2DC8A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca059 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
molecule keywords CATHEPSIN B
total genus 77
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc8A00
3N3GA 3IMAA 1ME4A 1QMYA 3O1GA 4XR7A 3V6CA 4FK5A 2HXZA 5EGWA 2YJCA 3N4CA 4ZUXU 3HHIA 4XUIA 2NQDB 1U9VA 4DMXA 3PDFA 2DCAA 3NHEA 5CHTA 2R9MA 3QT4A 2JQGR 1PXVA 4YYRA 3GCBA 4QRVA 4YV8A 3MHHA 1ATKA 1KFUL 4MZSA 2IPPB 2DC9A 2PADA 1VJVA 1Y08A 5CVMA 3LFYA 2FYEA 3K8UA 3V6EA 2DC8A 1AIMA 2P86A 1QXPA 3WXFA 1NB5A 2FRQA 1MEMA 1PIPA 3BC3A 2GFOA 1EWMA 5F02A 1K3BB 4YYSA 3ZUAA 1DEUA 1PPOA 4X6HA 3IOQA 2G8JA 4N79A 3IUTA 4RY2A 1PPDA 3D6SA 3IEJA 4QRXA 1AU0A 3P5VA 2NQGA 4CZWA 2Y5BA 2R6NA 4N4ZA 1EWLA 1TU6A 5J94A 3HHAA 2P7UA 1QDQA 4X6IA 3QSDA 2O6XA 2E01A 4P6EA 1THEA 1O0EA 2DJGB 3QJ3A 1F29A 2AS8A 2GHUA 3H6SA 2Y6EA 3C9EA 5A24A 5CVOB 1CJLA 3MHSA 1ZIVA 5FPWA 2BDLA 3I06A 3F75A 5JA7A 6PADA 1PCIA 1AU2A 4X6JA 1A6RA 3USVA 3BPFA 3KFQA 2FTDA 3BCNA 1ZCMA 1NPZA 2E03A 5JH3A 4PADA 1ICFA 3ERVA 1ME3A 3AI8A 1MEGA 2R9NA 2DZZA 2HH5A 1XKGA 3PNRA 4MZOA 4N8WA 2YJBA 1U9WA 2FT2A 3H7DA 2PBHA 4I04A 1BP4A 3WXEA 1CSBB 3KSEA 1AYUA 1U9QX 1TL9A 3E1ZB 1YVBA 2P0RA 2F7DA 4YYQA 1Q6KA 1GMYA 2BDZA 2H7JA 2PREA 1MHWA 3O0UA 2XU5A 5PADA 1POPA 3U8EA 3OVZA 2CB5A 3N3KA 9PAPA 3CBKA 1MIRA 3OISA 3OF8A 2E02A 1CTEA 1NQCA 2E00A 3MORA 4CDCB 1F2CA 4Q8HA 4W5BA 5CVNB 1Y4HA 2YJ8A 1KFXL 2ACTA 4FJCA 4W5CA 2VHSA 4DMYA 3H8CA 3KX1A 1YK8A 3BOWA 1HUCB 1TLOA 1GLOA 3P5WA 3M99A 4W4UA 3MTNA 2F1GA 1KHPA 2CIOA 4QRGA 2C0YA 4CDEB 1EF7A 3RVVA 1YT7A 1BQIA 1FH0A 4KLBA 1NB3A 3B79A 4I07A 1PPNA 3P5UA 1PADA 4PP1A 4YYUA 3BWKA 1X9YA 3IHPA 4K7CA 1U9XA 1MDWA 4BS5A 5CHVA 3K9MA 1STFE 1CB5A 4PP2E 2DCDA 3HD3A 1AYVA 2HHNA 2R9OA 2DC6A 5EF4A 1IWDA 5K16A 2YJ9A 4OEMA 1AYWA 3KWBX 2YJ2A 1CVZA 2G6DA 3CH3X 2DZYA 2AUXA 2HD5A 1EWOA 1BY8A 1F2AA 4FIPA 4CDDB 1GCBA 3OF9A 4QBBA 1PE6A 1DF0A 2ARYA 2DC7A 3RVWA 8PCHA 2ATOA 2B1NA 1PBHA 2AU1A 4P6GA 1AU3A 2OZ2A 3IV2A 1S4VA 2NQAA 1KXRA 4BS6A 1BGOA 7PCKA 4YYVA 2DCCA 1GECE 4G54A 3H8BA 2VHFA 3I3TA 1JQPA 3H89A 4YVAA 2OP3A 2NQIA 1CV8A 4QH6A 1ITOA 4HWYA 1PPPA 2AYNA 3PW3A 1AECA 1F2BA 2JQFR 2FQ9A 2PNSA 2XU3A 1YALA 3CBJA 1EWPA 1MS6A 1KHQA 2FRAA 3K24A 4WA6A 2OULA 4MSXA 4BPVA 4BSQA 1CPJA 3OVXA 1VSNA 2R9CA 4BQVA 4AXLA 3KWZA 2AIMA 3PBHA 1M6DA 3F5VA 2FUDA 3BPMA 2DCBA 3S3QA 1CS8A 2G7YA 2AYOA 2IBIA 3TNXA 4Q8GA 4CDFB 2XU1A 1U5IA 1SP4B 2AUZA 3KW9A 3DF0A 2B1MA 1NL6A 4PI3A 2FO5A 4YYWA 3P5XA 3KKUA 1CQDA 3WXGA 1SNKA 1YK7A 2WBFX 3S3RA 3LXSA 2G8EA 4OELA 1AU4A 1QOLA 4AXMA 2XU4A 3CH2X 3RVXA 2DJFB 1NLJA 3HWNA 2AVWA 4I05A 2R9FA
chains in the Genus database with same CATH superfamily
3N3GA 3IMAA 1ME4A 1QMYA 3O1GA 4XR7A 3TRKA 3V6CA 3E9SA 4FK5A 2HXZA 5EGWA 2YJCA 1PVJA 3N4CA 3MTVA 3HHIA 4XUIA 4ZUXU 2NQDB 1U9VA 4DMXA 3PDFA 3PT2A 2DCAA 3NHEA 5CHTA 2R9MA 3QT4A 2JQGR 1PXVA 4YYRA 2JRIA 3GCBA 2UZJA 4QRVA 4YV8A 3MHHA 1ATKA 1KFUL 4MZSA 2IPPB 2DC9A 2PADA 4ZTBA 4A5UA 1VJVA 3PHUA 1Y08A 5CVMA 3LFYA 2FYEA 3K8UA 3V6EA 2DC8A 4RKXA 1AIMA 2P86A 4M0WA 1QXPA 3W30A 4IUMA 3WXFA 1NB5A 2FRQA 1MEMA 1PIPA 3BC3A 2GFOA 5EZSA 1EWMA 4OVZB 5F02A 1K3BB 3BB7A 4YYSA 3ZUAA 1DEUA 1PPOA 4X6HA 3IOQA 2G8JA 4N79A 3IUTA 4RY2A 1PPDA 3D6SA 3IEJA 4QRXA 1AU0A 3P5VA 2NQGA 4CZWA 2Y5BA 3RNVA 3IFUA 2BTWA 2R6NA 4N4ZA 1EWLA 1TU6A 5J94A 3HHAA 2P7UA 1QDQA 4X6IA 3PHWA 3QSDA 2O6XA 2E01A 4P6EA 4BOSA 1THEA 1O0EA 2DJGB 5EZQA 3QJ3A 1F29A 2AS8A 2GHUA 3H6SA 2HWKA 2Y6EA 3C9EA 5A24A 5CVOB 1CJLA 3MHSA 1ZIVA 2BDLA 5FPWA 3I06A 3F75A 5JA7A 6PADA 1PCIA 1AU2A 4X6JA 1A6RA 3USVA 4MM3B 4P16A 3BPFA 3KFQA 2FTDA 4IP3A 3BCNA 1ZCMA 1NPZA 2E03A 5JH3A 4PADA 1ICFA 3ZNHA 3ERVA 1ME3A 3AI8A 1MEGA 2R9NA 2DZZA 2HH5A 1XKGA 3PNRA 4MZOA 4N8WA 2YJBA 1U9WA 2FT2A 3H7DA 4BOZA 2PBHA 4I04A 1BP4A 3PSEA 3WXEA 1CSBB 3KSEA 1AYUA 2DOSA 4REZA 3B21A 1U9QX 1TL9A 3E1ZB 1YVBA 2P0RA 2F7DA 4XZXA 1Q6KA 1GMYA 4YYQA 2BDZA 2H7JA 4RNAA 2PREA 1MHWA 4GUAA 3O0UA 2XU5A 5PADA 1POPA 3U8EA 3OVZA 2CB5A 3N3KA 4R3DA 9PAPA 3CBKA 1MIRA 3OISA 3O65A 3OF8A 4D8EA 2AGAA 2E02A 1CTEA 1NQCA 2E00A 3MORA 4CDCB 1F2CA 4Q8HA 4W5BA 5CVNB 1Y4HA 2YJ8A 1KFXL 2FE8A 2ACTA 4FJCA 4W5CA 4MI7A 2VHSA 4DMYA 2J7QA 3H8CA 4RF1A 3KX1A 1YK8A 3BOWA 1HUCB 1TLOA 1GLOA 1YZBA 3P5WA 3M99A 4W4UA 3MTNA 2F1GA 1KHPA 2CIOA 4QRGA 4HXDB 2C0YA 5E6JA 4D8IA 4CDEB 1EF7A 3RVVA 5KO3A 1YT7A 1BQIA 1FH0A 4KLBA 1NB3A 3B79A 4I07A 1PPNA 3P5UA 1PADA 4PP1A 4YYUA 3TMPA 3BWKA 1X9YA 3IHPA 4K7CA 4WURA 1U9XA 1MDWA 4BS5A 5CHVA 3PHXA 3K9MA 1STFE 1CB5A 4RF0A 4PP2E 2DCDA 3HD3A 1AYVA 2HHNA 2R9OA 2DC6A 5EF4A 3W31A 1IWDA 5K16A 3BY4A 2YJ9A 4OEMA 1AYWA 3KWBX 2YJ2A 1CVZA 2G6DA 3CH3X 2DZYA 2AUXA 2HD5A 1EWOA 3MP2A 1BY8A 1F2AA 4FIPA 1UKFA 4CDDB 1GCBA 3OF9A 4QBBA 1PE6A 4D8BA 1DF0A 2ARYA 2DC7A 3RVWA 2BU3A 3OQCA 8PCHA 2ATOA 2B1NA 1PBHA 2AU1A 2J7QC 2Z84A 4P6GA 1AU3A 2OZ2A 3IV2A 4BOUA 1S4VA 2NQAA 4OVZA 1KXRA 4BS6A 1BGOA 7PCKA 4YYVA 2DCCA 1GECE 4G54A 3H8BA 2VHFA 3I3TA 1JQPA 3H89A 4YVAA 2OP3A 2NQIA 4OW0A 1CV8A 4QH6A 1ITOA 4HWYA 1PPPA 2AYNA 3PW3A 1AECA 1F2BA 2JQFR 2FQ9A 2PNSA 2XU3A 1YALA 3CBJA 1EWPA 1MS6A 1KHQA 1DKIA 2FRAA 3K24A 4WA6A 2OULA 4MSXA 4BPVA 4BSQA 1CPJA 3OVXA 4PT5A 3BBAA 3PRMA 1VSNA 2R9CA 4BQVA 4AXLA 3KWZA 2AIMA 3PBHA 1M6DA 3F5VA 2FUDA 3BPMA 2DCBA 3S3QA 3PRPA 2JTCA 1CS8A 2G7YA 2BTWB 2AYOA 2IBIA 3TNXA 4Q8GA 4CDFB 2XU1A 1U5IA 1SP4B 2AUZA 5JZEA 3KW9A 3DF0A 2B1MA 1NL6A 2FO5A 4PI3A 4YYWA 3P5XA 3KKUA 1CQDA 4BOPA 3WXGA 1SNKA 1YK7A 2WBFX 3S3RA 3LXSA 3C0RA 3MJ5A 2G8EA 4BOQA 4OELA 1AU4A 1QOLA 4AXMA 2XU4A 3CH2X 3RVXA 2DJFB 1NLJA 3HWNA 2AVWA 4I05A 2R9FA
chains in the Genus database with same CATH topology
3N3GA 3IMAA 1GX3A 1ME4A 1QMYA 3O1GA 4XR7A 3V6CA 1W5RA 4FK5A 2HXZA 5EGWA 2YJCA 3N4CA 4ZUXU 3HHIA 4XUIA 2NQDB 1U9VA 4DMXA 3PDFA 2DCAA 3NHEA 5CHTA 2R9MA 3QT4A 2JQGR 1PXVA 4YYRA 3GCBA 4QRVA 3D9WA 4YV8A 3MHHA 1ATKA 1KFUL 4MZSA 2IPPB 2DC9A 2PADA 1VJVA 1Y08A 5CVMA 3LFYA 2FYEA 3K8UA 3V6EA 1E2TA 2DC8A 1AIMA 2P86A 1QXPA 3WXFA 1NB5A 2FRQA 1MEMA 1PIPA 3BC3A 2GFOA 1EWMA 5F02A 1K3BB 4YYSA 3ZUAA 1DEUA 1PPOA 4X6HA 3IOQA 2G8JA 4N79A 3IUTA 4RY2A 1PPDA 3D6SA 3IEJA 4QRXA 1AU0A 3P5VA 2NQGA 4CZWA 2Y5BA 2R6NA 4N4ZA 1EWLA 1TU6A 5J94A 3HHAA 2P7UA 1QDQA 4X6IA 3QSDA 2VFBA 2VFCA 2O6XA 2E01A 4P6EA 1THEA 1O0EA 2DJGB 3QJ3A 1F29A 2AS8A 2GHUA 3H6SA 2Y6EA 3C9EA 5A24A 5CVOB 4NV8A 1CJLA 3MHSA 1ZIVA 2BDLA 5FPWA 3I06A 3F75A 5JA7A 4BGFA 6PADA 1PCIA 1AU2A 4X6JA 1A6RA 3USVA 3BPFA 3KFQA 2FTDA 3BCNA 1ZCMA 1NPZA 2E03A 5JH3A 4PADA 1ICFA 3ERVA 1ME3A 3AI8A 1MEGA 2R9NA 2DZZA 2HH5A 1XKGA 3PNRA 4MZOA 4N8WA 2YJBA 1U9WA 2FT2A 3H7DA 2PBHA 4I04A 1BP4A 3WXEA 1CSBB 3KSEA 1AYUA 1U9QX 1TL9A 3E1ZB 1YVBA 2P0RA 2F7DA 4YYQA 1Q6KA 1GMYA 2BDZA 2H7JA 2PREA 1MHWA 3O0UA 2XU5A 5PADA 1POPA 3U8EA 3OVZA 2CB5A 3N3KA 9PAPA 3CBKA 1MIRA 3OISA 3OF8A 2E02A 1NQCA 1CTEA 2E00A 3MORA 4CDCB 1F2CA 4Q8HA 4W5BA 5CVNB 1Y4HA 2YJ8A 1KFXL 2ACTA 4FJCA 4W5CA 2VHSA 4DMYA 3H8CA 3KX1A 1YK8A 3BOWA 1HUCB 1TLOA 1GLOA 3P5WA 3M99A 4W4UA 3MTNA 2F1GA 1KHPA 2CIOA 4QRGA 2C0YA 4CDEB 1EF7A 3RVVA 1YT7A 1BQIA 1FH0A 3LTWA 4KLBA 1NB3A 3B79A 4I07A 1PPNA 3P5UA 1PADA 4PP1A 4YYUA 3BWKA 1X9YA 3IHPA 4K7CA 1U9XA 1MDWA 4BS5A 5CHVA 3K9MA 1STFE 1CB5A 4PP2E 2DCDA 3HD3A 1AYVA 2HHNA 2R9OA 2DC6A 5EF4A 2BSZA 1IWDA 5K16A 2YJ9A 4OEMA 1AYWA 3KWBX 2YJ2A 1CVZA 2G6DA 3CH3X 2DZYA 2AUXA 2HD5A 1EWOA 4NV7A 1BY8A 1F2AA 4FIPA 4CDDB 4C5PA 1GCBA 3OF9A 4QBBA 1PE6A 1DF0A 2ARYA 2DC7A 3RVWA 8PCHA 2ATOA 2B1NA 1PBHA 2AU1A 4P6GA 1AU3A 2OZ2A 3IV2A 1S4VA 2NQAA 1KXRA 4BS6A 1BGOA 7PCKA 4YYVA 2DCCA 1GECE 1W6FA 4G54A 3H8BA 2VHFA 3I3TA 1JQPA 3H89A 4YVAA 2OP3A 2NQIA 1CV8A 4QH6A 1ITOA 4HWYA 1PPPA 2AYNA 3PW3A 1AECA 1F2BA 2JQFR 2FQ9A 2PNSA 2XU3A 1YALA 3CBJA 1EWPA 1MS6A 1KHQA 2FRAA 3K24A 4WA6A 2OULA 4MSXA 4BPVA 4BSQA 1CPJA 3OVXA 4GUZA 1VSNA 2R9CA 4BQVA 4AXLA 3KWZA 2AIMA 3PBHA 1M6DA 3F5VA 2FUDA 3BPMA 2DCBA 3S3QA 1CS8A 2G7YA 2AYOA 2IBIA 3TNXA 4Q8GA 4CDFB 2XU1A 1U5IA 1SP4B 2AUZA 3KW9A 3DF0A 2B1MA 1NL6A 4PI3A 2FO5A 4YYWA 3P5XA 3KKUA 1CQDA 3WXGA 1SNKA 1YK7A 2WBFX 1W4TA 3S3RA 4B55A 3LXSA 2G8EA 4OELA 1AU4A 1QOLA 4AXMA 2XU4A 3CH2X 3RVXA 2DJFB 1NLJA 3HWNA 2AVWA 4I05A 2R9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3G A;  3IMA A;  1ME4 A;  1QMY A;  3O1G A;  4XR7 A;  3V6C A;  4FK5 A;  2HXZ A;  5EGW A;  2YJC A;  3N4C A;  4ZUX U;  3HHI A;  4XUI A;  2NQD B;  1U9V A;  4DMX A;  3PDF A;  2DCA A;  3NHE A;  5CHT A;  2R9M A;  3QT4 A;  2JQG R;  1PXV A;  4YYR A;  3GCB A;  4QRV A;  4YV8 A;  3MHH A;  1ATK A;  1KFU L;  4MZS A;  2IPP B;  2DC9 A;  2PAD A;  1VJV A;  1Y08 A;  5CVM A;  3LFY A;  2FYE A;  3K8U A;  3V6E A;  2DC8 A;  1AIM A;  2P86 A;  1QXP A;  3WXF A;  1NB5 A;  2FRQ A;  1MEM A;  1PIP A;  3BC3 A;  2GFO A;  1EWM A;  5F02 A;  1K3B B;  4YYS A;  3ZUA A;  1DEU A;  1PPO A;  4X6H A;  3IOQ A;  2G8J A;  4N79 A;  3IUT A;  4RY2 A;  1PPD A;  3D6S A;  3IEJ A;  4QRX A;  1AU0 A;  3P5V A;  2NQG A;  4CZW A;  2Y5B A;  2R6N A;  4N4Z A;  1EWL A;  1TU6 A;  5J94 A;  3HHA A;  2P7U A;  1QDQ A;  4X6I A;  3QSD A;  2O6X A;  2E01 A;  4P6E A;  1THE A;  1O0E A;  2DJG B;  3QJ3 A;  1F29 A;  2AS8 A;  2GHU A;  3H6S A;  2Y6E A;  3C9E A;  5A24 A;  5CVO B;  1CJL A;  3MHS A;  1ZIV A;  5FPW A;  2BDL A;  3I06 A;  3F75 A;  5JA7 A;  6PAD A;  1PCI A;  1AU2 A;  4X6J A;  1A6R A;  3USV A;  3BPF A;  3KFQ A;  2FTD A;  3BCN A;  1ZCM A;  1NPZ A;  2E03 A;  5JH3 A;  4PAD A;  1ICF A;  3ERV A;  1ME3 A;  3AI8 A;  1MEG A;  2R9N A;  2DZZ A;  2HH5 A;  1XKG A;  3PNR A;  4MZO A;  4N8W A;  2YJB A;  1U9W A;  2FT2 A;  3H7D A;  2PBH A;  4I04 A;  1BP4 A;  3WXE A;  1CSB B;  3KSE A;  1AYU A;  1U9Q X;  1TL9 A;  3E1Z B;  1YVB A;  2P0R A;  2F7D A;  4YYQ A;  1Q6K A;  1GMY A;  2BDZ A;  2H7J A;  2PRE A;  1MHW A;  3O0U A;  2XU5 A;  5PAD A;  1POP A;  3U8E A;  3OVZ A;  2CB5 A;  3N3K A;  9PAP A;  3CBK A;  1MIR A;  3OIS A;  3OF8 A;  2E02 A;  1CTE A;  1NQC A;  2E00 A;  3MOR A;  4CDC B;  1F2C A;  4Q8H A;  4W5B A;  5CVN B;  1Y4H A;  2YJ8 A;  1KFX L;  2ACT A;  4FJC A;  4W5C A;  2VHS A;  4DMY A;  3H8C A;  3KX1 A;  1YK8 A;  3BOW A;  1HUC B;  1TLO A;  1GLO A;  3P5W A;  3M99 A;  4W4U A;  3MTN A;  2F1G A;  1KHP A;  2CIO A;  4QRG A;  2C0Y A;  4CDE B;  1EF7 A;  3RVV A;  1YT7 A;  1BQI A;  1FH0 A;  4KLB A;  1NB3 A;  3B79 A;  4I07 A;  1PPN A;  3P5U A;  1PAD A;  4PP1 A;  4YYU A;  3BWK A;  1X9Y A;  3IHP A;  4K7C A;  1U9X A;  1MDW A;  4BS5 A;  5CHV A;  3K9M A;  1STF E;  1CB5 A;  4PP2 E;  2DCD A;  3HD3 A;  1AYV A;  2HHN A;  2R9O A;  2DC6 A;  5EF4 A;  1IWD A;  5K16 A;  2YJ9 A;  4OEM A;  1AYW A;  3KWB X;  2YJ2 A;  1CVZ A;  2G6D A;  3CH3 X;  2DZY A;  2AUX A;  2HD5 A;  1EWO A;  1BY8 A;  1F2A A;  4FIP A;  4CDD B;  1GCB A;  3OF9 A;  4QBB A;  1PE6 A;  1DF0 A;  2ARY A;  2DC7 A;  3RVW A;  8PCH A;  2ATO A;  2B1N A;  1PBH A;  2AU1 A;  4P6G A;  1AU3 A;  2OZ2 A;  3IV2 A;  1S4V A;  2NQA A;  1KXR A;  4BS6 A;  1BGO A;  7PCK A;  4YYV A;  2DCC A;  1GEC E;  4G54 A;  3H8B A;  2VHF A;  3I3T A;  1JQP A;  3H89 A;  4YVA A;  2OP3 A;  2NQI A;  1CV8 A;  4QH6 A;  1ITO A;  4HWY A;  1PPP A;  2AYN A;  3PW3 A;  1AEC A;  1F2B A;  2JQF R;  2FQ9 A;  2PNS A;  2XU3 A;  1YAL A;  3CBJ A;  1EWP A;  1MS6 A;  1KHQ A;  2FRA A;  3K24 A;  4WA6 A;  2OUL A;  4MSX A;  4BPV A;  4BSQ A;  1CPJ A;  3OVX A;  1VSN A;  2R9C A;  4BQV A;  4AXL A;  3KWZ A;  2AIM A;  3PBH A;  1M6D A;  3F5V A;  2FUD A;  3BPM A;  2DCB A;  3S3Q A;  1CS8 A;  2G7Y A;  2AYO A;  2IBI A;  3TNX A;  4Q8G A;  4CDF B;  2XU1 A;  1U5I A;  1SP4 B;  2AUZ A;  3KW9 A;  3DF0 A;  2B1M A;  1NL6 A;  4PI3 A;  2FO5 A;  4YYW A;  3P5X A;  3KKU A;  1CQD A;  3WXG A;  1SNK A;  1YK7 A;  2WBF X;  3S3R A;  3LXS A;  2G8E A;  4OEL A;  1AU4 A;  1QOL A;  4AXM A;  2XU4 A;  3CH2 X;  3RVX A;  2DJF B;  1NLJ A;  3HWN A;  2AVW A;  4I05 A;  2R9F A; 
#chains in the Genus database with same CATH topology
 3N3G A;  3IMA A;  1ME4 A;  1QMY A;  3O1G A;  4XR7 A;  3TRK A;  3V6C A;  3E9S A;  4FK5 A;  2HXZ A;  5EGW A;  2YJC A;  1PVJ A;  3N4C A;  3MTV A;  3HHI A;  4XUI A;  4ZUX U;  2NQD B;  1U9V A;  4DMX A;  3PDF A;  3PT2 A;  2DCA A;  3NHE A;  5CHT A;  2R9M A;  3QT4 A;  2JQG R;  1PXV A;  4YYR A;  2JRI A;  3GCB A;  2UZJ A;  4QRV A;  4YV8 A;  3MHH A;  1ATK A;  1KFU L;  4MZS A;  2IPP B;  2DC9 A;  2PAD A;  4ZTB A;  4A5U A;  1VJV A;  3PHU A;  1Y08 A;  5CVM A;  3LFY A;  2FYE A;  3K8U A;  3V6E A;  2DC8 A;  4RKX A;  1AIM A;  2P86 A;  4M0W A;  1QXP A;  3W30 A;  4IUM A;  3WXF A;  1NB5 A;  2FRQ A;  1MEM A;  1PIP A;  3BC3 A;  2GFO A;  5EZS A;  1EWM A;  4OVZ B;  5F02 A;  1K3B B;  3BB7 A;  4YYS A;  3ZUA A;  1DEU A;  1PPO A;  4X6H A;  3IOQ A;  2G8J A;  4N79 A;  3IUT A;  4RY2 A;  1PPD A;  3D6S A;  3IEJ A;  4QRX A;  1AU0 A;  3P5V A;  2NQG A;  4CZW A;  2Y5B A;  3RNV A;  3IFU A;  2BTW A;  2R6N A;  4N4Z A;  1EWL A;  1TU6 A;  5J94 A;  3HHA A;  2P7U A;  1QDQ A;  4X6I A;  3PHW A;  3QSD A;  2O6X A;  2E01 A;  4P6E A;  4BOS A;  1THE A;  1O0E A;  2DJG B;  5EZQ A;  3QJ3 A;  1F29 A;  2AS8 A;  2GHU A;  3H6S A;  2HWK A;  2Y6E A;  3C9E A;  5A24 A;  5CVO B;  1CJL A;  3MHS A;  1ZIV A;  2BDL A;  5FPW A;  3I06 A;  3F75 A;  5JA7 A;  6PAD A;  1PCI A;  1AU2 A;  4X6J A;  1A6R A;  3USV A;  4MM3 B;  4P16 A;  3BPF A;  3KFQ A;  2FTD A;  4IP3 A;  3BCN A;  1ZCM A;  1NPZ A;  2E03 A;  5JH3 A;  4PAD A;  1ICF A;  3ZNH A;  3ERV A;  1ME3 A;  3AI8 A;  1MEG A;  2R9N A;  2DZZ A;  2HH5 A;  1XKG A;  3PNR A;  4MZO A;  4N8W A;  2YJB A;  1U9W A;  2FT2 A;  3H7D A;  4BOZ A;  2PBH A;  4I04 A;  1BP4 A;  3PSE A;  3WXE A;  1CSB B;  3KSE A;  1AYU A;  2DOS A;  4REZ A;  3B21 A;  1U9Q X;  1TL9 A;  3E1Z B;  1YVB A;  2P0R A;  2F7D A;  4XZX A;  1Q6K A;  1GMY A;  4YYQ A;  2BDZ A;  2H7J A;  4RNA A;  2PRE A;  1MHW A;  4GUA A;  3O0U A;  2XU5 A;  5PAD A;  1POP A;  3U8E A;  3OVZ A;  2CB5 A;  3N3K A;  4R3D A;  9PAP A;  3CBK A;  1MIR A;  3OIS A;  3O65 A;  3OF8 A;  4D8E A;  2AGA A;  2E02 A;  1CTE A;  1NQC A;  2E00 A;  3MOR A;  4CDC B;  1F2C A;  4Q8H A;  4W5B A;  5CVN B;  1Y4H A;  2YJ8 A;  1KFX L;  2FE8 A;  2ACT A;  4FJC A;  4W5C A;  4MI7 A;  2VHS A;  4DMY A;  2J7Q A;  3H8C A;  4RF1 A;  3KX1 A;  1YK8 A;  3BOW A;  1HUC B;  1TLO A;  1GLO A;  1YZB A;  3P5W A;  3M99 A;  4W4U A;  3MTN A;  2F1G A;  1KHP A;  2CIO A;  4QRG A;  4HXD B;  2C0Y A;  5E6J A;  4D8I A;  4CDE B;  1EF7 A;  3RVV A;  5KO3 A;  1YT7 A;  1BQI A;  1FH0 A;  4KLB A;  1NB3 A;  3B79 A;  4I07 A;  1PPN A;  3P5U A;  1PAD A;  4PP1 A;  4YYU A;  3TMP A;  3BWK A;  1X9Y A;  3IHP A;  4K7C A;  4WUR A;  1U9X A;  1MDW A;  4BS5 A;  5CHV A;  3PHX A;  3K9M A;  1STF E;  1CB5 A;  4RF0 A;  4PP2 E;  2DCD A;  3HD3 A;  1AYV A;  2HHN A;  2R9O A;  2DC6 A;  5EF4 A;  3W31 A;  1IWD A;  5K16 A;  3BY4 A;  2YJ9 A;  4OEM A;  1AYW A;  3KWB X;  2YJ2 A;  1CVZ A;  2G6D A;  3CH3 X;  2DZY A;  2AUX A;  2HD5 A;  1EWO A;  3MP2 A;  1BY8 A;  1F2A A;  4FIP A;  1UKF A;  4CDD B;  1GCB A;  3OF9 A;  4QBB A;  1PE6 A;  4D8B A;  1DF0 A;  2ARY A;  2DC7 A;  3RVW A;  2BU3 A;  3OQC A;  8PCH A;  2ATO A;  2B1N A;  1PBH A;  2AU1 A;  2J7Q C;  2Z84 A;  4P6G A;  1AU3 A;  2OZ2 A;  3IV2 A;  4BOU A;  1S4V A;  2NQA A;  4OVZ A;  1KXR A;  4BS6 A;  1BGO A;  7PCK A;  4YYV A;  2DCC A;  1GEC E;  4G54 A;  3H8B A;  2VHF A;  3I3T A;  1JQP A;  3H89 A;  4YVA A;  2OP3 A;  2NQI A;  4OW0 A;  1CV8 A;  4QH6 A;  1ITO A;  4HWY A;  1PPP A;  2AYN A;  3PW3 A;  1AEC A;  1F2B A;  2JQF R;  2FQ9 A;  2PNS A;  2XU3 A;  1YAL A;  3CBJ A;  1EWP A;  1MS6 A;  1KHQ A;  1DKI A;  2FRA A;  3K24 A;  4WA6 A;  2OUL A;  4MSX A;  4BPV A;  4BSQ A;  1CPJ A;  3OVX A;  4PT5 A;  3BBA A;  3PRM A;  1VSN A;  2R9C A;  4BQV A;  4AXL A;  3KWZ A;  2AIM A;  3PBH A;  1M6D A;  3F5V A;  2FUD A;  3BPM A;  2DCB A;  3S3Q A;  3PRP A;  2JTC A;  1CS8 A;  2G7Y A;  2BTW B;  2AYO A;  2IBI A;  3TNX A;  4Q8G A;  4CDF B;  2XU1 A;  1U5I A;  1SP4 B;  2AUZ A;  5JZE A;  3KW9 A;  3DF0 A;  2B1M A;  1NL6 A;  2FO5 A;  4PI3 A;  4YYW A;  3P5X A;  3KKU A;  1CQD A;  4BOP A;  3WXG A;  1SNK A;  1YK7 A;  2WBF X;  3S3R A;  3LXS A;  3C0R A;  3MJ5 A;  2G8E A;  4BOQ A;  4OEL A;  1AU4 A;  1QOL A;  4AXM A;  2XU4 A;  3CH2 X;  3RVX A;  2DJF B;  1NLJ A;  3HWN A;  2AVW A;  4I05 A;  2R9F A; 
#chains in the Genus database with same CATH homology
 3N3G A;  3IMA A;  1GX3 A;  1ME4 A;  1QMY A;  3O1G A;  4XR7 A;  3V6C A;  1W5R A;  4FK5 A;  2HXZ A;  5EGW A;  2YJC A;  3N4C A;  4ZUX U;  3HHI A;  4XUI A;  2NQD B;  1U9V A;  4DMX A;  3PDF A;  2DCA A;  3NHE A;  5CHT A;  2R9M A;  3QT4 A;  2JQG R;  1PXV A;  4YYR A;  3GCB A;  4QRV A;  3D9W A;  4YV8 A;  3MHH A;  1ATK A;  1KFU L;  4MZS A;  2IPP B;  2DC9 A;  2PAD A;  1VJV A;  1Y08 A;  5CVM A;  3LFY A;  2FYE A;  3K8U A;  3V6E A;  1E2T A;  2DC8 A;  1AIM A;  2P86 A;  1QXP A;  3WXF A;  1NB5 A;  2FRQ A;  1MEM A;  1PIP A;  3BC3 A;  2GFO A;  1EWM A;  5F02 A;  1K3B B;  4YYS A;  3ZUA A;  1DEU A;  1PPO A;  4X6H A;  3IOQ A;  2G8J A;  4N79 A;  3IUT A;  4RY2 A;  1PPD A;  3D6S A;  3IEJ A;  4QRX A;  1AU0 A;  3P5V A;  2NQG A;  4CZW A;  2Y5B A;  2R6N A;  4N4Z A;  1EWL A;  1TU6 A;  5J94 A;  3HHA A;  2P7U A;  1QDQ A;  4X6I A;  3QSD A;  2VFB A;  2VFC A;  2O6X A;  2E01 A;  4P6E A;  1THE A;  1O0E A;  2DJG B;  3QJ3 A;  1F29 A;  2AS8 A;  2GHU A;  3H6S A;  2Y6E A;  3C9E A;  5A24 A;  5CVO B;  4NV8 A;  1CJL A;  3MHS A;  1ZIV A;  2BDL A;  5FPW A;  3I06 A;  3F75 A;  5JA7 A;  4BGF A;  6PAD A;  1PCI A;  1AU2 A;  4X6J A;  1A6R A;  3USV A;  3BPF A;  3KFQ A;  2FTD A;  3BCN A;  1ZCM A;  1NPZ A;  2E03 A;  5JH3 A;  4PAD A;  1ICF A;  3ERV A;  1ME3 A;  3AI8 A;  1MEG A;  2R9N A;  2DZZ A;  2HH5 A;  1XKG A;  3PNR A;  4MZO A;  4N8W A;  2YJB A;  1U9W A;  2FT2 A;  3H7D A;  2PBH A;  4I04 A;  1BP4 A;  3WXE A;  1CSB B;  3KSE A;  1AYU A;  1U9Q X;  1TL9 A;  3E1Z B;  1YVB A;  2P0R A;  2F7D A;  4YYQ A;  1Q6K A;  1GMY A;  2BDZ A;  2H7J A;  2PRE A;  1MHW A;  3O0U A;  2XU5 A;  5PAD A;  1POP A;  3U8E A;  3OVZ A;  2CB5 A;  3N3K A;  9PAP A;  3CBK A;  1MIR A;  3OIS A;  3OF8 A;  2E02 A;  1NQC A;  1CTE A;  2E00 A;  3MOR A;  4CDC B;  1F2C A;  4Q8H A;  4W5B A;  5CVN B;  1Y4H A;  2YJ8 A;  1KFX L;  2ACT A;  4FJC A;  4W5C A;  2VHS A;  4DMY A;  3H8C A;  3KX1 A;  1YK8 A;  3BOW A;  1HUC B;  1TLO A;  1GLO A;  3P5W A;  3M99 A;  4W4U A;  3MTN A;  2F1G A;  1KHP A;  2CIO A;  4QRG A;  2C0Y A;  4CDE B;  1EF7 A;  3RVV A;  1YT7 A;  1BQI A;  1FH0 A;  3LTW A;  4KLB A;  1NB3 A;  3B79 A;  4I07 A;  1PPN A;  3P5U A;  1PAD A;  4PP1 A;  4YYU A;  3BWK A;  1X9Y A;  3IHP A;  4K7C A;  1U9X A;  1MDW A;  4BS5 A;  5CHV A;  3K9M A;  1STF E;  1CB5 A;  4PP2 E;  2DCD A;  3HD3 A;  1AYV A;  2HHN A;  2R9O A;  2DC6 A;  5EF4 A;  2BSZ A;  1IWD A;  5K16 A;  2YJ9 A;  4OEM A;  1AYW A;  3KWB X;  2YJ2 A;  1CVZ A;  2G6D A;  3CH3 X;  2DZY A;  2AUX A;  2HD5 A;  1EWO A;  4NV7 A;  1BY8 A;  1F2A A;  4FIP A;  4CDD B;  4C5P A;  1GCB A;  3OF9 A;  4QBB A;  1PE6 A;  1DF0 A;  2ARY A;  2DC7 A;  3RVW A;  8PCH A;  2ATO A;  2B1N A;  1PBH A;  2AU1 A;  4P6G A;  1AU3 A;  2OZ2 A;  3IV2 A;  1S4V A;  2NQA A;  1KXR A;  4BS6 A;  1BGO A;  7PCK A;  4YYV A;  2DCC A;  1GEC E;  1W6F A;  4G54 A;  3H8B A;  2VHF A;  3I3T A;  1JQP A;  3H89 A;  4YVA A;  2OP3 A;  2NQI A;  1CV8 A;  4QH6 A;  1ITO A;  4HWY A;  1PPP A;  2AYN A;  3PW3 A;  1AEC A;  1F2B A;  2JQF R;  2FQ9 A;  2PNS A;  2XU3 A;  1YAL A;  3CBJ A;  1EWP A;  1MS6 A;  1KHQ A;  2FRA A;  3K24 A;  4WA6 A;  2OUL A;  4MSX A;  4BPV A;  4BSQ A;  1CPJ A;  3OVX A;  4GUZ A;  1VSN A;  2R9C A;  4BQV A;  4AXL A;  3KWZ A;  2AIM A;  3PBH A;  1M6D A;  3F5V A;  2FUD A;  3BPM A;  2DCB A;  3S3Q A;  1CS8 A;  2G7Y A;  2AYO A;  2IBI A;  3TNX A;  4Q8G A;  4CDF B;  2XU1 A;  1U5I A;  1SP4 B;  2AUZ A;  3KW9 A;  3DF0 A;  2B1M A;  1NL6 A;  4PI3 A;  2FO5 A;  4YYW A;  3P5X A;  3KKU A;  1CQD A;  3WXG A;  1SNK A;  1YK7 A;  2WBF X;  1W4T A;  3S3R A;  4B55 A;  3LXS A;  2G8E A;  4OEL A;  1AU4 A;  1QOL A;  4AXM A;  2XU4 A;  3CH2 X;  3RVX A;  2DJF B;  1NLJ A;  3HWN A;  2AVW A;  4I05 A;  2R9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...