2DC8A

X-ray crystal structure analysis of bovine spleen cathepsin b-ca059 complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
total genus 77
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dc8A00
1AECA 1EWPA 3H8BA 1NL6A 2DC6A 3MORA 2AVWA 2FQ9A 2FYEA 1CB5A 4WA6A 5CVMA 3QSDA 3F5VA 2YJBA 4YYUA 4PP1A 6PADA 3BOWA 3KWBX 1U9QX 4YYRA 3K24A 3PNRA 1ME4A 3MHSA 4QRXA 1M6DA 5EF4A 4YYQA 1EWMA 1AIMA 2DCCA 4BQVA 3HWNA 4N4ZA 4CDCB 4QBBA 5EGWA 1X9YA 5JH3A 1FH0A 2FRAA 4YYWA 3P5WA 7PCKA 4MSXA 4KLBA 4DMXA 4Q8HA 2R9CA 3H8CA 1AYWA 4XUIA 3WXEA 2BDLA 2ARYA 1ATKA 1Y08A 4RY2A 2AU1A 1AU0A 5CHTA 1BP4A 2PBHA 1U9XA 1PPOA 3V6EA 1CS8A 1U5IA 4X6IA 1PXVA 1YT7A 2WBFX 3KFQA 1PBHA 2CIOA 3USVA 2P86A 2G7YA 1IWDA 2YJ9A 3IUTA 1CSBB 1QMYA 2VHSA 5F02A 2OP3A 1QDQA 2NQAA 2AS8A 4YYSA 4QRGA 4G54A 3CBKA 1KFXL 2DC9A 3H7DA 3BWKA 1GLOA 3KX1A 4YYVA 1F29A 3O0UA 2G8JA 1ICFA 2E01A 3QT4A 1BGOA 1SP4B 2VHFA 5PADA 1YVBA 3KWZA 1MIRA 1XKGA 2NQDB 1F2BA 1NB3A 2NQGA 2PREA 3MTNA 1KHQA 2F7DA 2FO5A 5A24A 1GCBA 2HD5A 4AXLA 2XU3A 1JQPA 1CVZA 2R9OA 2F1GA 2O6XA 2ATOA 1PIPA 2JQGR 1TLOA 3BPMA 1Y4HA 4X6HA 3ZUAA 1SNKA 4OELA 2FUDA 2FRQA 1CPJA 1YK8A 1PCIA 2CB5A 3I3TA 4BPVA 5K16A 2AUXA 1U9WA 2OZ2A 2GHUA 4CDEB 1PADA 1QXPA 1ZIVA 3DF0A 3E1ZB 5FPWA 3V6CA 4K7CA 3LFYA 3F75A 2DJGB 1NB5A 1Q6KA 3N3GA 5JA7A 5CVNB 3CH3X 1TL9A 3S3QA 3LXSA 2P7UA 1MHWA 1YK7A 2ACTA 2AYNA 4PADA 2DC7A 2G6DA 4AXMA 2FT2A 2IBIA 3KW9A 4FIPA 1PPPA 3HHIA 1GMYA 3H6SA 3P5UA 1ZCMA 3P5VA 4FJCA 1CQDA 4BSQA 2E02A 1HUCB 2XU4A 3KKUA 4PP2E 2B1NA 4W4UA 4DMYA 3RVVA 4P6EA 1F2CA 2AYOA 1U9VA 3N4CA 2IPPB 4MZSA 2YJ8A 3I06A 4CZWA 1KFUL 3PBHA 4CDDB 4I04A 1EF7A 1K3BB 4BS5A 3CBJA 1PPDA 3QJ3A 8PCHA 3BPFA 1YALA 3OF8A 1MEMA 1GECE 1O0EA 4N8WA 4OEMA 3RVXA 4P6GA 4XR7A 3PDFA 1BQIA 1KXRA 1KHPA 1AU2A 1CV8A 2R6NA 2AUZA 3BC3A 4QH6A 1AU3A 2XU5A 3D6SA 1AYUA 2DCBA 3C9EA 4FK5A 1CJLA 3NHEA 3CH2X 2R9FA 5CHVA 3TNXA 1A6RA 2DC8A 3WXGA 1PE6A 4X6JA 1AU4A 1VSNA 2B1MA 4W5CA 4MZOA 1THEA 2Y5BA 1BY8A 2PADA 2FTDA 1S4VA 1EWLA 3OISA 5CVOB 3AI8A 1MS6A 2C0YA 4W5BA 3IHPA 2DZYA 2R9MA 4I05A 4BS6A 3OVXA 2DCAA 3U8EA 2BDZA 3M99A 3P5XA 3IEJA 2NQIA 3PW3A 1NLJA 2H7JA 1DEUA 2HXZA 1VJVA 3O1GA 1MDWA 2OULA 1TU6A 3GCBA 1PPNA 2XU1A 2HHNA 2DCDA 3K8UA 3N3KA 3K9MA 3HHAA 3BCNA 2DZZA 2G8EA 2PNSA 4Q8GA 5J94A 3B79A 1QOLA 4ZUXU 2GFOA 3MHHA 2R9NA 1DF0A 4QRVA 1AYVA 4I07A 4PI3A 2E00A 4YV8A 2HH5A 2JQFR 2AIMA 9PAPA 4YVAA 3IV2A 2Y6EA 2YJCA 3HD3A 2YJ2A 3WXFA 4HWYA 3OVZA 4N79A 3IMAA 3KSEA 1NPZA 1ME3A 1ITOA 3RVWA 4CDFB 1CTEA 3OF9A 1EWOA 3S3RA 3IOQA 3H89A 2E03A 1NQCA 3ERVA 2P0RA 1MEGA 2DJFB 1STFE 1F2AA 1POPA
chains in the Genus database with same CATH superfamily
1AECA 1EWPA 3H8BA 1NL6A 2DC6A 3MORA 3TMPA 2AVWA 2FQ9A 2FYEA 1CB5A 4WA6A 4M0WA 2J7QC 5CVMA 3QSDA 3F5VA 3E9SA 2YJBA 4YYUA 4PP1A 6PADA 3BOWA 3BBAA 3KWBX 1U9QX 4YYRA 3K24A 1YZBA 3PNRA 1ME4A 3MHSA 4QRXA 1M6DA 5EF4A 4D8IA 4YYQA 1EWMA 1AIMA 2DCCA 4BQVA 3HWNA 4N4ZA 4CDCB 4QBBA 5EGWA 1X9YA 5JH3A 2J7QA 1FH0A 3PHWA 3MP2A 2FRAA 3PRMA 4YYWA 3P5WA 1UKFA 4D8BA 7PCKA 4MSXA 4KLBA 2BU3A 4DMXA 4Q8HA 2R9CA 3H8CA 4REZA 1AYWA 4XUIA 3WXEA 4A5UA 2BDLA 2ARYA 4OVZA 3RNVA 4RNAA 1ATKA 4D8EA 1Y08A 4RY2A 2AU1A 4BOZA 1AU0A 5CHTA 1BP4A 2PBHA 1U9XA 1PPOA 3V6EA 1CS8A 1U5IA 4X6IA 5JZEA 1PXVA 1YT7A 2WBFX 3KFQA 1PBHA 2CIOA 3USVA 2P86A 2BTWA 2G7YA 1IWDA 3PRPA 2YJ9A 3MTVA 3IUTA 1CSBB 1QMYA 2Z84A 2VHSA 5F02A 2OP3A 1QDQA 2NQAA 2AS8A 4YYSA 4QRGA 4G54A 3CBKA 1KFXL 2DC9A 3H7DA 3BWKA 1GLOA 3KX1A 4YYVA 1F29A 3O0UA 2G8JA 1ICFA 2E01A 3QT4A 1BGOA 1SP4B 4RKXA 2VHFA 1DKIA 5PADA 1YVBA 4MM3B 3KWZA 1MIRA 1XKGA 2NQDB 1F2BA 3OQCA 1NB3A 2FE8A 2NQGA 2PREA 4BOUA 3MTNA 2DOSA 1KHQA 2F7DA 2FO5A 5A24A 1GCBA 2HD5A 4AXLA 2XU3A 1JQPA 1CVZA 2R9OA 2AGAA 2F1GA 2O6XA 2ATOA 1PIPA 2JQGR 4GUAA 1TLOA 3BPMA 1Y4HA 2JRIA 4X6HA 3ZUAA 1SNKA 4OELA 2FUDA 2FRQA 1CPJA 1YK8A 1PCIA 2CB5A 3I3TA 4BPVA 4HXDB 5K16A 2AUXA 4MI7A 1U9WA 2OZ2A 2GHUA 4CDEB 1PADA 1QXPA 1ZIVA 3DF0A 3E1ZB 3PHXA 5FPWA 3V6CA 4K7CA 3LFYA 3F75A 2DJGB 1NB5A 1Q6KA 3N3GA 5JA7A 5CVNB 3CH3X 1TL9A 3S3QA 3W31A 3LXSA 2P7UA 1MHWA 1YK7A 4BOPA 2ACTA 2AYNA 4PADA 2DC7A 2G6DA 4AXMA 2FT2A 2IBIA 3KW9A 4FIPA 1PPPA 3HHIA 1GMYA 3H6SA 3P5UA 1ZCMA 3P5VA 4FJCA 4ZTBA 1CQDA 4BSQA 2E02A 3W30A 3BB7A 1HUCB 2XU4A 3KKUA 4PP2E 2B1NA 4W4UA 4DMYA 3RVVA 3B21A 4P6EA 1F2CA 2AYOA 1U9VA 3N4CA 2IPPB 4MZSA 2YJ8A 3I06A 3PSEA 4CZWA 1KFUL 3PBHA 4CDDB 4I04A 1EF7A 1K3BB 4BS5A 3CBJA 1PPDA 3QJ3A 4BOQA 3PT2A 4PT5A 8PCHA 2JTCA 3BPFA 1YALA 3OF8A 1MEMA 3MJ5A 1GECE 1O0EA 4N8WA 4OEMA 3RVXA 4P6GA 5EZSA 4XR7A 3PDFA 1BQIA 1KXRA 1KHPA 1AU2A 1CV8A 2R6NA 2AUZA 4XZXA 3BC3A 4QH6A 5KO3A 1AU3A 2XU5A 3D6SA 5E6JA 1AYUA 4R3DA 2DCBA 3C9EA 4FK5A 1CJLA 4OVZB 3NHEA 3CH2X 2R9FA 5CHVA 3TNXA 1A6RA 2DC8A 3IFUA 3WXGA 1PE6A 4X6JA 2UZJA 1AU4A 1VSNA 2B1MA 4W5CA 4MZOA 1THEA 2Y5BA 1BY8A 1PVJA 3C0RA 2PADA 2FTDA 2BTWB 3TRKA 1S4VA 1EWLA 2HWKA 3OISA 5CVOB 3AI8A 1MS6A 2C0YA 3ZNHA 4W5BA 3IHPA 2DZYA 2R9MA 3O65A 4I05A 4BS6A 3OVXA 2DCAA 3U8EA 2BDZA 3M99A 3P5XA 3IEJA 2NQIA 4WURA 3PW3A 1NLJA 2H7JA 4P16A 1DEUA 2HXZA 1VJVA 3O1GA 1MDWA 2OULA 4IP3A 1TU6A 4IUMA 3GCBA 1PPNA 2XU1A 2HHNA 2DCDA 3K8UA 4BOSA 3N3KA 3K9MA 3HHAA 4RF1A 3BCNA 2DZZA 2G8EA 2PNSA 4Q8GA 5J94A 3B79A 1QOLA 4ZUXU 2GFOA 3MHHA 2R9NA 1DF0A 4QRVA 1AYVA 4I07A 4PI3A 2E00A 4YV8A 3BY4A 2HH5A 2JQFR 2AIMA 5EZQA 9PAPA 4YVAA 4RF0A 3IV2A 2Y6EA 2YJCA 3HD3A 2YJ2A 3WXFA 4HWYA 3OVZA 4N79A 3IMAA 3KSEA 1NPZA 1ME3A 1ITOA 3RVWA 4CDFB 1CTEA 3OF9A 3PHUA 1EWOA 3S3RA 3IOQA 3H89A 2E03A 1NQCA 4OW0A 3ERVA 2P0RA 1MEGA 2DJFB 1STFE 1F2AA 1POPA
chains in the Genus database with same CATH topology
1AECA 1EWPA 3H8BA 1NL6A 2DC6A 3MORA 2AVWA 2FQ9A 2FYEA 1CB5A 4WA6A 5CVMA 3QSDA 3F5VA 2YJBA 4YYUA 4PP1A 6PADA 3BOWA 3KWBX 1U9QX 4YYRA 4NV8A 3K24A 3PNRA 1ME4A 3MHSA 2BSZA 4QRXA 1M6DA 5EF4A 4YYQA 1EWMA 1AIMA 2DCCA 4BQVA 3HWNA 4N4ZA 4CDCB 4QBBA 5EGWA 1X9YA 5JH3A 4B55A 1FH0A 2FRAA 4YYWA 3P5WA 7PCKA 4MSXA 4KLBA 4DMXA 4Q8HA 2R9CA 3H8CA 1AYWA 4XUIA 3WXEA 2BDLA 2VFBA 2ARYA 1ATKA 1Y08A 4RY2A 2AU1A 1AU0A 5CHTA 1BP4A 2PBHA 1U9XA 1PPOA 3V6EA 1CS8A 1U5IA 4X6IA 1PXVA 1YT7A 2WBFX 3KFQA 1PBHA 2CIOA 3USVA 2P86A 2G7YA 1IWDA 2YJ9A 3IUTA 1CSBB 1QMYA 2VHSA 5F02A 2OP3A 1QDQA 2NQAA 2AS8A 4YYSA 4QRGA 4G54A 3CBKA 1KFXL 2DC9A 3H7DA 3BWKA 1GLOA 3KX1A 4YYVA 1F29A 3O0UA 2G8JA 1ICFA 2E01A 3QT4A 1BGOA 1SP4B 2VHFA 5PADA 1YVBA 3KWZA 1MIRA 1XKGA 2NQDB 1F2BA 1NB3A 2NQGA 2PREA 3MTNA 1KHQA 1W5RA 2F7DA 2FO5A 5A24A 1GCBA 2HD5A 3LTWA 4AXLA 2XU3A 1JQPA 1CVZA 2R9OA 2F1GA 2O6XA 2ATOA 1PIPA 2JQGR 1TLOA 3BPMA 1Y4HA 4X6HA 3ZUAA 1SNKA 4OELA 2FUDA 2FRQA 1CPJA 1YK8A 1PCIA 2CB5A 3I3TA 4BPVA 5K16A 4GUZA 2AUXA 1U9WA 2OZ2A 2GHUA 4C5PA 4CDEB 1PADA 1QXPA 1ZIVA 3DF0A 3E1ZB 5FPWA 3V6CA 4K7CA 3LFYA 3F75A 2DJGB 1NB5A 1Q6KA 3N3GA 5JA7A 5CVNB 3CH3X 1TL9A 3S3QA 3LXSA 2P7UA 1MHWA 1YK7A 2ACTA 4NV7A 2AYNA 4PADA 1GX3A 2DC7A 2G6DA 4AXMA 2FT2A 2IBIA 3KW9A 4FIPA 1PPPA 3HHIA 1GMYA 3H6SA 3P5UA 1ZCMA 3P5VA 4FJCA 1CQDA 4BSQA 3D9WA 2E02A 1HUCB 2XU4A 3KKUA 4PP2E 2B1NA 4W4UA 4DMYA 3RVVA 4P6EA 1F2CA 2AYOA 1U9VA 3N4CA 2IPPB 4MZSA 2YJ8A 3I06A 4CZWA 1KFUL 3PBHA 4CDDB 4I04A 1EF7A 1K3BB 4BS5A 3CBJA 1PPDA 3QJ3A 8PCHA 3BPFA 1YALA 3OF8A 1MEMA 1GECE 1O0EA 4N8WA 4OEMA 3RVXA 4P6GA 4XR7A 3PDFA 1BQIA 1KXRA 1KHPA 1AU2A 1CV8A 2R6NA 2AUZA 3BC3A 4QH6A 1E2TA 1AU3A 2XU5A 3D6SA 1AYUA 2DCBA 3C9EA 4FK5A 1CJLA 3NHEA 3CH2X 2R9FA 5CHVA 3TNXA 1A6RA 2DC8A 3WXGA 1PE6A 4X6JA 1AU4A 1VSNA 2B1MA 4W5CA 4MZOA 1THEA 2Y5BA 1BY8A 2PADA 2FTDA 1S4VA 1EWLA 3OISA 5CVOB 3AI8A 1MS6A 2C0YA 4W5BA 3IHPA 2DZYA 2R9MA 4I05A 4BS6A 3OVXA 2DCAA 3U8EA 2BDZA 3M99A 3P5XA 3IEJA 2NQIA 4BGFA 3PW3A 1NLJA 2H7JA 1DEUA 2HXZA 1VJVA 3O1GA 1MDWA 2OULA 1W4TA 1TU6A 3GCBA 1PPNA 2XU1A 2HHNA 2DCDA 3K8UA 3N3KA 3K9MA 3HHAA 3BCNA 2DZZA 2G8EA 2PNSA 4Q8GA 5J94A 3B79A 1QOLA 2VFCA 4ZUXU 1W6FA 2GFOA 3MHHA 2R9NA 1DF0A 4QRVA 1AYVA 4I07A 4PI3A 2E00A 4YV8A 2HH5A 2JQFR 2AIMA 9PAPA 4YVAA 3IV2A 2Y6EA 2YJCA 3HD3A 2YJ2A 3WXFA 4HWYA 3OVZA 4N79A 3IMAA 3KSEA 1NPZA 1ME3A 1ITOA 3RVWA 4CDFB 1CTEA 3OF9A 1EWOA 3S3RA 3IOQA 3H89A 2E03A 1NQCA 3ERVA 2P0RA 1MEGA 2DJFB 1STFE 1F2AA 1POPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEC A;  1EWP A;  3H8B A;  1NL6 A;  2DC6 A;  3MOR A;  2AVW A;  2FQ9 A;  2FYE A;  1CB5 A;  4WA6 A;  5CVM A;  3QSD A;  3F5V A;  2YJB A;  4YYU A;  4PP1 A;  6PAD A;  3BOW A;  3KWB X;  1U9Q X;  4YYR A;  3K24 A;  3PNR A;  1ME4 A;  3MHS A;  4QRX A;  1M6D A;  5EF4 A;  4YYQ A;  1EWM A;  1AIM A;  2DCC A;  4BQV A;  3HWN A;  4N4Z A;  4CDC B;  4QBB A;  5EGW A;  1X9Y A;  5JH3 A;  1FH0 A;  2FRA A;  4YYW A;  3P5W A;  7PCK A;  4MSX A;  4KLB A;  4DMX A;  4Q8H A;  2R9C A;  3H8C A;  1AYW A;  4XUI A;  3WXE A;  2BDL A;  2ARY A;  1ATK A;  1Y08 A;  4RY2 A;  2AU1 A;  1AU0 A;  5CHT A;  1BP4 A;  2PBH A;  1U9X A;  1PPO A;  3V6E A;  1CS8 A;  1U5I A;  4X6I A;  1PXV A;  1YT7 A;  2WBF X;  3KFQ A;  1PBH A;  2CIO A;  3USV A;  2P86 A;  2G7Y A;  1IWD A;  2YJ9 A;  3IUT A;  1CSB B;  1QMY A;  2VHS A;  5F02 A;  2OP3 A;  1QDQ A;  2NQA A;  2AS8 A;  4YYS A;  4QRG A;  4G54 A;  3CBK A;  1KFX L;  2DC9 A;  3H7D A;  3BWK A;  1GLO A;  3KX1 A;  4YYV A;  1F29 A;  3O0U A;  2G8J A;  1ICF A;  2E01 A;  3QT4 A;  1BGO A;  1SP4 B;  2VHF A;  5PAD A;  1YVB A;  3KWZ A;  1MIR A;  1XKG A;  2NQD B;  1F2B A;  1NB3 A;  2NQG A;  2PRE A;  3MTN A;  1KHQ A;  2F7D A;  2FO5 A;  5A24 A;  1GCB A;  2HD5 A;  4AXL A;  2XU3 A;  1JQP A;  1CVZ A;  2R9O A;  2F1G A;  2O6X A;  2ATO A;  1PIP A;  2JQG R;  1TLO A;  3BPM A;  1Y4H A;  4X6H A;  3ZUA A;  1SNK A;  4OEL A;  2FUD A;  2FRQ A;  1CPJ A;  1YK8 A;  1PCI A;  2CB5 A;  3I3T A;  4BPV A;  5K16 A;  2AUX A;  1U9W A;  2OZ2 A;  2GHU A;  4CDE B;  1PAD A;  1QXP A;  1ZIV A;  3DF0 A;  3E1Z B;  5FPW A;  3V6C A;  4K7C A;  3LFY A;  3F75 A;  2DJG B;  1NB5 A;  1Q6K A;  3N3G A;  5JA7 A;  5CVN B;  3CH3 X;  1TL9 A;  3S3Q A;  3LXS A;  2P7U A;  1MHW A;  1YK7 A;  2ACT A;  2AYN A;  4PAD A;  2DC7 A;  2G6D A;  4AXM A;  2FT2 A;  2IBI A;  3KW9 A;  4FIP A;  1PPP A;  3HHI A;  1GMY A;  3H6S A;  3P5U A;  1ZCM A;  3P5V A;  4FJC A;  1CQD A;  4BSQ A;  2E02 A;  1HUC B;  2XU4 A;  3KKU A;  4PP2 E;  2B1N A;  4W4U A;  4DMY A;  3RVV A;  4P6E A;  1F2C A;  2AYO A;  1U9V A;  3N4C A;  2IPP B;  4MZS A;  2YJ8 A;  3I06 A;  4CZW A;  1KFU L;  3PBH A;  4CDD B;  4I04 A;  1EF7 A;  1K3B B;  4BS5 A;  3CBJ A;  1PPD A;  3QJ3 A;  8PCH A;  3BPF A;  1YAL A;  3OF8 A;  1MEM A;  1GEC E;  1O0E A;  4N8W A;  4OEM A;  3RVX A;  4P6G A;  4XR7 A;  3PDF A;  1BQI A;  1KXR A;  1KHP A;  1AU2 A;  1CV8 A;  2R6N A;  2AUZ A;  3BC3 A;  4QH6 A;  1AU3 A;  2XU5 A;  3D6S A;  1AYU A;  2DCB A;  3C9E A;  4FK5 A;  1CJL A;  3NHE A;  3CH2 X;  2R9F A;  5CHV A;  3TNX A;  1A6R A;  2DC8 A;  3WXG A;  1PE6 A;  4X6J A;  1AU4 A;  1VSN A;  2B1M A;  4W5C A;  4MZO A;  1THE A;  2Y5B A;  1BY8 A;  2PAD A;  2FTD A;  1S4V A;  1EWL A;  3OIS A;  5CVO B;  3AI8 A;  1MS6 A;  2C0Y A;  4W5B A;  3IHP A;  2DZY A;  2R9M A;  4I05 A;  4BS6 A;  3OVX A;  2DCA A;  3U8E A;  2BDZ A;  3M99 A;  3P5X A;  3IEJ A;  2NQI A;  3PW3 A;  1NLJ A;  2H7J A;  1DEU A;  2HXZ A;  1VJV A;  3O1G A;  1MDW A;  2OUL A;  1TU6 A;  3GCB A;  1PPN A;  2XU1 A;  2HHN A;  2DCD A;  3K8U A;  3N3K A;  3K9M A;  3HHA A;  3BCN A;  2DZZ A;  2G8E A;  2PNS A;  4Q8G A;  5J94 A;  3B79 A;  1QOL A;  4ZUX U;  2GFO A;  3MHH A;  2R9N A;  1DF0 A;  4QRV A;  1AYV A;  4I07 A;  4PI3 A;  2E00 A;  4YV8 A;  2HH5 A;  2JQF R;  2AIM A;  9PAP A;  4YVA A;  3IV2 A;  2Y6E A;  2YJC A;  3HD3 A;  2YJ2 A;  3WXF A;  4HWY A;  3OVZ A;  4N79 A;  3IMA A;  3KSE A;  1NPZ A;  1ME3 A;  1ITO A;  3RVW A;  4CDF B;  1CTE A;  3OF9 A;  1EWO A;  3S3R A;  3IOQ A;  3H89 A;  2E03 A;  1NQC A;  3ERV A;  2P0R A;  1MEG A;  2DJF B;  1STF E;  1F2A A;  1POP A; 
#chains in the Genus database with same CATH topology
 1AEC A;  1EWP A;  3H8B A;  1NL6 A;  2DC6 A;  3MOR A;  3TMP A;  2AVW A;  2FQ9 A;  2FYE A;  1CB5 A;  4WA6 A;  4M0W A;  2J7Q C;  5CVM A;  3QSD A;  3F5V A;  3E9S A;  2YJB A;  4YYU A;  4PP1 A;  6PAD A;  3BOW A;  3BBA A;  3KWB X;  1U9Q X;  4YYR A;  3K24 A;  1YZB A;  3PNR A;  1ME4 A;  3MHS A;  4QRX A;  1M6D A;  5EF4 A;  4D8I A;  4YYQ A;  1EWM A;  1AIM A;  2DCC A;  4BQV A;  3HWN A;  4N4Z A;  4CDC B;  4QBB A;  5EGW A;  1X9Y A;  5JH3 A;  2J7Q A;  1FH0 A;  3PHW A;  3MP2 A;  2FRA A;  3PRM A;  4YYW A;  3P5W A;  1UKF A;  4D8B A;  7PCK A;  4MSX A;  4KLB A;  2BU3 A;  4DMX A;  4Q8H A;  2R9C A;  3H8C A;  4REZ A;  1AYW A;  4XUI A;  3WXE A;  4A5U A;  2BDL A;  2ARY A;  4OVZ A;  3RNV A;  4RNA A;  1ATK A;  4D8E A;  1Y08 A;  4RY2 A;  2AU1 A;  4BOZ A;  1AU0 A;  5CHT A;  1BP4 A;  2PBH A;  1U9X A;  1PPO A;  3V6E A;  1CS8 A;  1U5I A;  4X6I A;  5JZE A;  1PXV A;  1YT7 A;  2WBF X;  3KFQ A;  1PBH A;  2CIO A;  3USV A;  2P86 A;  2BTW A;  2G7Y A;  1IWD A;  3PRP A;  2YJ9 A;  3MTV A;  3IUT A;  1CSB B;  1QMY A;  2Z84 A;  2VHS A;  5F02 A;  2OP3 A;  1QDQ A;  2NQA A;  2AS8 A;  4YYS A;  4QRG A;  4G54 A;  3CBK A;  1KFX L;  2DC9 A;  3H7D A;  3BWK A;  1GLO A;  3KX1 A;  4YYV A;  1F29 A;  3O0U A;  2G8J A;  1ICF A;  2E01 A;  3QT4 A;  1BGO A;  1SP4 B;  4RKX A;  2VHF A;  1DKI A;  5PAD A;  1YVB A;  4MM3 B;  3KWZ A;  1MIR A;  1XKG A;  2NQD B;  1F2B A;  3OQC A;  1NB3 A;  2FE8 A;  2NQG A;  2PRE A;  4BOU A;  3MTN A;  2DOS A;  1KHQ A;  2F7D A;  2FO5 A;  5A24 A;  1GCB A;  2HD5 A;  4AXL A;  2XU3 A;  1JQP A;  1CVZ A;  2R9O A;  2AGA A;  2F1G A;  2O6X A;  2ATO A;  1PIP A;  2JQG R;  4GUA A;  1TLO A;  3BPM A;  1Y4H A;  2JRI A;  4X6H A;  3ZUA A;  1SNK A;  4OEL A;  2FUD A;  2FRQ A;  1CPJ A;  1YK8 A;  1PCI A;  2CB5 A;  3I3T A;  4BPV A;  4HXD B;  5K16 A;  2AUX A;  4MI7 A;  1U9W A;  2OZ2 A;  2GHU A;  4CDE B;  1PAD A;  1QXP A;  1ZIV A;  3DF0 A;  3E1Z B;  3PHX A;  5FPW A;  3V6C A;  4K7C A;  3LFY A;  3F75 A;  2DJG B;  1NB5 A;  1Q6K A;  3N3G A;  5JA7 A;  5CVN B;  3CH3 X;  1TL9 A;  3S3Q A;  3W31 A;  3LXS A;  2P7U A;  1MHW A;  1YK7 A;  4BOP A;  2ACT A;  2AYN A;  4PAD A;  2DC7 A;  2G6D A;  4AXM A;  2FT2 A;  2IBI A;  3KW9 A;  4FIP A;  1PPP A;  3HHI A;  1GMY A;  3H6S A;  3P5U A;  1ZCM A;  3P5V A;  4FJC A;  4ZTB A;  1CQD A;  4BSQ A;  2E02 A;  3W30 A;  3BB7 A;  1HUC B;  2XU4 A;  3KKU A;  4PP2 E;  2B1N A;  4W4U A;  4DMY A;  3RVV A;  3B21 A;  4P6E A;  1F2C A;  2AYO A;  1U9V A;  3N4C A;  2IPP B;  4MZS A;  2YJ8 A;  3I06 A;  3PSE A;  4CZW A;  1KFU L;  3PBH A;  4CDD B;  4I04 A;  1EF7 A;  1K3B B;  4BS5 A;  3CBJ A;  1PPD A;  3QJ3 A;  4BOQ A;  3PT2 A;  4PT5 A;  8PCH A;  2JTC A;  3BPF A;  1YAL A;  3OF8 A;  1MEM A;  3MJ5 A;  1GEC E;  1O0E A;  4N8W A;  4OEM A;  3RVX A;  4P6G A;  5EZS A;  4XR7 A;  3PDF A;  1BQI A;  1KXR A;  1KHP A;  1AU2 A;  1CV8 A;  2R6N A;  2AUZ A;  4XZX A;  3BC3 A;  4QH6 A;  5KO3 A;  1AU3 A;  2XU5 A;  3D6S A;  5E6J A;  1AYU A;  4R3D A;  2DCB A;  3C9E A;  4FK5 A;  1CJL A;  4OVZ B;  3NHE A;  3CH2 X;  2R9F A;  5CHV A;  3TNX A;  1A6R A;  2DC8 A;  3IFU A;  3WXG A;  1PE6 A;  4X6J A;  2UZJ A;  1AU4 A;  1VSN A;  2B1M A;  4W5C A;  4MZO A;  1THE A;  2Y5B A;  1BY8 A;  1PVJ A;  3C0R A;  2PAD A;  2FTD A;  2BTW B;  3TRK A;  1S4V A;  1EWL A;  2HWK A;  3OIS A;  5CVO B;  3AI8 A;  1MS6 A;  2C0Y A;  3ZNH A;  4W5B A;  3IHP A;  2DZY A;  2R9M A;  3O65 A;  4I05 A;  4BS6 A;  3OVX A;  2DCA A;  3U8E A;  2BDZ A;  3M99 A;  3P5X A;  3IEJ A;  2NQI A;  4WUR A;  3PW3 A;  1NLJ A;  2H7J A;  4P16 A;  1DEU A;  2HXZ A;  1VJV A;  3O1G A;  1MDW A;  2OUL A;  4IP3 A;  1TU6 A;  4IUM A;  3GCB A;  1PPN A;  2XU1 A;  2HHN A;  2DCD A;  3K8U A;  4BOS A;  3N3K A;  3K9M A;  3HHA A;  4RF1 A;  3BCN A;  2DZZ A;  2G8E A;  2PNS A;  4Q8G A;  5J94 A;  3B79 A;  1QOL A;  4ZUX U;  2GFO A;  3MHH A;  2R9N A;  1DF0 A;  4QRV A;  1AYV A;  4I07 A;  4PI3 A;  2E00 A;  4YV8 A;  3BY4 A;  2HH5 A;  2JQF R;  2AIM A;  5EZQ A;  9PAP A;  4YVA A;  4RF0 A;  3IV2 A;  2Y6E A;  2YJC A;  3HD3 A;  2YJ2 A;  3WXF A;  4HWY A;  3OVZ A;  4N79 A;  3IMA A;  3KSE A;  1NPZ A;  1ME3 A;  1ITO A;  3RVW A;  4CDF B;  1CTE A;  3OF9 A;  3PHU A;  1EWO A;  3S3R A;  3IOQ A;  3H89 A;  2E03 A;  1NQC A;  4OW0 A;  3ERV A;  2P0R A;  1MEG A;  2DJF B;  1STF E;  1F2A A;  1POP A; 
#chains in the Genus database with same CATH homology
 1AEC A;  1EWP A;  3H8B A;  1NL6 A;  2DC6 A;  3MOR A;  2AVW A;  2FQ9 A;  2FYE A;  1CB5 A;  4WA6 A;  5CVM A;  3QSD A;  3F5V A;  2YJB A;  4YYU A;  4PP1 A;  6PAD A;  3BOW A;  3KWB X;  1U9Q X;  4YYR A;  4NV8 A;  3K24 A;  3PNR A;  1ME4 A;  3MHS A;  2BSZ A;  4QRX A;  1M6D A;  5EF4 A;  4YYQ A;  1EWM A;  1AIM A;  2DCC A;  4BQV A;  3HWN A;  4N4Z A;  4CDC B;  4QBB A;  5EGW A;  1X9Y A;  5JH3 A;  4B55 A;  1FH0 A;  2FRA A;  4YYW A;  3P5W A;  7PCK A;  4MSX A;  4KLB A;  4DMX A;  4Q8H A;  2R9C A;  3H8C A;  1AYW A;  4XUI A;  3WXE A;  2BDL A;  2VFB A;  2ARY A;  1ATK A;  1Y08 A;  4RY2 A;  2AU1 A;  1AU0 A;  5CHT A;  1BP4 A;  2PBH A;  1U9X A;  1PPO A;  3V6E A;  1CS8 A;  1U5I A;  4X6I A;  1PXV A;  1YT7 A;  2WBF X;  3KFQ A;  1PBH A;  2CIO A;  3USV A;  2P86 A;  2G7Y A;  1IWD A;  2YJ9 A;  3IUT A;  1CSB B;  1QMY A;  2VHS A;  5F02 A;  2OP3 A;  1QDQ A;  2NQA A;  2AS8 A;  4YYS A;  4QRG A;  4G54 A;  3CBK A;  1KFX L;  2DC9 A;  3H7D A;  3BWK A;  1GLO A;  3KX1 A;  4YYV A;  1F29 A;  3O0U A;  2G8J A;  1ICF A;  2E01 A;  3QT4 A;  1BGO A;  1SP4 B;  2VHF A;  5PAD A;  1YVB A;  3KWZ A;  1MIR A;  1XKG A;  2NQD B;  1F2B A;  1NB3 A;  2NQG A;  2PRE A;  3MTN A;  1KHQ A;  1W5R A;  2F7D A;  2FO5 A;  5A24 A;  1GCB A;  2HD5 A;  3LTW A;  4AXL A;  2XU3 A;  1JQP A;  1CVZ A;  2R9O A;  2F1G A;  2O6X A;  2ATO A;  1PIP A;  2JQG R;  1TLO A;  3BPM A;  1Y4H A;  4X6H A;  3ZUA A;  1SNK A;  4OEL A;  2FUD A;  2FRQ A;  1CPJ A;  1YK8 A;  1PCI A;  2CB5 A;  3I3T A;  4BPV A;  5K16 A;  4GUZ A;  2AUX A;  1U9W A;  2OZ2 A;  2GHU A;  4C5P A;  4CDE B;  1PAD A;  1QXP A;  1ZIV A;  3DF0 A;  3E1Z B;  5FPW A;  3V6C A;  4K7C A;  3LFY A;  3F75 A;  2DJG B;  1NB5 A;  1Q6K A;  3N3G A;  5JA7 A;  5CVN B;  3CH3 X;  1TL9 A;  3S3Q A;  3LXS A;  2P7U A;  1MHW A;  1YK7 A;  2ACT A;  4NV7 A;  2AYN A;  4PAD A;  1GX3 A;  2DC7 A;  2G6D A;  4AXM A;  2FT2 A;  2IBI A;  3KW9 A;  4FIP A;  1PPP A;  3HHI A;  1GMY A;  3H6S A;  3P5U A;  1ZCM A;  3P5V A;  4FJC A;  1CQD A;  4BSQ A;  3D9W A;  2E02 A;  1HUC B;  2XU4 A;  3KKU A;  4PP2 E;  2B1N A;  4W4U A;  4DMY A;  3RVV A;  4P6E A;  1F2C A;  2AYO A;  1U9V A;  3N4C A;  2IPP B;  4MZS A;  2YJ8 A;  3I06 A;  4CZW A;  1KFU L;  3PBH A;  4CDD B;  4I04 A;  1EF7 A;  1K3B B;  4BS5 A;  3CBJ A;  1PPD A;  3QJ3 A;  8PCH A;  3BPF A;  1YAL A;  3OF8 A;  1MEM A;  1GEC E;  1O0E A;  4N8W A;  4OEM A;  3RVX A;  4P6G A;  4XR7 A;  3PDF A;  1BQI A;  1KXR A;  1KHP A;  1AU2 A;  1CV8 A;  2R6N A;  2AUZ A;  3BC3 A;  4QH6 A;  1E2T A;  1AU3 A;  2XU5 A;  3D6S A;  1AYU A;  2DCB A;  3C9E A;  4FK5 A;  1CJL A;  3NHE A;  3CH2 X;  2R9F A;  5CHV A;  3TNX A;  1A6R A;  2DC8 A;  3WXG A;  1PE6 A;  4X6J A;  1AU4 A;  1VSN A;  2B1M A;  4W5C A;  4MZO A;  1THE A;  2Y5B A;  1BY8 A;  2PAD A;  2FTD A;  1S4V A;  1EWL A;  3OIS A;  5CVO B;  3AI8 A;  1MS6 A;  2C0Y A;  4W5B A;  3IHP A;  2DZY A;  2R9M A;  4I05 A;  4BS6 A;  3OVX A;  2DCA A;  3U8E A;  2BDZ A;  3M99 A;  3P5X A;  3IEJ A;  2NQI A;  4BGF A;  3PW3 A;  1NLJ A;  2H7J A;  1DEU A;  2HXZ A;  1VJV A;  3O1G A;  1MDW A;  2OUL A;  1W4T A;  1TU6 A;  3GCB A;  1PPN A;  2XU1 A;  2HHN A;  2DCD A;  3K8U A;  3N3K A;  3K9M A;  3HHA A;  3BCN A;  2DZZ A;  2G8E A;  2PNS A;  4Q8G A;  5J94 A;  3B79 A;  1QOL A;  2VFC A;  4ZUX U;  1W6F A;  2GFO A;  3MHH A;  2R9N A;  1DF0 A;  4QRV A;  1AYV A;  4I07 A;  4PI3 A;  2E00 A;  4YV8 A;  2HH5 A;  2JQF R;  2AIM A;  9PAP A;  4YVA A;  3IV2 A;  2Y6E A;  2YJC A;  3HD3 A;  2YJ2 A;  3WXF A;  4HWY A;  3OVZ A;  4N79 A;  3IMA A;  3KSE A;  1NPZ A;  1ME3 A;  1ITO A;  3RVW A;  4CDF B;  1CTE A;  3OF9 A;  1EWO A;  3S3R A;  3IOQ A;  3H89 A;  2E03 A;  1NQC A;  3ERV A;  2P0R A;  1MEG A;  2DJF B;  1STF E;  1F2A A;  1POP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...