2DC8A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca059 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
total genus 77
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc8A00
2AVWA 2HH5A 3KWBX 2XU4A 1BY8A 3QSDA 2ARYA 2NQGA 4I05A 1F2BA 3GCBA 4CDFB 5K16A 1YK8A 2FT2A 2FRQA 3MORA 1SP4B 3WXEA 5CHVA 3H8BA 1Q6KA 3S3RA 3KX1A 3CBJA 2FRAA 2ATOA 1F2AA 4HWYA 4ZUXU 4PADA 3QT4A 4PP2E 3M99A 3RVXA 2DC7A 2R9CA 3BCNA 5JH3A 4FJCA 4W5BA 1TL9A 3N3GA 4X6HA 2OULA 1PPDA 3RVVA 4MSXA 1CS8A 2P0RA 1KFXL 3P5XA 2DJGB 2FYEA 2AS8A 4I07A 1SNKA 4BPVA 4YYUA 3WXGA 1IWDA 1YT7A 1GCBA 1JQPA 5CHTA 2IPPB 3I3TA 5CVNB 1ICFA 1AECA 1U9XA 1MEMA 3I06A 1PIPA 4OELA 4BS5A 4N79A 4YYWA 3BOWA 1XKGA 2AU1A 2FO5A 4YYVA 4P6EA 5FPWA 2GHUA 1AU3A 2AYNA 1EF7A 3K9MA 3O0UA 1MDWA 1M6DA 1AU0A 4P6GA 4OEMA 1ITOA 3CH3X 4X6JA 4QRVA 4CZWA 5A24A 2YJ2A 2R9OA 2AYOA 1PCIA 1A6RA 1ME3A 1PXVA 4YVAA 3D6SA 1S4VA 1GLOA 2AUXA 1PPOA 4QBBA 2DC6A 3IMAA 2OP3A 2VHFA 2GFOA 2NQAA 3B79A 1EWPA 1NQCA 1YK7A 2AIMA 1Y4HA 3MTNA 1KHQA 1HUCB 4PI3A 4PP1A 1BP4A 2PNSA 3P5UA 4W5CA 3N4CA 4K7CA 2YJ8A 1ZCMA 5J94A 1KXRA 2F1GA 2VHSA 2HD5A 4YYRA 3KWZA 3ERVA 1NPZA 1PADA 1CTEA 1NB5A 1CVZA 2E00A 3MHSA 3NHEA 4X6IA 3AI8A 2YJCA 2Y5BA 1O0EA 1U9VA 1ATKA 3WXFA 3H7DA 3KKUA 5CVMA 4YYQA 2P86A 3PBHA 3BPMA 1NLJA 1PE6A 3RVWA 4YYSA 2P7UA 1MHWA 1QXPA 3O1GA 2F7DA 1QOLA 1F29A 1CSBB 4I04A 5CVOB 3BWKA 4XR7A 2IBIA 5PADA 1PBHA 1CJLA 3CH2X 4FK5A 3U8EA 1NL6A 5EGWA 3S3QA 1BGOA 3KW9A 4N8WA 2R9MA 1AIMA 3ZUAA 2DC9A 2B1MA 2PADA 3K24A 4KLBA 1CPJA 4YV8A 3IOQA 4BQVA 4AXMA 2YJ9A 1EWMA 2ACTA 3OISA 4MZSA 3IUTA 3BPFA 2R9FA 2WBFX 1POPA 3OF9A 4G54A 5JA7A 2O6XA 2OZ2A 4MZOA 1MEGA 4WA6A 2Y6EA 4QRGA 2HHNA 1F2CA 3PDFA 3OVXA 2XU5A 1AU4A 3HD3A 3F5VA 2B1NA 1AYUA 4N4ZA 4QH6A 2JQGR 5F02A 3TNXA 3PNRA 4FIPA 1EWOA 3N3KA 1MIRA 3OF8A 2E02A 1CQDA 4DMYA 2BDZA 2FQ9A 3LFYA 2PREA 3E1ZB 1U5IA 1DF0A 2XU1A 4Q8GA 3MHHA 3DF0A 4W4UA 3IEJA 2DCDA 2DCAA 1U9WA 1THEA 2DZZA 1QMYA 9PAPA 2NQDB 2DCBA 1AU2A 2XU3A 3LXSA 2E03A 3H6SA 3IV2A 4XUIA 2G8EA 2E01A 3IHPA 1VSNA 2CB5A 1AYVA 3CBKA 3C9EA 1BQIA 2R9NA 3P5VA 6PADA 2DZYA 1U9QX 2DC8A 1GMYA 1CV8A 2FUDA 3P5WA 1QDQA 3PW3A 1YVBA 2CIOA 1STFE 4AXLA 4BS6A 3USVA 3HHIA 2JQFR 2G8JA 2NQIA 3H89A 3V6EA 3KSEA 2G7YA 1YALA 4CDDB 4DMXA 4Q8HA 2BDLA 2FTDA 1K3BB 7PCKA 4RY2A 1ME4A 3F75A 1NB3A 2G6DA 1FH0A 8PCHA 1TU6A 4CDEB 2R6NA 2C0YA 1CB5A 1KFUL 4QRXA 1GECE 2DJFB 1PPNA 3V6CA 3KFQA 1MS6A 3QJ3A 1Y08A 1ZIVA 2DCCA 5EF4A 1PPPA 1KHPA 2PBHA 4BSQA 3H8CA 2YJBA 2AUZA 1EWLA 1TLOA 1VJVA 3K8UA 1AYWA 3BC3A 3HHAA 3HWNA 2HXZA 1X9YA 1DEUA 2H7JA 3OVZA 4CDCB
chains in the Genus database with same CATH superfamily
4RNAA 2AVWA 2HH5A 3KWBX 2XU4A 1BY8A 3QSDA 2ARYA 2UZJA 2NQGA 4I05A 1F2BA 3GCBA 4CDFB 4RF0A 5K16A 1YK8A 2FT2A 3PRMA 2FRQA 3MORA 1SP4B 3WXEA 5CHVA 3H8BA 4HXDB 1Q6KA 3S3RA 3KX1A 3CBJA 2FRAA 2ATOA 1F2AA 4HWYA 4ZUXU 4PADA 3QT4A 4D8BA 4PP2E 3M99A 3RVXA 2DC7A 1PVJA 2R9CA 3BCNA 5JH3A 4FJCA 4W5BA 1TL9A 3N3GA 4X6HA 4GUAA 2OULA 1PPDA 3RVVA 4MSXA 1CS8A 2P0RA 2AGAA 1KFXL 3P5XA 2DJGB 2FYEA 2AS8A 4I07A 1SNKA 4BPVA 4YYUA 3WXGA 1IWDA 1YT7A 1GCBA 1JQPA 5CHTA 4MI7A 2IPPB 3I3TA 5CVNB 1ICFA 1AECA 4BOPA 1U9XA 1MEMA 4OW0A 4IUMA 3I06A 1PIPA 4OELA 4BS5A 3ZNHA 4R3DA 4N79A 3PHUA 4YYWA 3BOWA 3TMPA 1XKGA 2AU1A 2FO5A 4YYVA 4P6EA 5FPWA 2GHUA 1AU3A 2AYNA 1EF7A 3K9MA 3O0UA 1MDWA 1M6DA 1AU0A 3PSEA 4P6GA 4OEMA 1ITOA 3CH3X 4X6JA 4QRVA 1UKFA 3E9SA 4CZWA 5A24A 2YJ2A 2R9OA 3MP2A 2AYOA 1PCIA 4D8IA 1A6RA 1ME3A 1PXVA 4YVAA 3D6SA 1S4VA 1GLOA 2AUXA 1PPOA 4QBBA 2DC6A 3IMAA 2OP3A 2VHFA 2GFOA 2NQAA 4P16A 3B79A 1EWPA 1NQCA 1YK7A 2AIMA 1Y4HA 3MTNA 1KHQA 1HUCB 4PI3A 4D8EA 4PP1A 1BP4A 2PNSA 3P5UA 4W5CA 3N4CA 1DKIA 4K7CA 4REZA 2YJ8A 1ZCMA 3BY4A 5J94A 5KO3A 1KXRA 2F1GA 2VHSA 2HD5A 4YYRA 3KWZA 3ERVA 1NPZA 1PADA 1CTEA 1NB5A 1CVZA 4OVZB 2E00A 3MHSA 3NHEA 4X6IA 3AI8A 2BTWB 2YJCA 2Y5BA 1O0EA 1U9VA 1ATKA 3WXFA 3H7DA 3KKUA 5EZSA 5CVMA 4YYQA 2P86A 3PBHA 3C0RA 3BPMA 1NLJA 1PE6A 3RVWA 4YYSA 2P7UA 4RF1A 1MHWA 1QXPA 3O1GA 2F7DA 1QOLA 1F29A 1CSBB 4I04A 5CVOB 4CDCB 3BWKA 4A5UA 4XR7A 2IBIA 5PADA 1PBHA 5JZEA 1CJLA 3CH2X 4FK5A 3U8EA 3BBAA 1NL6A 4PT5A 5EGWA 3S3QA 1BGOA 3KW9A 4N8WA 2R9MA 1AIMA 3ZUAA 2DC9A 2B1MA 2PADA 3K24A 4KLBA 5E6JA 1CPJA 4YV8A 3IOQA 4BQVA 4AXMA 3PRPA 2YJ9A 1EWMA 2ACTA 3OISA 4MZSA 3IUTA 3BPFA 2R9FA 2WBFX 1POPA 3MTVA 3OF9A 3B21A 4G54A 5JA7A 2O6XA 2OZ2A 4MZOA 1MEGA 4WA6A 2Y6EA 4QRGA 2HHNA 1F2CA 3PDFA 3OVXA 2XU5A 1AU4A 3HD3A 3F5VA 2B1NA 1AYUA 4N4ZA 3RNVA 4QH6A 2JQGR 5F02A 4BOQA 3TNXA 3PNRA 4FIPA 1EWOA 3N3KA 1MIRA 3OF8A 2E02A 1CQDA 3PT2A 2BU3A 4DMYA 2BDZA 2FQ9A 3LFYA 2PREA 3E1ZB 3W30A 1U5IA 1DF0A 2XU1A 4Q8GA 3MHHA 4XZXA 3DF0A 2JRIA 3PHWA 3O65A 4W4UA 3IEJA 2DCDA 2DCAA 1U9WA 1THEA 2DZZA 1QMYA 2DOSA 9PAPA 2NQDB 2J7QC 2DCBA 1AU2A 2XU3A 3LXSA 2E03A 3H6SA 3IV2A 4XUIA 2G8EA 2E01A 3IHPA 1VSNA 3TRKA 2CB5A 1AYVA 3CBKA 3BB7A 4IP3A 4MM3B 1YZBA 3C9EA 1BQIA 2R9NA 3P5VA 6PADA 2DZYA 4BOSA 1U9QX 2DC8A 1GMYA 1CV8A 2FUDA 3P5WA 3W31A 4ZTBA 1QDQA 3PW3A 1YVBA 2CIOA 1STFE 4AXLA 4BS6A 3USVA 3HHIA 2JQFR 2G8JA 2NQIA 3H89A 2FE8A 3V6EA 3KSEA 4BOUA 2Z84A 2G7YA 1YALA 4CDDB 4DMXA 5EZQA 4RKXA 4Q8HA 2BDLA 2FTDA 1K3BB 7PCKA 2J7QA 4RY2A 1ME4A 3F75A 3OQCA 1NB3A 2HWKA 2G6DA 1FH0A 8PCHA 1TU6A 4CDEB 2R6NA 2C0YA 2JTCA 1CB5A 1KFUL 3MJ5A 4QRXA 1GECE 2DJFB 1PPNA 3V6CA 4BOZA 3KFQA 1MS6A 3QJ3A 1Y08A 1ZIVA 2DCCA 3PHXA 5EF4A 1PPPA 1KHPA 2PBHA 4BSQA 3H8CA 2YJBA 2AUZA 4M0WA 1EWLA 1TLOA 4OVZA 1VJVA 3K8UA 2BTWA 1AYWA 3BC3A 3HHAA 3IFUA 3HWNA 2HXZA 1X9YA 1DEUA 2H7JA 3OVZA 4WURA
chains in the Genus database with same CATH topology
2AVWA 2HH5A 3KWBX 2XU4A 1BY8A 3QSDA 2ARYA 2NQGA 4I05A 1F2BA 3GCBA 4CDFB 5K16A 1YK8A 2FT2A 2FRQA 3MORA 1SP4B 3WXEA 5CHVA 3H8BA 1Q6KA 3S3RA 3KX1A 3CBJA 2FRAA 2ATOA 1F2AA 4HWYA 4ZUXU 4PADA 3QT4A 4PP2E 3M99A 3RVXA 2DC7A 2R9CA 3BCNA 5JH3A 4FJCA 4W5BA 1TL9A 3N3GA 4X6HA 2OULA 1PPDA 3RVVA 4MSXA 1CS8A 2P0RA 1KFXL 3P5XA 2DJGB 2FYEA 2AS8A 4I07A 1SNKA 4BPVA 4YYUA 3WXGA 1IWDA 1YT7A 1GCBA 1W6FA 1JQPA 5CHTA 2IPPB 3I3TA 5CVNB 1ICFA 1AECA 1U9XA 1MEMA 3I06A 1PIPA 4OELA 4BS5A 4N79A 4YYWA 3BOWA 1XKGA 2AU1A 2FO5A 4YYVA 4P6EA 5FPWA 2GHUA 1AU3A 3D9WA 2AYNA 1EF7A 3K9MA 3O0UA 1MDWA 1M6DA 1AU0A 4P6GA 4OEMA 1ITOA 4GUZA 3CH3X 4X6JA 4QRVA 4CZWA 5A24A 2YJ2A 2R9OA 2AYOA 1PCIA 1A6RA 1ME3A 1PXVA 4YVAA 3D6SA 1S4VA 1GLOA 2AUXA 1PPOA 4QBBA 2DC6A 3IMAA 2OP3A 2VHFA 2GFOA 2NQAA 3B79A 1EWPA 1NQCA 1YK7A 2AIMA 1Y4HA 3MTNA 1KHQA 1HUCB 4PI3A 4PP1A 1BP4A 2PNSA 3P5UA 4W5CA 3N4CA 4K7CA 2YJ8A 1ZCMA 5J94A 1KXRA 2F1GA 2VHSA 2HD5A 4YYRA 3KWZA 3ERVA 1NPZA 1PADA 1CTEA 1NB5A 1CVZA 2E00A 3MHSA 3NHEA 4X6IA 3AI8A 2YJCA 2Y5BA 1O0EA 1U9VA 1ATKA 3WXFA 3H7DA 3KKUA 5CVMA 4YYQA 2P86A 3PBHA 3BPMA 1NLJA 1PE6A 3RVWA 4YYSA 1W5RA 2P7UA 1MHWA 1QXPA 3O1GA 2F7DA 1QOLA 1F29A 4BGFA 1CSBB 4I04A 5CVOB 3BWKA 3LTWA 4XR7A 2IBIA 5PADA 1PBHA 1CJLA 3CH2X 4FK5A 3U8EA 1NL6A 5EGWA 3S3QA 1BGOA 3KW9A 4N8WA 2R9MA 1AIMA 3ZUAA 2DC9A 2B1MA 2PADA 3K24A 4KLBA 1CPJA 4YV8A 3IOQA 4BQVA 4AXMA 2YJ9A 1EWMA 2ACTA 3OISA 4MZSA 3IUTA 3BPFA 2R9FA 2WBFX 1POPA 1GX3A 3OF9A 4G54A 5JA7A 2O6XA 2OZ2A 4MZOA 1MEGA 4WA6A 2Y6EA 4QRGA 2HHNA 1F2CA 3PDFA 3OVXA 2XU5A 1AU4A 3HD3A 3F5VA 2B1NA 1AYUA 4N4ZA 4QH6A 2JQGR 5F02A 3TNXA 3PNRA 4FIPA 1EWOA 3N3KA 1MIRA 3OF8A 2E02A 1CQDA 4DMYA 2BDZA 2FQ9A 3LFYA 2PREA 3E1ZB 1W4TA 1U5IA 1DF0A 2XU1A 4Q8GA 3MHHA 3DF0A 4W4UA 3IEJA 2DCDA 2DCAA 1U9WA 1THEA 2DZZA 1QMYA 9PAPA 2NQDB 2DCBA 1AU2A 2XU3A 3LXSA 2E03A 3H6SA 3IV2A 4XUIA 2G8EA 2E01A 3IHPA 1VSNA 2BSZA 2CB5A 1AYVA 3CBKA 3C9EA 1BQIA 2R9NA 3P5VA 6PADA 2DZYA 1U9QX 2DC8A 2VFBA 1GMYA 1CV8A 2FUDA 3P5WA 1QDQA 1E2TA 3PW3A 1YVBA 2CIOA 1STFE 4AXLA 4BS6A 3USVA 3HHIA 2JQFR 2G8JA 2NQIA 3H89A 3V6EA 3KSEA 2G7YA 1YALA 4CDDB 4DMXA 4B55A 4Q8HA 2BDLA 2FTDA 1K3BB 7PCKA 2VFCA 4RY2A 1ME4A 3F75A 4NV8A 1NB3A 2G6DA 1FH0A 8PCHA 1TU6A 4CDEB 2R6NA 2C0YA 1CB5A 1KFUL 4NV7A 4QRXA 1GECE 2DJFB 1PPNA 3V6CA 3KFQA 1MS6A 3QJ3A 1Y08A 4C5PA 1ZIVA 2DCCA 5EF4A 1PPPA 1KHPA 2PBHA 4BSQA 3H8CA 2YJBA 2AUZA 1EWLA 1TLOA 1VJVA 3K8UA 1AYWA 3BC3A 3HHAA 3HWNA 2HXZA 1X9YA 1DEUA 2H7JA 3OVZA 4CDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVW A;  2HH5 A;  3KWB X;  2XU4 A;  1BY8 A;  3QSD A;  2ARY A;  2NQG A;  4I05 A;  1F2B A;  3GCB A;  4CDF B;  5K16 A;  1YK8 A;  2FT2 A;  2FRQ A;  3MOR A;  1SP4 B;  3WXE A;  5CHV A;  3H8B A;  1Q6K A;  3S3R A;  3KX1 A;  3CBJ A;  2FRA A;  2ATO A;  1F2A A;  4HWY A;  4ZUX U;  4PAD A;  3QT4 A;  4PP2 E;  3M99 A;  3RVX A;  2DC7 A;  2R9C A;  3BCN A;  5JH3 A;  4FJC A;  4W5B A;  1TL9 A;  3N3G A;  4X6H A;  2OUL A;  1PPD A;  3RVV A;  4MSX A;  1CS8 A;  2P0R A;  1KFX L;  3P5X A;  2DJG B;  2FYE A;  2AS8 A;  4I07 A;  1SNK A;  4BPV A;  4YYU A;  3WXG A;  1IWD A;  1YT7 A;  1GCB A;  1JQP A;  5CHT A;  2IPP B;  3I3T A;  5CVN B;  1ICF A;  1AEC A;  1U9X A;  1MEM A;  3I06 A;  1PIP A;  4OEL A;  4BS5 A;  4N79 A;  4YYW A;  3BOW A;  1XKG A;  2AU1 A;  2FO5 A;  4YYV A;  4P6E A;  5FPW A;  2GHU A;  1AU3 A;  2AYN A;  1EF7 A;  3K9M A;  3O0U A;  1MDW A;  1M6D A;  1AU0 A;  4P6G A;  4OEM A;  1ITO A;  3CH3 X;  4X6J A;  4QRV A;  4CZW A;  5A24 A;  2YJ2 A;  2R9O A;  2AYO A;  1PCI A;  1A6R A;  1ME3 A;  1PXV A;  4YVA A;  3D6S A;  1S4V A;  1GLO A;  2AUX A;  1PPO A;  4QBB A;  2DC6 A;  3IMA A;  2OP3 A;  2VHF A;  2GFO A;  2NQA A;  3B79 A;  1EWP A;  1NQC A;  1YK7 A;  2AIM A;  1Y4H A;  3MTN A;  1KHQ A;  1HUC B;  4PI3 A;  4PP1 A;  1BP4 A;  2PNS A;  3P5U A;  4W5C A;  3N4C A;  4K7C A;  2YJ8 A;  1ZCM A;  5J94 A;  1KXR A;  2F1G A;  2VHS A;  2HD5 A;  4YYR A;  3KWZ A;  3ERV A;  1NPZ A;  1PAD A;  1CTE A;  1NB5 A;  1CVZ A;  2E00 A;  3MHS A;  3NHE A;  4X6I A;  3AI8 A;  2YJC A;  2Y5B A;  1O0E A;  1U9V A;  1ATK A;  3WXF A;  3H7D A;  3KKU A;  5CVM A;  4YYQ A;  2P86 A;  3PBH A;  3BPM A;  1NLJ A;  1PE6 A;  3RVW A;  4YYS A;  2P7U A;  1MHW A;  1QXP A;  3O1G A;  2F7D A;  1QOL A;  1F29 A;  1CSB B;  4I04 A;  5CVO B;  3BWK A;  4XR7 A;  2IBI A;  5PAD A;  1PBH A;  1CJL A;  3CH2 X;  4FK5 A;  3U8E A;  1NL6 A;  5EGW A;  3S3Q A;  1BGO A;  3KW9 A;  4N8W A;  2R9M A;  1AIM A;  3ZUA A;  2DC9 A;  2B1M A;  2PAD A;  3K24 A;  4KLB A;  1CPJ A;  4YV8 A;  3IOQ A;  4BQV A;  4AXM A;  2YJ9 A;  1EWM A;  2ACT A;  3OIS A;  4MZS A;  3IUT A;  3BPF A;  2R9F A;  2WBF X;  1POP A;  3OF9 A;  4G54 A;  5JA7 A;  2O6X A;  2OZ2 A;  4MZO A;  1MEG A;  4WA6 A;  2Y6E A;  4QRG A;  2HHN A;  1F2C A;  3PDF A;  3OVX A;  2XU5 A;  1AU4 A;  3HD3 A;  3F5V A;  2B1N A;  1AYU A;  4N4Z A;  4QH6 A;  2JQG R;  5F02 A;  3TNX A;  3PNR A;  4FIP A;  1EWO A;  3N3K A;  1MIR A;  3OF8 A;  2E02 A;  1CQD A;  4DMY A;  2BDZ A;  2FQ9 A;  3LFY A;  2PRE A;  3E1Z B;  1U5I A;  1DF0 A;  2XU1 A;  4Q8G A;  3MHH A;  3DF0 A;  4W4U A;  3IEJ A;  2DCD A;  2DCA A;  1U9W A;  1THE A;  2DZZ A;  1QMY A;  9PAP A;  2NQD B;  2DCB A;  1AU2 A;  2XU3 A;  3LXS A;  2E03 A;  3H6S A;  3IV2 A;  4XUI A;  2G8E A;  2E01 A;  3IHP A;  1VSN A;  2CB5 A;  1AYV A;  3CBK A;  3C9E A;  1BQI A;  2R9N A;  3P5V A;  6PAD A;  2DZY A;  1U9Q X;  2DC8 A;  1GMY A;  1CV8 A;  2FUD A;  3P5W A;  1QDQ A;  3PW3 A;  1YVB A;  2CIO A;  1STF E;  4AXL A;  4BS6 A;  3USV A;  3HHI A;  2JQF R;  2G8J A;  2NQI A;  3H89 A;  3V6E A;  3KSE A;  2G7Y A;  1YAL A;  4CDD B;  4DMX A;  4Q8H A;  2BDL A;  2FTD A;  1K3B B;  7PCK A;  4RY2 A;  1ME4 A;  3F75 A;  1NB3 A;  2G6D A;  1FH0 A;  8PCH A;  1TU6 A;  4CDE B;  2R6N A;  2C0Y A;  1CB5 A;  1KFU L;  4QRX A;  1GEC E;  2DJF B;  1PPN A;  3V6C A;  3KFQ A;  1MS6 A;  3QJ3 A;  1Y08 A;  1ZIV A;  2DCC A;  5EF4 A;  1PPP A;  1KHP A;  2PBH A;  4BSQ A;  3H8C A;  2YJB A;  2AUZ A;  1EWL A;  1TLO A;  1VJV A;  3K8U A;  1AYW A;  3BC3 A;  3HHA A;  3HWN A;  2HXZ A;  1X9Y A;  1DEU A;  2H7J A;  3OVZ A;  4CDC B; 
#chains in the Genus database with same CATH topology
 4RNA A;  2AVW A;  2HH5 A;  3KWB X;  2XU4 A;  1BY8 A;  3QSD A;  2ARY A;  2UZJ A;  2NQG A;  4I05 A;  1F2B A;  3GCB A;  4CDF B;  4RF0 A;  5K16 A;  1YK8 A;  2FT2 A;  3PRM A;  2FRQ A;  3MOR A;  1SP4 B;  3WXE A;  5CHV A;  3H8B A;  4HXD B;  1Q6K A;  3S3R A;  3KX1 A;  3CBJ A;  2FRA A;  2ATO A;  1F2A A;  4HWY A;  4ZUX U;  4PAD A;  3QT4 A;  4D8B A;  4PP2 E;  3M99 A;  3RVX A;  2DC7 A;  1PVJ A;  2R9C A;  3BCN A;  5JH3 A;  4FJC A;  4W5B A;  1TL9 A;  3N3G A;  4X6H A;  4GUA A;  2OUL A;  1PPD A;  3RVV A;  4MSX A;  1CS8 A;  2P0R A;  2AGA A;  1KFX L;  3P5X A;  2DJG B;  2FYE A;  2AS8 A;  4I07 A;  1SNK A;  4BPV A;  4YYU A;  3WXG A;  1IWD A;  1YT7 A;  1GCB A;  1JQP A;  5CHT A;  4MI7 A;  2IPP B;  3I3T A;  5CVN B;  1ICF A;  1AEC A;  4BOP A;  1U9X A;  1MEM A;  4OW0 A;  4IUM A;  3I06 A;  1PIP A;  4OEL A;  4BS5 A;  3ZNH A;  4R3D A;  4N79 A;  3PHU A;  4YYW A;  3BOW A;  3TMP A;  1XKG A;  2AU1 A;  2FO5 A;  4YYV A;  4P6E A;  5FPW A;  2GHU A;  1AU3 A;  2AYN A;  1EF7 A;  3K9M A;  3O0U A;  1MDW A;  1M6D A;  1AU0 A;  3PSE A;  4P6G A;  4OEM A;  1ITO A;  3CH3 X;  4X6J A;  4QRV A;  1UKF A;  3E9S A;  4CZW A;  5A24 A;  2YJ2 A;  2R9O A;  3MP2 A;  2AYO A;  1PCI A;  4D8I A;  1A6R A;  1ME3 A;  1PXV A;  4YVA A;  3D6S A;  1S4V A;  1GLO A;  2AUX A;  1PPO A;  4QBB A;  2DC6 A;  3IMA A;  2OP3 A;  2VHF A;  2GFO A;  2NQA A;  4P16 A;  3B79 A;  1EWP A;  1NQC A;  1YK7 A;  2AIM A;  1Y4H A;  3MTN A;  1KHQ A;  1HUC B;  4PI3 A;  4D8E A;  4PP1 A;  1BP4 A;  2PNS A;  3P5U A;  4W5C A;  3N4C A;  1DKI A;  4K7C A;  4REZ A;  2YJ8 A;  1ZCM A;  3BY4 A;  5J94 A;  5KO3 A;  1KXR A;  2F1G A;  2VHS A;  2HD5 A;  4YYR A;  3KWZ A;  3ERV A;  1NPZ A;  1PAD A;  1CTE A;  1NB5 A;  1CVZ A;  4OVZ B;  2E00 A;  3MHS A;  3NHE A;  4X6I A;  3AI8 A;  2BTW B;  2YJC A;  2Y5B A;  1O0E A;  1U9V A;  1ATK A;  3WXF A;  3H7D A;  3KKU A;  5EZS A;  5CVM A;  4YYQ A;  2P86 A;  3PBH A;  3C0R A;  3BPM A;  1NLJ A;  1PE6 A;  3RVW A;  4YYS A;  2P7U A;  4RF1 A;  1MHW A;  1QXP A;  3O1G A;  2F7D A;  1QOL A;  1F29 A;  1CSB B;  4I04 A;  5CVO B;  4CDC B;  3BWK A;  4A5U A;  4XR7 A;  2IBI A;  5PAD A;  1PBH A;  5JZE A;  1CJL A;  3CH2 X;  4FK5 A;  3U8E A;  3BBA A;  1NL6 A;  4PT5 A;  5EGW A;  3S3Q A;  1BGO A;  3KW9 A;  4N8W A;  2R9M A;  1AIM A;  3ZUA A;  2DC9 A;  2B1M A;  2PAD A;  3K24 A;  4KLB A;  5E6J A;  1CPJ A;  4YV8 A;  3IOQ A;  4BQV A;  4AXM A;  3PRP A;  2YJ9 A;  1EWM A;  2ACT A;  3OIS A;  4MZS A;  3IUT A;  3BPF A;  2R9F A;  2WBF X;  1POP A;  3MTV A;  3OF9 A;  3B21 A;  4G54 A;  5JA7 A;  2O6X A;  2OZ2 A;  4MZO A;  1MEG A;  4WA6 A;  2Y6E A;  4QRG A;  2HHN A;  1F2C A;  3PDF A;  3OVX A;  2XU5 A;  1AU4 A;  3HD3 A;  3F5V A;  2B1N A;  1AYU A;  4N4Z A;  3RNV A;  4QH6 A;  2JQG R;  5F02 A;  4BOQ A;  3TNX A;  3PNR A;  4FIP A;  1EWO A;  3N3K A;  1MIR A;  3OF8 A;  2E02 A;  1CQD A;  3PT2 A;  2BU3 A;  4DMY A;  2BDZ A;  2FQ9 A;  3LFY A;  2PRE A;  3E1Z B;  3W30 A;  1U5I A;  1DF0 A;  2XU1 A;  4Q8G A;  3MHH A;  4XZX A;  3DF0 A;  2JRI A;  3PHW A;  3O65 A;  4W4U A;  3IEJ A;  2DCD A;  2DCA A;  1U9W A;  1THE A;  2DZZ A;  1QMY A;  2DOS A;  9PAP A;  2NQD B;  2J7Q C;  2DCB A;  1AU2 A;  2XU3 A;  3LXS A;  2E03 A;  3H6S A;  3IV2 A;  4XUI A;  2G8E A;  2E01 A;  3IHP A;  1VSN A;  3TRK A;  2CB5 A;  1AYV A;  3CBK A;  3BB7 A;  4IP3 A;  4MM3 B;  1YZB A;  3C9E A;  1BQI A;  2R9N A;  3P5V A;  6PAD A;  2DZY A;  4BOS A;  1U9Q X;  2DC8 A;  1GMY A;  1CV8 A;  2FUD A;  3P5W A;  3W31 A;  4ZTB A;  1QDQ A;  3PW3 A;  1YVB A;  2CIO A;  1STF E;  4AXL A;  4BS6 A;  3USV A;  3HHI A;  2JQF R;  2G8J A;  2NQI A;  3H89 A;  2FE8 A;  3V6E A;  3KSE A;  4BOU A;  2Z84 A;  2G7Y A;  1YAL A;  4CDD B;  4DMX A;  5EZQ A;  4RKX A;  4Q8H A;  2BDL A;  2FTD A;  1K3B B;  7PCK A;  2J7Q A;  4RY2 A;  1ME4 A;  3F75 A;  3OQC A;  1NB3 A;  2HWK A;  2G6D A;  1FH0 A;  8PCH A;  1TU6 A;  4CDE B;  2R6N A;  2C0Y A;  2JTC A;  1CB5 A;  1KFU L;  3MJ5 A;  4QRX A;  1GEC E;  2DJF B;  1PPN A;  3V6C A;  4BOZ A;  3KFQ A;  1MS6 A;  3QJ3 A;  1Y08 A;  1ZIV A;  2DCC A;  3PHX A;  5EF4 A;  1PPP A;  1KHP A;  2PBH A;  4BSQ A;  3H8C A;  2YJB A;  2AUZ A;  4M0W A;  1EWL A;  1TLO A;  4OVZ A;  1VJV A;  3K8U A;  2BTW A;  1AYW A;  3BC3 A;  3HHA A;  3IFU A;  3HWN A;  2HXZ A;  1X9Y A;  1DEU A;  2H7J A;  3OVZ A;  4WUR A; 
#chains in the Genus database with same CATH homology
 2AVW A;  2HH5 A;  3KWB X;  2XU4 A;  1BY8 A;  3QSD A;  2ARY A;  2NQG A;  4I05 A;  1F2B A;  3GCB A;  4CDF B;  5K16 A;  1YK8 A;  2FT2 A;  2FRQ A;  3MOR A;  1SP4 B;  3WXE A;  5CHV A;  3H8B A;  1Q6K A;  3S3R A;  3KX1 A;  3CBJ A;  2FRA A;  2ATO A;  1F2A A;  4HWY A;  4ZUX U;  4PAD A;  3QT4 A;  4PP2 E;  3M99 A;  3RVX A;  2DC7 A;  2R9C A;  3BCN A;  5JH3 A;  4FJC A;  4W5B A;  1TL9 A;  3N3G A;  4X6H A;  2OUL A;  1PPD A;  3RVV A;  4MSX A;  1CS8 A;  2P0R A;  1KFX L;  3P5X A;  2DJG B;  2FYE A;  2AS8 A;  4I07 A;  1SNK A;  4BPV A;  4YYU A;  3WXG A;  1IWD A;  1YT7 A;  1GCB A;  1W6F A;  1JQP A;  5CHT A;  2IPP B;  3I3T A;  5CVN B;  1ICF A;  1AEC A;  1U9X A;  1MEM A;  3I06 A;  1PIP A;  4OEL A;  4BS5 A;  4N79 A;  4YYW A;  3BOW A;  1XKG A;  2AU1 A;  2FO5 A;  4YYV A;  4P6E A;  5FPW A;  2GHU A;  1AU3 A;  3D9W A;  2AYN A;  1EF7 A;  3K9M A;  3O0U A;  1MDW A;  1M6D A;  1AU0 A;  4P6G A;  4OEM A;  1ITO A;  4GUZ A;  3CH3 X;  4X6J A;  4QRV A;  4CZW A;  5A24 A;  2YJ2 A;  2R9O A;  2AYO A;  1PCI A;  1A6R A;  1ME3 A;  1PXV A;  4YVA A;  3D6S A;  1S4V A;  1GLO A;  2AUX A;  1PPO A;  4QBB A;  2DC6 A;  3IMA A;  2OP3 A;  2VHF A;  2GFO A;  2NQA A;  3B79 A;  1EWP A;  1NQC A;  1YK7 A;  2AIM A;  1Y4H A;  3MTN A;  1KHQ A;  1HUC B;  4PI3 A;  4PP1 A;  1BP4 A;  2PNS A;  3P5U A;  4W5C A;  3N4C A;  4K7C A;  2YJ8 A;  1ZCM A;  5J94 A;  1KXR A;  2F1G A;  2VHS A;  2HD5 A;  4YYR A;  3KWZ A;  3ERV A;  1NPZ A;  1PAD A;  1CTE A;  1NB5 A;  1CVZ A;  2E00 A;  3MHS A;  3NHE A;  4X6I A;  3AI8 A;  2YJC A;  2Y5B A;  1O0E A;  1U9V A;  1ATK A;  3WXF A;  3H7D A;  3KKU A;  5CVM A;  4YYQ A;  2P86 A;  3PBH A;  3BPM A;  1NLJ A;  1PE6 A;  3RVW A;  4YYS A;  1W5R A;  2P7U A;  1MHW A;  1QXP A;  3O1G A;  2F7D A;  1QOL A;  1F29 A;  4BGF A;  1CSB B;  4I04 A;  5CVO B;  3BWK A;  3LTW A;  4XR7 A;  2IBI A;  5PAD A;  1PBH A;  1CJL A;  3CH2 X;  4FK5 A;  3U8E A;  1NL6 A;  5EGW A;  3S3Q A;  1BGO A;  3KW9 A;  4N8W A;  2R9M A;  1AIM A;  3ZUA A;  2DC9 A;  2B1M A;  2PAD A;  3K24 A;  4KLB A;  1CPJ A;  4YV8 A;  3IOQ A;  4BQV A;  4AXM A;  2YJ9 A;  1EWM A;  2ACT A;  3OIS A;  4MZS A;  3IUT A;  3BPF A;  2R9F A;  2WBF X;  1POP A;  1GX3 A;  3OF9 A;  4G54 A;  5JA7 A;  2O6X A;  2OZ2 A;  4MZO A;  1MEG A;  4WA6 A;  2Y6E A;  4QRG A;  2HHN A;  1F2C A;  3PDF A;  3OVX A;  2XU5 A;  1AU4 A;  3HD3 A;  3F5V A;  2B1N A;  1AYU A;  4N4Z A;  4QH6 A;  2JQG R;  5F02 A;  3TNX A;  3PNR A;  4FIP A;  1EWO A;  3N3K A;  1MIR A;  3OF8 A;  2E02 A;  1CQD A;  4DMY A;  2BDZ A;  2FQ9 A;  3LFY A;  2PRE A;  3E1Z B;  1W4T A;  1U5I A;  1DF0 A;  2XU1 A;  4Q8G A;  3MHH A;  3DF0 A;  4W4U A;  3IEJ A;  2DCD A;  2DCA A;  1U9W A;  1THE A;  2DZZ A;  1QMY A;  9PAP A;  2NQD B;  2DCB A;  1AU2 A;  2XU3 A;  3LXS A;  2E03 A;  3H6S A;  3IV2 A;  4XUI A;  2G8E A;  2E01 A;  3IHP A;  1VSN A;  2BSZ A;  2CB5 A;  1AYV A;  3CBK A;  3C9E A;  1BQI A;  2R9N A;  3P5V A;  6PAD A;  2DZY A;  1U9Q X;  2DC8 A;  2VFB A;  1GMY A;  1CV8 A;  2FUD A;  3P5W A;  1QDQ A;  1E2T A;  3PW3 A;  1YVB A;  2CIO A;  1STF E;  4AXL A;  4BS6 A;  3USV A;  3HHI A;  2JQF R;  2G8J A;  2NQI A;  3H89 A;  3V6E A;  3KSE A;  2G7Y A;  1YAL A;  4CDD B;  4DMX A;  4B55 A;  4Q8H A;  2BDL A;  2FTD A;  1K3B B;  7PCK A;  2VFC A;  4RY2 A;  1ME4 A;  3F75 A;  4NV8 A;  1NB3 A;  2G6D A;  1FH0 A;  8PCH A;  1TU6 A;  4CDE B;  2R6N A;  2C0Y A;  1CB5 A;  1KFU L;  4NV7 A;  4QRX A;  1GEC E;  2DJF B;  1PPN A;  3V6C A;  3KFQ A;  1MS6 A;  3QJ3 A;  1Y08 A;  4C5P A;  1ZIV A;  2DCC A;  5EF4 A;  1PPP A;  1KHP A;  2PBH A;  4BSQ A;  3H8C A;  2YJB A;  2AUZ A;  1EWL A;  1TLO A;  1VJV A;  3K8U A;  1AYW A;  3BC3 A;  3HHA A;  3HWN A;  2HXZ A;  1X9Y A;  1DEU A;  2H7J A;  3OVZ A;  4CDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...