM A;  2FO5 A;  2Y5B A;  3GCB A;  3C9E A;  3O65 A;  3D6S A;  3ERV A;  3N4C A;  4PP2 E;  3DF0 A;  3PDF A;  4I07 A;  1VSN A;  4BS5 A;  2HWK A;  2P86 A;  3M99 A;  1U5I A;  3BOW A;  1AEC A;  3N3G A;  2AVW A;  4I05 A;  1KHQ A;  1X9Y A;  1EWL A;  1AU2 A;  2BTW A;  3P5X A;  1PAD A;  1TU6 A;  3O0U A;  2O6X A;  2R9M A;  4BOP A;  4REZ A;  3LFY A;  3W31 A;  2YJ8 A;  5CHV A;  1MEG A;  4QRG A;  4YYU A;  2E01 A;  3USV A;  1Q6K A;  2OP3 A;  2J7Q C;  4MM3 B;  4BSQ A;  4YYQ A;  1AU4 A;  2ACT A;  4A5U A;  2DCA A;  2OZ2 A;  2DCB A;  3BWK A;  4IP3 A;  2NQG A;  2DCD A;  1F29 A;  4P6G A;  2PAD A;  3OIS A;  4BOS A;  3OVX A;  3TNX A;  2FQ9 A;  1UKF A;  3V6E A;  1YVB A;  2R6N A;  2IPP B;  4QH6 A;  1F2B A;  4FJC A;  1F2C A;  1STF E;  1AIM A;  1CQD A;  1QDQ A;  4BOU A;  1PPO A;  1O0E A;  1KFX L;  4FK5 A;  4Q8G A;  4QRV A; 
#chains in the Genus database with same CATH homology
 3MHS A;  1MEM A;  4BS6 A;  4RY2 A;  3MHH A;  2AYO A;  1F2A A;  1KHP A;  4CZW A;  4WA6 A;  1VJV A;  1AYW A;  2DC8 A;  3F75 A;  4YYS A;  1FH0 A;  4HWY A;  2F1G A;  3AI8 A;  2BDL A;  1TL9 A;  1IWD A;  3CH3 X;  4N8W A;  1CTE A;  2XU1 A;  1PPP A;  3B79 A;  1XKG A;  2DC7 A;  4CDC B;  1GX3 A;  3PNR A;  1A6R A;  2G6D A;  4DMX A;  5CVN B;  1DEU A;  1BGO A;  5CVO B;  3K9M A;  4BQV A;  5PAD A;  2B1M A;  3KKU A;  2VFC A;  3P5W A;  5EF4 A;  1U9Q X;  4MZS A;  3H89 A;  1ATK A;  4PP1 A;  2G8J A;  2HH5 A;  4OEL A;  3BCN A;  2DC9 A;  5CHT A;  3IMA A;  3P5U A;  2E00 A;  1JQP A;  3RVV A;  4C5P A;  1SNK A;  4X6I A;  2Y6E A;  3PW3 A;  1BY8 A;  1CSB B;  1U9V A;  4K7C A;  3P5V A;  3BPM A;  2DJF B;  2CIO A;  3KW9 A;  4QRX A;  3N3K A;  1YK8 A;  4BPV A;  4XUI A;  4ZUX U;  3HWN A;  1NL6 A;  1NQC A;  4X6J A;  3HHI A;  1ME3 A;  3IHP A;  1YT7 A;  5K16 A;  2DJG B;  2GHU A;  4W4U A;  3KWB X;  2VHS A;  2YJ2 A;  2FRQ A;  2AIM A;  1BP4 A;  4N4Z A;  4PI3 A;  3ZUA A;  2XU4 A;  1PCI A;  1AYV A;  1SP4 B;  4CDF B;  3H8C A;  4XR7 A;  1MS6 A;  3S3Q A;  1ZCM A;  2JQG R;  4Q8H A;  4YYV A;  4YYR A;  1MHW A;  3I06 A;  9PAP A;  3WXF A;  1GLO A;  4CDE B;  2E02 A;  2E03 A;  1THE A;  2FUD A;  1HUC B;  1ZIV A;  3H6S A;  4DMY A;  4N79 A;  3QSD A;  2B1N A;  1EF7 A;  2AUX A;  1GEC E;  3IEJ A;  3K24 A;  3HD3 A;  1CS8 A;  1MIR A;  2G7Y A;  5EGW A;  2HD5 A;  4KLB A;  1NPZ A;  4GUZ A;  2NQI A;  3PBH A;  3F5V A;  4CDD B;  1EWO A;  1NLJ A;  3D9W A;  1CPJ A;  1PBH A;  7PCK A;  2NQD B;  4PAD A;  1YAL A;  3IV2 A;  1GMY A;  3IUT A;  4MSX A;  2ATO A;  1PPD A;  1PPN A;  2FTD A;  2DC6 A;  3U8E A;  2WBF X;  5F02 A;  3K8U A;  1QXP A;  3OF8 A;  1MDW A;  1KXR A;  2XU3 A;  1W4T A;  2BDZ A;  2F7D A;  3KSE A;  6PAD A;  2JQF R;  2G8E A;  3V6C A;  2DZZ A;  2OUL A;  1EWP A;  1PIP A;  5JA7 A;  2PNS A;  3QT4 A;  4YV8 A;  2FRA A;  3KFQ A;  1NB5 A;  2P7U A;  2CB5 A;  2PBH A;  5JH3 A;  5CVM A;  4W5B A;  4AXM A;  3RVW A;  3KWZ A;  1U9W A;  1TLO A;  3BPF A;  1W5R A;  2HXZ A;  2FT2 A;  4AXL A;  4X6H A;  2AUZ A;  1E2T A;  1NB3 A;  3MTN A;  1ICF A;  4YYW A;  2YJB A;  4QBB A;  3CBJ A;  2AU1 A;  4I04 A;  5J94 A;  1S4V A;  8PCH A;  3MOR A;  1Y08 A;  2YJC A;  3OF9 A;  1CVZ A;  2R9F A;  2VHF A;  2FYE A;  3WXG A;  3E1Z B;  1CJL A;  3H8B A;  2R9O A;  1PXV A;  1KFU L;  3BC3 A;  5FPW A;  2HHN A;  2AYN A;  3IOQ A;  5A24 A;  3OVZ A;  2R9N A;  4YVA A;  3WXE A;  4B55 A;  2DCC A;  1ITO A;  1M6D A;  1U9X A;  1POP A;  2AS8 A;  1QOL A;  1AYU A;  4G54 A;  4W5C A;  1GCB A;  1CB5 A;  1ME4 A;  2C0Y A;  2BSZ A;  1EWM A;  2DZY A;  3CBK A;  2ARY A;  2YJ9 A;  3NHE A;  3QJ3 A;  1Y4H A;  3HHA A;  3O1G A;  2IBI A;  2NQA A;  3H7D A;  1K3B B;  2PRE A;  4FIP A;  2R9C A;  3S3R A;  2XU5 A;  3KX1 A;  3I3T A;  1BQI A;  4NV7 A;  1QMY A;  1YK7 A;  1AU3 A;  1DF0 A;  3CH2 X;  1PE6 A;  2GFO A;  4MZO A;  4NV8 A;  3RVX A;  4P6E A;  3LXS A;  4OEM A;  2P0R A;  2H7J A;  1AU0 A;  1CV8 A;  2FO5 A;  2Y5B A;  3GCB A;  3C9E A;  3D6S A;  3ERV A;  3N4C A;  4PP2 E;  3DF0 A;  3PDF A;  4I07 A;  1VSN A;  4BS5 A;  3LTW A;  2P86 A;  3M99 A;  1U5I A;  3BOW A;  1AEC A;  3N3G A;  2AVW A;  4I05 A;  1KHQ A;  1X9Y A;  1EWL A;  1AU2 A;  3P5X A;  1PAD A;  1TU6 A;  3O0U A;  2O6X A;  2R9M A;  3LFY A;  2YJ8 A;  5CHV A;  1MEG A;  4QRG A;  4YYU A;  1W6F A;  2E01 A;  3USV A;  1Q6K A;  2OP3 A;  4BSQ A;  4YYQ A;  1AU4 A;  2ACT A;  2DCA A;  2OZ2 A;  4BGF A;  2DCB A;  3BWK A;  2NQG A;  2DCD A;  1F29 A;  4P6G A;  2PAD A;  3OIS A;  3OVX A;  3TNX A;  2FQ9 A;  3V6E A;  1YVB A;  2R6N A;  2IPP B;  4QH6 A;  1F2B A;  4FJC A;  1F2C A;  1STF E;  1AIM A;  1CQD A;  1QDQ A;  1PPO A;  1O0E A;  1KFX L;  4FK5 A;  4Q8G A;  2VFB A;  4QRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...