4MZOA

Mouse cathepsin s with covalent ligand (3s,4s)-n-[(2e)-2-iminoethyl]-4-(morpholin-4-ylcarbonyl)-1-(phenylsulfonyl)pyrrolidine-3-carboxamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of potent and selective cathepsin S inhibitors containing different central cyclic scaffolds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
total genus 67
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4mzoA00
1ZCMA 1PPOA 2PADA 4G54A 1AU2A 3PDFA 4AXLA 3P5WA 1F2CA 2B1NA 2G8EA 3I3TA 2FTDA 2DZZA 1QDQA 4YYVA 2DCBA 4MZOA 1BP4A 3N3KA 2GFOA 3V6EA 1NPZA 1YK8A 1EF7A 4I07A 4P6EA 1CSBB 3U8EA 3B79A 2P0RA 3OF9A 5JH3A 5PADA 1BY8A 2DCCA 3IV2A 3AI8A 3GCBA 2FUDA 3IUTA 3P5XA 2NQGA 1AIMA 4RY2A 1K3BB 2YJCA 1BQIA 1CVZA 2ATOA 1XKGA 2G7YA 3RVWA 3S3QA 5K16A 4BSQA 1F2BA 3KWZA 3OVZA 1NQCA 3IHPA 1F2AA 2R6NA 2HHNA 2AUXA 2F7DA 3O0UA 1Y4HA 2Y6EA 1MS6A 3H8BA 4MSXA 1VJVA 1SP4B 5CVOB 4QBBA 4ZUXU 1GLOA 4QRXA 4PP2E 3P5VA 2ARYA 1DF0A 1PPPA 2FYEA 1ATKA 3H89A 1YT7A 3OVXA 2OULA 5CHVA 2P7UA 2GHUA 1KFUL 1Y08A 3HWNA 3OISA 1HUCB 4K7CA 3MORA 2B1MA 2DJGB 4W4UA 3KW9A 4X6IA 3BC3A 1EWPA 2DCDA 2VHSA 3PNRA 2E00A 2H7JA 2FO5A 1U9QX 5CHTA 2E01A 3BPMA 2R9OA 3H8CA 4DMXA 2DJFB 3E1ZB 1CB5A 1NB3A 3N3GA 3WXFA 2E02A 1PADA 1AECA 3IOQA 4YYWA 2R9CA 2HXZA 1BGOA 2PNSA 4CZWA 2XU5A 2AYOA 2R9MA 1PPNA 2O6XA 1A6RA 1CTEA 4YYSA 1F29A 4N79A 4QRGA 3LXSA 4FJCA 1TL9A 1U9WA 2XU1A 1U9VA 4QRVA 3QJ3A 3M99A 1AU0A 1PPDA 4XUIA 1CPJA 2FQ9A 2XU4A 4I04A 3C9EA 3IEJA 2AS8A 4Q8HA 1U9XA 3V6CA 2FT2A 2AVWA 3MTNA 1EWOA 4BS5A 3KSEA 2AIMA 1VSNA 3TNXA 2CIOA 4BPVA 2Y5BA 5F02A 2AYNA 5FPWA 3CH2X 3CH3X 1JQPA 4CDDB 2BDZA 2DC7A 1ZIVA 2AU1A 2PREA 2NQDB 5CVNB 3BCNA 1AU3A 1YVBA 2DZYA 1IWDA 2VHFA 4HWYA 3QSDA 9PAPA 3S3RA 5A24A 3I06A 4W5CA 4N4ZA 1ME3A 1AU4A 3D6SA 2FRQA 2ACTA 2E03A 4N8WA 3HHIA 1PE6A 1MIRA 3KKUA 3ZUAA 1QXPA 3CBKA 2YJ2A 4PADA 3WXEA 3NHEA 2DC9A 3BOWA 2G8JA 3MHSA 3PBHA 1KHQA 4WA6A 4FIPA 6PADA 2YJ8A 2OP3A 1MDWA 2YJBA 1MEGA 1KXRA 4AXMA 1X9YA 1MHWA 2AUZA 2R9NA 1GCBA 3IMAA 1PXVA 1ME4A 4QH6A 1NLJA 2HH5A 2YJ9A 4MZSA 1DEUA 4OELA 2NQAA 1AYUA 1QOLA 1KHPA 1QMYA 3CBJA 2DC8A 1THEA 2P86A 3KWBX 4P6GA 1PIPA 4CDEB 1STFE 1KFXL 1MEMA 1O0EA 3RVXA 1POPA 5J94A 4YVAA 2WBFX 4W5BA 4X6JA 4BS6A 2NQIA 4YV8A 4Q8GA 1NB5A 2PBHA 3DF0A 3K24A 3USVA 2CB5A 4X6HA 1GECE 2HD5A 3HD3A 1GMYA 2JQFR 2F1GA 4YYQA 1NL6A 1CJLA 1TLOA 3LFYA 3OF8A 2DC6A 1EWLA 5EGWA 2BDLA 4BQVA 7PCKA 3O1GA 1YALA 1EWMA 3ERVA 2OZ2A 2DCAA 3K9MA 3K8UA 3HHAA 5CVMA 4YYUA 4KLBA 4YYRA 1PBHA 1ICFA 3MHHA 3KX1A 4OEMA 3H6SA 1S4VA 1YK7A 4PI3A 4PP1A 2R9FA 3KFQA 8PCHA 4FK5A 1U5IA 3WXGA 1TU6A 3N4CA 1SNKA 3P5UA 1AYVA 3PW3A 3F75A 3QT4A 4DMYA 2JQGR 4CDCB 1M6DA 3F5VA 1CS8A 1PCIA 1CQDA 1AYWA 4CDFB 3H7DA 5JA7A 1ITOA 1FH0A 5EF4A 4I05A 3BPFA 1Q6KA 1CV8A 2XU3A 2C0YA 2IBIA 3BWKA 4XR7A 2G6DA 2IPPB 2FRAA 3RVVA
chains in the Genus database with same CATH superfamily
1ZCMA 1PPOA 2PADA 4M0WA 4G54A 1AU2A 3PDFA 4AXLA 2JRIA 3P5WA 1F2CA 3MP2A 2B1NA 2G8EA 3I3TA 2FTDA 2DZZA 1QDQA 4YYVA 2DCBA 4MZOA 1BP4A 3N3KA 2GFOA 3V6EA 1NPZA 1YK8A 1EF7A 4I07A 4P6EA 1CSBB 3U8EA 3B79A 2P0RA 3OF9A 5JH3A 5PADA 4BOUA 1BY8A 2DCCA 3IV2A 3AI8A 3GCBA 2FUDA 3IUTA 3P5XA 3IFUA 2NQGA 5E6JA 1AIMA 4RY2A 1K3BB 2YJCA 1BQIA 1CVZA 2ATOA 4D8EA 1XKGA 2G7YA 4OW0A 3RVWA 3S3QA 5K16A 4BSQA 3W31A 1F2BA 4WURA 4MI7A 3KWZA 3OVZA 1NQCA 3IHPA 4IUMA 1F2AA 2R6NA 2HHNA 2AUXA 2F7DA 3O0UA 3TRKA 1Y4HA 2Y6EA 1MS6A 3H8BA 4MSXA 1VJVA 3BY4A 1SP4B 5CVOB 4QBBA 4ZUXU 1GLOA 4QRXA 4PP2E 4RKXA 3P5VA 2ARYA 1DF0A 1PPPA 2JTCA 3C0RA 2FYEA 1ATKA 3H89A 1YT7A 4RNAA 3OVXA 2OULA 5CHVA 2P7UA 4OVZB 2GHUA 1KFUL 3BB7A 1Y08A 3HWNA 3OISA 1HUCB 4K7CA 3MORA 2B1MA 2DJGB 4W4UA 3KW9A 4X6IA 3BC3A 1EWPA 2DCDA 2VHSA 2Z84A 3PNRA 2E00A 2H7JA 2FO5A 1U9QX 5CHTA 4P16A 2E01A 3BPMA 2R9OA 3H8CA 4DMXA 2DJFB 3E1ZB 4BOZA 1CB5A 3MJ5A 1NB3A 4BOQA 3N3GA 3WXFA 4HXDB 2E02A 1PADA 1AECA 3IOQA 4YYWA 4RF0A 2J7QC 2R9CA 2HXZA 1BGOA 2PNSA 4CZWA 2XU5A 2AYOA 2R9MA 1PPNA 2O6XA 1A6RA 1CTEA 4YYSA 1F29A 4N79A 4QRGA 3LXSA 4FJCA 1TL9A 1U9WA 2XU1A 1U9VA 1YZBA 4QRVA 3QJ3A 3M99A 1AU0A 1PPDA 4XUIA 1CPJA 2FQ9A 2XU4A 4I04A 4OVZA 3C9EA 3IEJA 2AS8A 4Q8HA 1U9XA 3V6CA 2FT2A 2AVWA 3MTNA 1EWOA 4BS5A 3KSEA 3E9SA 2AIMA 1VSNA 3TNXA 2CIOA 3PHWA 4BPVA 2Y5BA 5F02A 2AYNA 5FPWA 3CH2X 3CH3X 1JQPA 4CDDB 2BDZA 2DC7A 1ZIVA 2AU1A 2PREA 2NQDB 5KO3A 5CVNB 3B21A 2J7QA 3BCNA 1AU3A 1YVBA 2DZYA 1IWDA 2VHFA 4HWYA 3QSDA 9PAPA 3S3RA 2HWKA 5A24A 3I06A 4W5CA 4N4ZA 1ME3A 1AU4A 3D6SA 2FRQA 2ACTA 2E03A 4N8WA 4D8BA 2DOSA 3HHIA 1PE6A 1MIRA 1UKFA 3KKUA 3ZUAA 1QXPA 3CBKA 2BTWA 3PSEA 2YJ2A 4PADA 3WXEA 4D8IA 3NHEA 2DC9A 3BOWA 2G8JA 3MHSA 3PBHA 1KHQA 4WA6A 4FIPA 6PADA 2YJ8A 2OP3A 1MDWA 2YJBA 1MEGA 1KXRA 4BOPA 4AXMA 1X9YA 1MHWA 2AUZA 2R9NA 5JZEA 4RF1A 1GCBA 3IMAA 1PXVA 3TMPA 1ME4A 4QH6A 2BTWB 1NLJA 2HH5A 2YJ9A 4MZSA 1DEUA 4OELA 2NQAA 1AYUA 2UZJA 1QOLA 3PT2A 1KHPA 1QMYA 3CBJA 2DC8A 1THEA 2P86A 3KWBX 4ZTBA 4P6GA 1PIPA 3ZNHA 3PRMA 4XZXA 1STFE 4CDEB 1KFXL 1MEMA 1O0EA 3RVXA 1POPA 3PHXA 5J94A 4YVAA 2WBFX 5EZQA 4W5BA 1DKIA 4X6JA 4BS6A 2NQIA 4REZA 4YV8A 4Q8GA 3MTVA 1NB5A 2PBHA 3DF0A 3K24A 3USVA 2CB5A 4X6HA 1GECE 2HD5A 3HD3A 1GMYA 2JQFR 2F1GA 4YYQA 1NL6A 1CJLA 1TLOA 3LFYA 2BU3A 3OF8A 2DC6A 1EWLA 4BOSA 5EGWA 2BDLA 4BQVA 1PVJA 7PCKA 3O1GA 1YALA 1EWMA 3ERVA 2FE8A 3RNVA 2OZ2A 2DCAA 3K9MA 3K8UA 3HHAA 5CVMA 4A5UA 4YYUA 4KLBA 2AGAA 4YYRA 3OQCA 1PBHA 1ICFA 3MHHA 3KX1A 4OEMA 3H6SA 1S4VA 3PHUA 1YK7A 4PI3A 4PP1A 2R9FA 3KFQA 4IP3A 4MM3B 8PCHA 4FK5A 1U5IA 3WXGA 1TU6A 3N4CA 3W30A 1SNKA 3P5UA 1AYVA 3PW3A 4PT5A 3F75A 3O65A 3QT4A 4DMYA 2JQGR 4CDCB 1M6DA 3F5VA 1CS8A 5EZSA 1PCIA 1CQDA 1AYWA 4CDFB 3BBAA 3H7DA 5JA7A 3PRPA 1ITOA 1FH0A 5EF4A 4I05A 3BPFA 1Q6KA 1CV8A 2XU3A 2C0YA 2IBIA 3BWKA 4XR7A 2G6DA 2IPPB 4GUAA 4R3DA 2FRAA 3RVVA
chains in the Genus database with same CATH topology
1ZCMA 1PPOA 2PADA 4G54A 1AU2A 3PDFA 4AXLA 3P5WA 1F2CA 2B1NA 2G8EA 3I3TA 2FTDA 2DZZA 1QDQA 4YYVA 2DCBA 4MZOA 1BP4A 3N3KA 2GFOA 3V6EA 1NPZA 1YK8A 1EF7A 4I07A 4P6EA 1CSBB 3U8EA 3B79A 2P0RA 3OF9A 5JH3A 5PADA 1BY8A 2DCCA 3IV2A 3AI8A 3GCBA 2FUDA 3IUTA 3P5XA 2NQGA 1AIMA 4RY2A 1K3BB 2YJCA 1BQIA 1CVZA 4GUZA 2ATOA 1XKGA 2G7YA 3RVWA 3S3QA 5K16A 4BSQA 1F2BA 3KWZA 3OVZA 1NQCA 3IHPA 1F2AA 2R6NA 4BGFA 2HHNA 2AUXA 2F7DA 3O0UA 4C5PA 3D9WA 1Y4HA 2Y6EA 1MS6A 3H8BA 4MSXA 1VJVA 1SP4B 5CVOB 4QBBA 4ZUXU 1GLOA 4QRXA 4PP2E 3P5VA 2ARYA 1DF0A 1PPPA 2FYEA 1ATKA 3H89A 1YT7A 3OVXA 2OULA 5CHVA 2P7UA 2GHUA 1KFUL 1Y08A 3HWNA 3OISA 1HUCB 4K7CA 3MORA 2B1MA 2DJGB 4W4UA 3KW9A 4X6IA 3BC3A 1EWPA 2DCDA 2VHSA 3PNRA 2E00A 2H7JA 2FO5A 1U9QX 5CHTA 2E01A 3BPMA 2R9OA 3H8CA 4DMXA 2DJFB 3E1ZB 2VFCA 1CB5A 1NB3A 3N3GA 3WXFA 2E02A 1PADA 1AECA 3IOQA 4YYWA 2R9CA 2HXZA 1BGOA 2PNSA 4CZWA 3LTWA 2XU5A 2AYOA 2R9MA 1PPNA 2O6XA 1A6RA 1CTEA 4YYSA 1F29A 4N79A 4QRGA 3LXSA 4FJCA 1TL9A 1U9WA 2XU1A 1U9VA 4QRVA 3QJ3A 3M99A 1AU0A 1PPDA 4XUIA 1CPJA 2FQ9A 2XU4A 4I04A 3C9EA 3IEJA 2AS8A 4Q8HA 1U9XA 3V6CA 4B55A 2FT2A 2AVWA 3MTNA 1EWOA 4BS5A 3KSEA 2VFBA 2AIMA 1VSNA 3TNXA 2CIOA 4BPVA 2Y5BA 5F02A 2AYNA 5FPWA 3CH2X 3CH3X 1JQPA 4CDDB 2BDZA 2DC7A 1ZIVA 2AU1A 2PREA 1GX3A 2NQDB 5CVNB 3BCNA 1AU3A 1YVBA 2DZYA 1IWDA 2VHFA 4HWYA 3QSDA 1W4TA 9PAPA 3S3RA 5A24A 3I06A 4W5CA 4N4ZA 1ME3A 1AU4A 3D6SA 2FRQA 2ACTA 2E03A 4N8WA 3HHIA 1PE6A 1MIRA 3KKUA 3ZUAA 1QXPA 3CBKA 2YJ2A 4PADA 3WXEA 3NHEA 2DC9A 3BOWA 2G8JA 1E2TA 3MHSA 3PBHA 1KHQA 4WA6A 4FIPA 6PADA 2YJ8A 2OP3A 1MDWA 1W6FA 2YJBA 1MEGA 1KXRA 4AXMA 1X9YA 1MHWA 2AUZA 2R9NA 1GCBA 3IMAA 1PXVA 1ME4A 4QH6A 1NLJA 2HH5A 2YJ9A 4MZSA 1DEUA 4OELA 2NQAA 1AYUA 1QOLA 1KHPA 1QMYA 3CBJA 2DC8A 1THEA 2P86A 3KWBX 4P6GA 1PIPA 4CDEB 1STFE 1KFXL 1MEMA 1O0EA 3RVXA 1POPA 5J94A 4YVAA 2WBFX 4W5BA 4X6JA 4NV7A 4BS6A 2NQIA 4YV8A 4Q8GA 1NB5A 2PBHA 3DF0A 3K24A 3USVA 2CB5A 4NV8A 4X6HA 1GECE 2HD5A 3HD3A 1GMYA 2JQFR 2F1GA 4YYQA 1NL6A 1CJLA 1TLOA 3LFYA 3OF8A 2DC6A 1EWLA 5EGWA 2BDLA 4BQVA 7PCKA 3O1GA 1W5RA 1YALA 1EWMA 3ERVA 2OZ2A 2DCAA 3K9MA 3K8UA 3HHAA 5CVMA 4YYUA 4KLBA 4YYRA 1PBHA 1ICFA 3MHHA 3KX1A 4OEMA 3H6SA 1S4VA 1YK7A 4PI3A 4PP1A 2R9FA 3KFQA 8PCHA 4FK5A 1U5IA 3WXGA 1TU6A 3N4CA 1SNKA 3P5UA 1AYVA 3PW3A 3F75A 3QT4A 4DMYA 2JQGR 4CDCB 1M6DA 3F5VA 1CS8A 1PCIA 1CQDA 1AYWA 4CDFB 3H7DA 5JA7A 1ITOA 1FH0A 5EF4A 4I05A 3BPFA 2BSZA 1Q6KA 1CV8A 2XU3A 2C0YA 2IBIA 3BWKA 4XR7A 2G6DA 2IPPB 2FRAA 3RVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCM A;  1PPO A;  2PAD A;  4G54 A;  1AU2 A;  3PDF A;  4AXL A;  3P5W A;  1F2C A;  2B1N A;  2G8E A;  3I3T A;  2FTD A;  2DZZ A;  1QDQ A;  4YYV A;  2DCB A;  4MZO A;  1BP4 A;  3N3K A;  2GFO A;  3V6E A;  1NPZ A;  1YK8 A;  1EF7 A;  4I07 A;  4P6E A;  1CSB B;  3U8E A;  3B79 A;  2P0R A;  3OF9 A;  5JH3 A;  5PAD A;  1BY8 A;  2DCC A;  3IV2 A;  3AI8 A;  3GCB A;  2FUD A;  3IUT A;  3P5X A;  2NQG A;  1AIM A;  4RY2 A;  1K3B B;  2YJC A;  1BQI A;  1CVZ A;  2ATO A;  1XKG A;  2G7Y A;  3RVW A;  3S3Q A;  5K16 A;  4BSQ A;  1F2B A;  3KWZ A;  3OVZ A;  1NQC A;  3IHP A;  1F2A A;  2R6N A;  2HHN A;  2AUX A;  2F7D A;  3O0U A;  1Y4H A;  2Y6E A;  1MS6 A;  3H8B A;  4MSX A;  1VJV A;  1SP4 B;  5CVO B;  4QBB A;  4ZUX U;  1GLO A;  4QRX A;  4PP2 E;  3P5V A;  2ARY A;  1DF0 A;  1PPP A;  2FYE A;  1ATK A;  3H89 A;  1YT7 A;  3OVX A;  2OUL A;  5CHV A;  2P7U A;  2GHU A;  1KFU L;  1Y08 A;  3HWN A;  3OIS A;  1HUC B;  4K7C A;  3MOR A;  2B1M A;  2DJG B;  4W4U A;  3KW9 A;  4X6I A;  3BC3 A;  1EWP A;  2DCD A;  2VHS A;  3PNR A;  2E00 A;  2H7J A;  2FO5 A;  1U9Q X;  5CHT A;  2E01 A;  3BPM A;  2R9O A;  3H8C A;  4DMX A;  2DJF B;  3E1Z B;  1CB5 A;  1NB3 A;  3N3G A;  3WXF A;  2E02 A;  1PAD A;  1AEC A;  3IOQ A;  4YYW A;  2R9C A;  2HXZ A;  1BGO A;  2PNS A;  4CZW A;  2XU5 A;  2AYO A;  2R9M A;  1PPN A;  2O6X A;  1A6R A;  1CTE A;  4YYS A;  1F29 A;  4N79 A;  4QRG A;  3LXS A;  4FJC A;  1TL9 A;  1U9W A;  2XU1 A;  1U9V A;  4QRV A;  3QJ3 A;  3M99 A;  1AU0 A;  1PPD A;  4XUI A;  1CPJ A;  2FQ9 A;  2XU4 A;  4I04 A;  3C9E A;  3IEJ A;  2AS8 A;  4Q8H A;  1U9X A;  3V6C A;  2FT2 A;  2AVW A;  3MTN A;  1EWO A;  4BS5 A;  3KSE A;  2AIM A;  1VSN A;  3TNX A;  2CIO A;  4BPV A;  2Y5B A;  5F02 A;  2AYN A;  5FPW A;  3CH2 X;  3CH3 X;  1JQP A;  4CDD B;  2BDZ A;  2DC7 A;  1ZIV A;  2AU1 A;  2PRE A;  2NQD B;  5CVN B;  3BCN A;  1AU3 A;  1YVB A;  2DZY A;  1IWD A;  2VHF A;  4HWY A;  3QSD A;  9PAP A;  3S3R A;  5A24 A;  3I06 A;  4W5C A;  4N4Z A;  1ME3 A;  1AU4 A;  3D6S A;  2FRQ A;  2ACT A;  2E03 A;  4N8W A;  3HHI A;  1PE6 A;  1MIR A;  3KKU A;  3ZUA A;  1QXP A;  3CBK A;  2YJ2 A;  4PAD A;  3WXE A;  3NHE A;  2DC9 A;  3BOW A;  2G8J A;  3MHS A;  3PBH A;  1KHQ A;  4WA6 A;  4FIP A;  6PAD A;  2YJ8 A;  2OP3 A;  1MDW A;  2YJB A;  1MEG A;  1KXR A;  4AXM A;  1X9Y A;  1MHW A;  2AUZ A;  2R9N A;  1GCB A;  3IMA A;  1PXV A;  1ME4 A;  4QH6 A;  1NLJ A;  2HH5 A;  2YJ9 A;  4MZS A;  1DEU A;  4OEL A;  2NQA A;  1AYU A;  1QOL A;  1KHP A;  1QMY A;  3CBJ A;  2DC8 A;  1THE A;  2P86 A;  3KWB X;  4P6G A;  1PIP A;  4CDE B;  1STF E;  1KFX L;  1MEM A;  1O0E A;  3RVX A;  1POP A;  5J94 A;  4YVA A;  2WBF X;  4W5B A;  4X6J A;  4BS6 A;  2NQI A;  4YV8 A;  4Q8G A;  1NB5 A;  2PBH A;  3DF0 A;  3K24 A;  3USV A;  2CB5 A;  4X6H A;  1GEC E;  2HD5 A;  3HD3 A;  1GMY A;  2JQF R;  2F1G A;  4YYQ A;  1NL6 A;  1CJL A;  1TLO A;  3LFY A;  3OF8 A;  2DC6 A;  1EWL A;  5EGW A;  2BDL A;  4BQV A;  7PCK A;  3O1G A;  1YAL A;  1EWM A;  3ERV A;  2OZ2 A;  2DCA A;  3K9M A;  3K8U A;  3HHA A;  5CVM A;  4YYU A;  4KLB A;  4YYR A;  1PBH A;  1ICF A;  3MHH A;  3KX1 A;  4OEM A;  3H6S A;  1S4V A;  1YK7 A;  4PI3 A;  4PP1 A;  2R9F A;  3KFQ A;  8PCH A;  4FK5 A;  1U5I A;  3WXG A;  1TU6 A;  3N4C A;  1SNK A;  3P5U A;  1AYV A;  3PW3 A;  3F75 A;  3QT4 A;  4DMY A;  2JQG R;  4CDC B;  1M6D A;  3F5V A;  1CS8 A;  1PCI A;  1CQD A;  1AYW A;  4CDF B;  3H7D A;  5JA7 A;  1ITO A;  1FH0 A;  5EF4 A;  4I05 A;  3BPF A;  1Q6K A;  1CV8 A;  2XU3 A;  2C0Y A;  2IBI A;  3BWK A;  4XR7 A;  2G6D A;  2IPP B;  2FRA A;  3RVV A; 
#chains in the Genus database with same CATH topology
 1ZCM A;  1PPO A;  2PAD A;  4M0W A;  4G54 A;  1AU2 A;  3PDF A;  4AXL A;  2JRI A;  3P5W A;  1F2C A;  3MP2 A;  2B1N A;  2G8E A;  3I3T A;  2FTD A;  2DZZ A;  1QDQ A;  4YYV A;  2DCB A;  4MZO A;  1BP4 A;  3N3K A;  2GFO A;  3V6E A;  1NPZ A;  1YK8 A;  1EF7 A;  4I07 A;  4P6E A;  1CSB B;  3U8E A;  3B79 A;  2P0R A;  3OF9 A;  5JH3 A;  5PAD A;  4BOU A;  1BY8 A;  2DCC A;  3IV2 A;  3AI8 A;  3GCB A;  2FUD A;  3IUT A;  3P5X A;  3IFU A;  2NQG A;  5E6J A;  1AIM A;  4RY2 A;  1K3B B;  2YJC A;  1BQI A;  1CVZ A;  2ATO A;  4D8E A;  1XKG A;  2G7Y A;  4OW0 A;  3RVW A;  3S3Q A;  5K16 A;  4BSQ A;  3W31 A;  1F2B A;  4WUR A;  4MI7 A;  3KWZ A;  3OVZ A;  1NQC A;  3IHP A;  4IUM A;  1F2A A;  2R6N A;  2HHN A;  2AUX A;  2F7D A;  3O0U A;  3TRK A;  1Y4H A;  2Y6E A;  1MS6 A;  3H8B A;  4MSX A;  1VJV A;  3BY4 A;  1SP4 B;  5CVO B;  4QBB A;  4ZUX U;  1GLO A;  4QRX A;  4PP2 E;  4RKX A;  3P5V A;  2ARY A;  1DF0 A;  1PPP A;  2JTC A;  3C0R A;  2FYE A;  1ATK A;  3H89 A;  1YT7 A;  4RNA A;  3OVX A;  2OUL A;  5CHV A;  2P7U A;  4OVZ B;  2GHU A;  1KFU L;  3BB7 A;  1Y08 A;  3HWN A;  3OIS A;  1HUC B;  4K7C A;  3MOR A;  2B1M A;  2DJG B;  4W4U A;  3KW9 A;  4X6I A;  3BC3 A;  1EWP A;  2DCD A;  2VHS A;  2Z84 A;  3PNR A;  2E00 A;  2H7J A;  2FO5 A;  1U9Q X;  5CHT A;  4P16 A;  2E01 A;  3BPM A;  2R9O A;  3H8C A;  4DMX A;  2DJF B;  3E1Z B;  4BOZ A;  1CB5 A;  3MJ5 A;  1NB3 A;  4BOQ A;  3N3G A;  3WXF A;  4HXD B;  2E02 A;  1PAD A;  1AEC A;  3IOQ A;  4YYW A;  4RF0 A;  2J7Q C;  2R9C A;  2HXZ A;  1BGO A;  2PNS A;  4CZW A;  2XU5 A;  2AYO A;  2R9M A;  1PPN A;  2O6X A;  1A6R A;  1CTE A;  4YYS A;  1F29 A;  4N79 A;  4QRG A;  3LXS A;  4FJC A;  1TL9 A;  1U9W A;  2XU1 A;  1U9V A;  1YZB A;  4QRV A;  3QJ3 A;  3M99 A;  1AU0 A;  1PPD A;  4XUI A;  1CPJ A;  2FQ9 A;  2XU4 A;  4I04 A;  4OVZ A;  3C9E A;  3IEJ A;  2AS8 A;  4Q8H A;  1U9X A;  3V6C A;  2FT2 A;  2AVW A;  3MTN A;  1EWO A;  4BS5 A;  3KSE A;  3E9S A;  2AIM A;  1VSN A;  3TNX A;  2CIO A;  3PHW A;  4BPV A;  2Y5B A;  5F02 A;  2AYN A;  5FPW A;  3CH2 X;  3CH3 X;  1JQP A;  4CDD B;  2BDZ A;  2DC7 A;  1ZIV A;  2AU1 A;  2PRE A;  2NQD B;  5KO3 A;  5CVN B;  3B21 A;  2J7Q A;  3BCN A;  1AU3 A;  1YVB A;  2DZY A;  1IWD A;  2VHF A;  4HWY A;  3QSD A;  9PAP A;  3S3R A;  2HWK A;  5A24 A;  3I06 A;  4W5C A;  4N4Z A;  1ME3 A;  1AU4 A;  3D6S A;  2FRQ A;  2ACT A;  2E03 A;  4N8W A;  4D8B A;  2DOS A;  3HHI A;  1PE6 A;  1MIR A;  1UKF A;  3KKU A;  3ZUA A;  1QXP A;  3CBK A;  2BTW A;  3PSE A;  2YJ2 A;  4PAD A;  3WXE A;  4D8I A;  3NHE A;  2DC9 A;  3BOW A;  2G8J A;  3MHS A;  3PBH A;  1KHQ A;  4WA6 A;  4FIP A;  6PAD A;  2YJ8 A;  2OP3 A;  1MDW A;  2YJB A;  1MEG A;  1KXR A;  4BOP A;  4AXM A;  1X9Y A;  1MHW A;  2AUZ A;  2R9N A;  5JZE A;  4RF1 A;  1GCB A;  3IMA A;  1PXV A;  3TMP A;  1ME4 A;  4QH6 A;  2BTW B;  1NLJ A;  2HH5 A;  2YJ9 A;  4MZS A;  1DEU A;  4OEL A;  2NQA A;  1AYU A;  2UZJ A;  1QOL A;  3PT2 A;  1KHP A;  1QMY A;  3CBJ A;  2DC8 A;  1THE A;  2P86 A;  3KWB X;  4ZTB A;  4P6G A;  1PIP A;  3ZNH A;  3PRM A;  4XZX A;  1STF E;  4CDE B;  1KFX L;  1MEM A;  1O0E A;  3RVX A;  1POP A;  3PHX A;  5J94 A;  4YVA A;  2WBF X;  5EZQ A;  4W5B A;  1DKI A;  4X6J A;  4BS6 A;  2NQI A;  4REZ A;  4YV8 A;  4Q8G A;  3MTV A;  1NB5 A;  2PBH A;  3DF0 A;  3K24 A;  3USV A;  2CB5 A;  4X6H A;  1GEC E;  2HD5 A;  3HD3 A;  1GMY A;  2JQF R;  2F1G A;  4YYQ A;  1NL6 A;  1CJL A;  1TLO A;  3LFY A;  2BU3 A;  3OF8 A;  2DC6 A;  1EWL A;  4BOS A;  5EGW A;  2BDL A;  4BQV A;  1PVJ A;  7PCK A;  3O1G A;  1YAL A;  1EWM A;  3ERV A;  2FE8 A;  3RNV A;  2OZ2 A;  2DCA A;  3K9M A;  3K8U A;  3HHA A;  5CVM A;  4A5U A;  4YYU A;  4KLB A;  2AGA A;  4YYR A;  3OQC A;  1PBH A;  1ICF A;  3MHH A;  3KX1 A;  4OEM A;  3H6S A;  1S4V A;  3PHU A;  1YK7 A;  4PI3 A;  4PP1 A;  2R9F A;  3KFQ A;  4IP3 A;  4MM3 B;  8PCH A;  4FK5 A;  1U5I A;  3WXG A;  1TU6 A;  3N4C A;  3W30 A;  1SNK A;  3P5U A;  1AYV A;  3PW3 A;  4PT5 A;  3F75 A;  3O65 A;  3QT4 A;  4DMY A;  2JQG R;  4CDC B;  1M6D A;  3F5V A;  1CS8 A;  5EZS A;  1PCI A;  1CQD A;  1AYW A;  4CDF B;  3BBA A;  3H7D A;  5JA7 A;  3PRP A;  1ITO A;  1FH0 A;  5EF4 A;  4I05 A;  3BPF A;  1Q6K A;  1CV8 A;  2XU3 A;  2C0Y A;  2IBI A;  3BWK A;  4XR7 A;  2G6D A;  2IPP B;  4GUA A;  4R3D A;  2FRA A;  3RVV A; 
#chains in the Genus database with same CATH homology
 1ZCM A;  1PPO A;  2PAD A;  4G54 A;  1AU2 A;  3PDF A;  4AXL A;  3P5W A;  1F2C A;  2B1N A;  2G8E A;  3I3T A;  2FTD A;  2DZZ A;  1QDQ A;  4YYV A;  2DCB A;  4MZO A;  1BP4 A;  3N3K A;  2GFO A;  3V6E A;  1NPZ A;  1YK8 A;  1EF7 A;  4I07 A;  4P6E A;  1CSB B;  3U8E A;  3B79 A;  2P0R A;  3OF9 A;  5JH3 A;  5PAD A;  1BY8 A;  2DCC A;  3IV2 A;  3AI8 A;  3GCB A;  2FUD A;  3IUT A;  3P5X A;  2NQG A;  1AIM A;  4RY2 A;  1K3B B;  2YJC A;  1BQI A;  1CVZ A;  4GUZ A;  2ATO A;  1XKG A;  2G7Y A;  3RVW A;  3S3Q A;  5K16 A;  4BSQ A;  1F2B A;  3KWZ A;  3OVZ A;  1NQC A;  3IHP A;  1F2A A;  2R6N A;  4BGF A;  2HHN A;  2AUX A;  2F7D A;  3O0U A;  4C5P A;  3D9W A;  1Y4H A;  2Y6E A;  1MS6 A;  3H8B A;  4MSX A;  1VJV A;  1SP4 B;  5CVO B;  4QBB A;  4ZUX U;  1GLO A;  4QRX A;  4PP2 E;  3P5V A;  2ARY A;  1DF0 A;  1PPP A;  2FYE A;  1ATK A;  3H89 A;  1YT7 A;  3OVX A;  2OUL A;  5CHV A;  2P7U A;  2GHU A;  1KFU L;  1Y08 A;  3HWN A;  3OIS A;  1HUC B;  4K7C A;  3MOR A;  2B1M A;  2DJG B;  4W4U A;  3KW9 A;  4X6I A;  3BC3 A;  1EWP A;  2DCD A;  2VHS A;  3PNR A;  2E00 A;  2H7J A;  2FO5 A;  1U9Q X;  5CHT A;  2E01 A;  3BPM A;  2R9O A;  3H8C A;  4DMX A;  2DJF B;  3E1Z B;  2VFC A;  1CB5 A;  1NB3 A;  3N3G A;  3WXF A;  2E02 A;  1PAD A;  1AEC A;  3IOQ A;  4YYW A;  2R9C A;  2HXZ A;  1BGO A;  2PNS A;  4CZW A;  3LTW A;  2XU5 A;  2AYO A;  2R9M A;  1PPN A;  2O6X A;  1A6R A;  1CTE A;  4YYS A;  1F29 A;  4N79 A;  4QRG A;  3LXS A;  4FJC A;  1TL9 A;  1U9W A;  2XU1 A;  1U9V A;  4QRV A;  3QJ3 A;  3M99 A;  1AU0 A;  1PPD A;  4XUI A;  1CPJ A;  2FQ9 A;  2XU4 A;  4I04 A;  3C9E A;  3IEJ A;  2AS8 A;  4Q8H A;  1U9X A;  3V6C A;  4B55 A;  2FT2 A;  2AVW A;  3MTN A;  1EWO A;  4BS5 A;  3KSE A;  2VFB A;  2AIM A;  1VSN A;  3TNX A;  2CIO A;  4BPV A;  2Y5B A;  5F02 A;  2AYN A;  5FPW A;  3CH2 X;  3CH3 X;  1JQP A;  4CDD B;  2BDZ A;  2DC7 A;  1ZIV A;  2AU1 A;  2PRE A;  1GX3 A;  2NQD B;  5CVN B;  3BCN A;  1AU3 A;  1YVB A;  2DZY A;  1IWD A;  2VHF A;  4HWY A;  3QSD A;  1W4T A;  9PAP A;  3S3R A;  5A24 A;  3I06 A;  4W5C A;  4N4Z A;  1ME3 A;  1AU4 A;  3D6S A;  2FRQ A;  2ACT A;  2E03 A;  4N8W A;  3HHI A;  1PE6 A;  1MIR A;  3KKU A;  3ZUA A;  1QXP A;  3CBK A;  2YJ2 A;  4PAD A;  3WXE A;  3NHE A;  2DC9 A;  3BOW A;  2G8J A;  1E2T A;  3MHS A;  3PBH A;  1KHQ A;  4WA6 A;  4FIP A;  6PAD A;  2YJ8 A;  2OP3 A;  1MDW A;  1W6F A;  2YJB A;  1MEG A;  1KXR A;  4AXM A;  1X9Y A;  1MHW A;  2AUZ A;  2R9N A;  1GCB A;  3IMA A;  1PXV A;  1ME4 A;  4QH6 A;  1NLJ A;  2HH5 A;  2YJ9 A;  4MZS A;  1DEU A;  4OEL A;  2NQA A;  1AYU A;  1QOL A;  1KHP A;  1QMY A;  3CBJ A;  2DC8 A;  1THE A;  2P86 A;  3KWB X;  4P6G A;  1PIP A;  4CDE B;  1STF E;  1KFX L;  1MEM A;  1O0E A;  3RVX A;  1POP A;  5J94 A;  4YVA A;  2WBF X;  4W5B A;  4X6J A;  4NV7 A;  4BS6 A;  2NQI A;  4YV8 A;  4Q8G A;  1NB5 A;  2PBH A;  3DF0 A;  3K24 A;  3USV A;  2CB5 A;  4NV8 A;  4X6H A;  1GEC E;  2HD5 A;  3HD3 A;  1GMY A;  2JQF R;  2F1G A;  4YYQ A;  1NL6 A;  1CJL A;  1TLO A;  3LFY A;  3OF8 A;  2DC6 A;  1EWL A;  5EGW A;  2BDL A;  4BQV A;  7PCK A;  3O1G A;  1W5R A;  1YAL A;  1EWM A;  3ERV A;  2OZ2 A;  2DCA A;  3K9M A;  3K8U A;  3HHA A;  5CVM A;  4YYU A;  4KLB A;  4YYR A;  1PBH A;  1ICF A;  3MHH A;  3KX1 A;  4OEM A;  3H6S A;  1S4V A;  1YK7 A;  4PI3 A;  4PP1 A;  2R9F A;  3KFQ A;  8PCH A;  4FK5 A;  1U5I A;  3WXG A;  1TU6 A;  3N4C A;  1SNK A;  3P5U A;  1AYV A;  3PW3 A;  3F75 A;  3QT4 A;  4DMY A;  2JQG R;  4CDC B;  1M6D A;  3F5V A;  1CS8 A;  1PCI A;  1CQD A;  1AYW A;  4CDF B;  3H7D A;  5JA7 A;  1ITO A;  1FH0 A;  5EF4 A;  4I05 A;  3BPF A;  2BSZ A;  1Q6K A;  1CV8 A;  2XU3 A;  2C0Y A;  2IBI A;  3BWK A;  4XR7 A;  2G6D A;  2IPP B;  2FRA A;  3RVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...