1BP4A

Use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PAPAIN
publication title Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites.
pubmed doi rcsb
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bp4A00
1U9VA 2R9CA 2FQ9A 2HHNA 3IOQA 1BGOA 2YJCA 2IPPB 3QSDA 3LFYA 2FRAA 2Y5BA 3P5VA 2DCBA 3CH3X 1EF7A 5A24A 4P6GA 3KFQA 3S3QA 1AYUA 3GCBA 1CV8A 2DC6A 2FYEA 4MSXA 2R9OA 3H89A 3O1GA 2YJBA 1YK7A 4XUIA 3QT4A 4YV8A 1MDWA 3N4CA 4AXMA 1PXVA 3KW9A 4CDCB 7PCKA 6PADA 4QRXA 1KXRA 4BQVA 4X6HA 1GMYA 4MZSA 4P6EA 1ATKA 1CTEA 1BQIA 4WA6A 4YYWA 3OF8A 4W5CA 4BPVA 1PADA 1KHQA 1Q6KA 5EGWA 1MEGA 2VHFA 2ATOA 4YYQA 4KLBA 1DF0A 3IV2A 1THEA 1AU0A 1NB5A 3HHIA 2BDLA 3D6SA 4CDDB 2AUXA 3PBHA 4CDFB 1PPPA 4QRVA 1Y4HA 3BPMA 1MS6A 2DJGB 1AU4A 4BSQA 4FIPA 2OZ2A 3K9MA 1F2BA 4I07A 4I04A 3HWNA 1AYVA 2P86A 3U8EA 3IHPA 2AIMA 1U9XA 4QBBA 3QJ3A 1QDQA 4XR7A 1YT7A 3RVXA 2P0RA 3DF0A 1TLOA 1ZCMA 1STFE 4OEMA 1JQPA 4X6IA 3I3TA 1MEMA 1YK8A 5PADA 3KWBX 1NL6A 3OF9A 1MIRA 1SP4B 1PPDA 5FPWA 1YVBA 2OP3A 3KWZA 3RVVA 1PE6A 2FO5A 5JA7A 1U5IA 3OISA 2DC9A 2XU5A 3B79A 3CBKA 2ACTA 2E00A 3ERVA 2PNSA 3OVXA 1KFUL 1CVZA 5JH3A 4N8WA 2GFOA 1QOLA 2CIOA 3KKUA 3OVZA 1F2AA 1QXPA 1A6RA 1KHPA 1FH0A 2DCDA 4N79A 4K7CA 2FRQA 2O6XA 1EWPA 3LXSA 2NQGA 1PPOA 9PAPA 2FUDA 1CSBB 3O0UA 2B1NA 4BS5A 3WXGA 2AS8A 2DZYA 2PBHA 1Y08A 2FTDA 1X9YA 1QMYA 4I05A 3BOWA 2YJ2A 4PI3A 4G54A 3BC3A 2XU1A 1PPNA 2H7JA 1GECE 3MTNA 1XKGA 3KX1A 1EWMA 1YALA 1TL9A 1ME3A 2AVWA 1AU2A 1K3BB 4N4ZA 1U9WA 4MZOA 2GHUA 2DCAA 3CH2X 1IWDA 2AYNA 3H8BA 1GCBA 5F02A 1NQCA 5EF4A 2WBFX 2DC7A 3F5VA 2DJFB 2G6DA 3MHHA 3P5XA 2E03A 2E02A 2R9MA 4DMXA 2R9FA 2BDZA 3NHEA 4BS6A 1EWOA 4W5BA 1VSNA 1KFXL 2G8EA 2FT2A 3KSEA 1AIMA 1M6DA 3V6CA 3USVA 2C0YA 2PADA 3WXFA 4CDEB 3P5UA 1ICFA 1POPA 2XU4A 2DC8A 2JQFR 4QH6A 4AXLA 4X6JA 1AECA 3I06A 1MHWA 1CJLA 4PP2E 5CVMA 1EWLA 2NQIA 4YYRA 2PREA 1CPJA 3IEJA 1NPZA 2XU3A 3N3KA 3HD3A 1HUCB 2JQGR 4Q8GA 5CVOB 4PP1A 3CBJA 2R6NA 5CHTA 1U9QX 4PADA 1AU3A 4YYVA 3MORA 3K24A 2HD5A 4FJCA 3BCNA 2DCCA 2HH5A 1GLOA 3H7DA 3V6EA 1VJVA 3MHSA 4OELA 4Q8HA 4ZUXU 5J94A 3WXEA 1PIPA 3TNXA 5CVNB 3BPFA 5K16A 4HWYA 3H6SA 3E1ZB 3K8UA 1BP4A 1F2CA 2AU1A 2F1GA 2E01A 2R9NA 3ZUAA 1S4VA 3C9EA 2AYOA 4YYSA 1CS8A 3BWKA 2NQDB 2B1MA 3PW3A 4W4UA 2Y6EA 4QRGA 1O0EA 2OULA 2G8JA 3HHAA 1PBHA 3PDFA 1ITOA 3N3GA 2VHSA 2NQAA 4YYUA 1ME4A 2F7DA 3P5WA 3S3RA 2YJ8A 3M99A 5CHVA 2AUZA 2P7UA 2YJ9A 3H8CA 2ARYA 1CB5A 8PCHA 2HXZA 2IBIA 1ZIVA 4RY2A 3IMAA 1F29A 1SNKA 1CQDA 1BY8A 4FK5A 2DZZA 3PNRA 1TU6A 3IUTA 4YVAA 2G7YA 3RVWA 1PCIA 1DEUA 3AI8A 2CB5A 1NLJA 4CZWA 4DMYA 1NB3A 3F75A 1AYWA
chains in the Genus database with same CATH superfamily
1U9VA 5E6JA 2R9CA 2FQ9A 2HHNA 3IOQA 1BGOA 2YJCA 2IPPB 5JZEA 5EZSA 3QSDA 3LFYA 2FRAA 2Y5BA 3P5VA 2DCBA 3CH3X 3IFUA 1EF7A 4RF0A 5A24A 4P6GA 3KFQA 4BOQA 3S3QA 1AYUA 3GCBA 1CV8A 2DC6A 2FYEA 4MSXA 2R9OA 4A5UA 3H89A 3O1GA 2YJBA 1YK7A 4XUIA 3QT4A 4YV8A 1MDWA 4OVZA 3N4CA 4AXMA 1PXVA 3KW9A 4CDCB 7PCKA 6PADA 3W30A 4QRXA 1KXRA 4BQVA 4X6HA 1GMYA 4MZSA 4P6EA 1ATKA 4BOUA 1CTEA 1BQIA 4WA6A 4YYWA 3OF8A 4W5CA 4BPVA 1PADA 1KHQA 1Q6KA 5EGWA 1MEGA 4XZXA 2VHFA 2ATOA 4YYQA 4KLBA 1DKIA 1DF0A 3IV2A 4D8BA 1THEA 3PRMA 1AU0A 1NB5A 3HHIA 2BDLA 2JRIA 3D6SA 4CDDB 4MM3B 2AUXA 3PBHA 4CDFB 1PPPA 4QRVA 1Y4HA 3BPMA 1MS6A 2DJGB 1AU4A 4BSQA 4FIPA 2OZ2A 3K9MA 4ZTBA 1F2BA 4I07A 4I04A 3HWNA 1AYVA 2P86A 2AGAA 3U8EA 3IHPA 2AIMA 1U9XA 4QBBA 3QJ3A 1QDQA 4XR7A 1YT7A 3PHXA 3BY4A 3RVXA 4R3DA 4BOSA 2P0RA 5KO3A 3DF0A 1TLOA 1ZCMA 1STFE 4OEMA 1JQPA 4REZA 4X6IA 3I3TA 3PRPA 4HXDB 1MEMA 1YK8A 5PADA 3KWBX 1NL6A 3OF9A 1MIRA 1SP4B 1PPDA 5FPWA 4BOZA 1PVJA 1YVBA 2OP3A 3KWZA 3RVVA 1PE6A 2FO5A 5JA7A 1U5IA 3OISA 2DC9A 2XU5A 3B79A 3CBKA 2ACTA 2E00A 3ERVA 2PNSA 3OVXA 1KFUL 1CVZA 5JH3A 4N8WA 2GFOA 1QOLA 2CIOA 4WURA 3KKUA 3OVZA 1F2AA 1QXPA 1A6RA 1KHPA 1FH0A 2DCDA 4N79A 4K7CA 2FRQA 2O6XA 1EWPA 3LXSA 2NQGA 1PPOA 9PAPA 2FUDA 1CSBB 3O0UA 1YZBA 2B1NA 4BS5A 3WXGA 2AS8A 2UZJA 3MP2A 2DZYA 2PBHA 1Y08A 2FTDA 3PSEA 1X9YA 1QMYA 4I05A 3BOWA 2YJ2A 4PI3A 4G54A 3BC3A 2XU1A 1PPNA 2H7JA 3B21A 1GECE 3MTNA 1XKGA 3KX1A 1EWMA 1YALA 3TRKA 3PT2A 1TL9A 1ME3A 2AVWA 1AU2A 1K3BB 4N4ZA 1U9WA 4MZOA 2J7QC 2GHUA 3C0RA 2BTWB 2DCAA 4IP3A 4MI7A 3CH2X 4P16A 1IWDA 2AYNA 3OQCA 3H8BA 1GCBA 2BU3A 3O65A 5F02A 3PHUA 1NQCA 5EF4A 2WBFX 2DC7A 3F5VA 2DJFB 2G6DA 3BB7A 3MHHA 3RNVA 3P5XA 2E03A 2E02A 2R9MA 4DMXA 2R9FA 2BDZA 3NHEA 4BS6A 4D8IA 2JTCA 1EWOA 4W5BA 3E9SA 1VSNA 4RKXA 1KFXL 2G8EA 2FT2A 3KSEA 1AIMA 1M6DA 3V6CA 3USVA 2C0YA 2PADA 3WXFA 4CDEB 3P5UA 1ICFA 1POPA 2XU4A 2DC8A 2JQFR 4QH6A 4AXLA 4X6JA 1AECA 3I06A 1MHWA 1CJLA 4PP2E 5CVMA 1EWLA 4D8EA 3BBAA 2NQIA 4YYRA 2PREA 1CPJA 3IEJA 3PHWA 1NPZA 2XU3A 3N3KA 3HD3A 1HUCB 3TMPA 2JQGR 4Q8GA 5CVOB 4PP1A 3CBJA 2R6NA 5CHTA 1U9QX 4PADA 1AU3A 4YYVA 3MORA 3K24A 2HD5A 4OW0A 2FE8A 4FJCA 3BCNA 2DCCA 2HH5A 1GLOA 3H7DA 3V6EA 1VJVA 3MHSA 4OELA 4Q8HA 4ZUXU 2HWKA 5J94A 3WXEA 1PIPA 3TNXA 5CVNB 3BPFA 5K16A 4HWYA 3H6SA 3E1ZB 3K8UA 1BP4A 1UKFA 1F2CA 2AU1A 3MJ5A 2F1GA 3MTVA 2E01A 2R9NA 3ZUAA 1S4VA 3C9EA 2AYOA 2Z84A 4YYSA 1CS8A 3BWKA 2NQDB 2DOSA 4RNAA 2B1MA 3PW3A 4W4UA 2Y6EA 4QRGA 1O0EA 2OULA 2G8JA 3HHAA 1PBHA 3PDFA 1ITOA 3N3GA 2VHSA 3ZNHA 2J7QA 2NQAA 4YYUA 1ME4A 2F7DA 3P5WA 3W31A 4RF1A 5EZQA 3S3RA 2YJ8A 3M99A 4BOPA 4PT5A 5CHVA 4GUAA 2AUZA 2P7UA 2YJ9A 3H8CA 2ARYA 1CB5A 4IUMA 4M0WA 8PCHA 2HXZA 2IBIA 1ZIVA 4RY2A 3IMAA 1F29A 1SNKA 1CQDA 1BY8A 2BTWA 4FK5A 2DZZA 3PNRA 1TU6A 3IUTA 4YVAA 2G7YA 3RVWA 1PCIA 1DEUA 3AI8A 2CB5A 1NLJA 4CZWA 4DMYA 1NB3A 4OVZB 3F75A 1AYWA
chains in the Genus database with same CATH topology
1U9VA 2R9CA 2FQ9A 2HHNA 3IOQA 4GUZA 1BGOA 2YJCA 2IPPB 3QSDA 2BSZA 3LFYA 2FRAA 2Y5BA 3P5VA 2DCBA 3CH3X 1EF7A 5A24A 4P6GA 3KFQA 3S3QA 1AYUA 3GCBA 1CV8A 2DC6A 2FYEA 4MSXA 2R9OA 3H89A 3O1GA 2YJBA 1YK7A 4XUIA 3QT4A 4YV8A 1MDWA 3N4CA 4AXMA 1W5RA 1PXVA 3KW9A 4CDCB 7PCKA 6PADA 4QRXA 1KXRA 4BQVA 4X6HA 1GMYA 4MZSA 4P6EA 1ATKA 1CTEA 1BQIA 4WA6A 4YYWA 3OF8A 4W5CA 4BPVA 1PADA 1KHQA 1Q6KA 5EGWA 1MEGA 2VHFA 2ATOA 4YYQA 4KLBA 1DF0A 3IV2A 1THEA 1AU0A 1NB5A 3HHIA 2BDLA 3D6SA 4CDDB 1GX3A 2AUXA 3PBHA 4CDFB 1PPPA 4QRVA 1Y4HA 4BGFA 3BPMA 1MS6A 2DJGB 1AU4A 4BSQA 4FIPA 2OZ2A 3K9MA 1F2BA 4I07A 4I04A 3HWNA 1AYVA 2P86A 3U8EA 3IHPA 2AIMA 1U9XA 4QBBA 3QJ3A 1QDQA 4XR7A 1YT7A 3LTWA 3RVXA 2P0RA 3DF0A 1TLOA 1ZCMA 1STFE 4OEMA 1JQPA 4X6IA 3I3TA 1MEMA 1YK8A 5PADA 3KWBX 1NL6A 3OF9A 1MIRA 1SP4B 1PPDA 5FPWA 1YVBA 2OP3A 3KWZA 3RVVA 1PE6A 2FO5A 5JA7A 1U5IA 3OISA 2DC9A 2XU5A 3B79A 3CBKA 1E2TA 2ACTA 2E00A 3ERVA 2PNSA 3OVXA 4NV7A 1KFUL 1CVZA 5JH3A 4N8WA 2GFOA 1QOLA 2CIOA 3KKUA 3OVZA 1F2AA 1QXPA 1A6RA 1KHPA 1FH0A 2DCDA 4N79A 4K7CA 2FRQA 2O6XA 1EWPA 3LXSA 2NQGA 1PPOA 9PAPA 2FUDA 1CSBB 3O0UA 2B1NA 4BS5A 3WXGA 2AS8A 2DZYA 2PBHA 1Y08A 2FTDA 1X9YA 1QMYA 4I05A 3BOWA 3D9WA 2YJ2A 4PI3A 4G54A 1W4TA 4B55A 3BC3A 2XU1A 1PPNA 2H7JA 1GECE 3MTNA 1XKGA 3KX1A 1EWMA 1YALA 1TL9A 1ME3A 2AVWA 1AU2A 1K3BB 4N4ZA 1U9WA 4MZOA 2GHUA 2DCAA 3CH2X 1IWDA 2AYNA 3H8BA 1GCBA 5F02A 1NQCA 5EF4A 2WBFX 2DC7A 3F5VA 2DJFB 2G6DA 3MHHA 3P5XA 2E03A 2VFCA 2E02A 2R9MA 4DMXA 2R9FA 4NV8A 2BDZA 3NHEA 4BS6A 2VFBA 1EWOA 4W5BA 1VSNA 1KFXL 2G8EA 2FT2A 3KSEA 1AIMA 1M6DA 3V6CA 3USVA 2C0YA 2PADA 3WXFA 4CDEB 3P5UA 1ICFA 1POPA 2XU4A 2DC8A 2JQFR 4QH6A 4AXLA 4X6JA 1AECA 3I06A 1MHWA 1CJLA 4PP2E 5CVMA 1EWLA 2NQIA 4YYRA 2PREA 1CPJA 3IEJA 1NPZA 2XU3A 3N3KA 3HD3A 1HUCB 4C5PA 2JQGR 4Q8GA 5CVOB 4PP1A 3CBJA 2R6NA 5CHTA 1U9QX 4PADA 1AU3A 4YYVA 3MORA 3K24A 2HD5A 4FJCA 3BCNA 2DCCA 2HH5A 1GLOA 3H7DA 3V6EA 1VJVA 3MHSA 4OELA 4Q8HA 4ZUXU 5J94A 3WXEA 1PIPA 3TNXA 5CVNB 3BPFA 5K16A 4HWYA 3H6SA 3E1ZB 3K8UA 1BP4A 1F2CA 2AU1A 2F1GA 2E01A 2R9NA 3ZUAA 1S4VA 3C9EA 2AYOA 4YYSA 1CS8A 3BWKA 2NQDB 2B1MA 3PW3A 4W4UA 2Y6EA 4QRGA 1O0EA 2OULA 2G8JA 3HHAA 1PBHA 3PDFA 1ITOA 3N3GA 2VHSA 2NQAA 4YYUA 1ME4A 2F7DA 3P5WA 3S3RA 2YJ8A 3M99A 5CHVA 2AUZA 2P7UA 2YJ9A 3H8CA 2ARYA 1CB5A 8PCHA 2HXZA 2IBIA 1ZIVA 4RY2A 3IMAA 1F29A 1SNKA 1CQDA 1BY8A 4FK5A 1W6FA 2DZZA 3PNRA 1TU6A 3IUTA 4YVAA 2G7YA 3RVWA 1PCIA 1DEUA 3AI8A 2CB5A 1NLJA 4CZWA 4DMYA 1NB3A 3F75A 1AYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9V A;  2R9C A;  2FQ9 A;  2HHN A;  3IOQ A;  1BGO A;  2YJC A;  2IPP B;  3QSD A;  3LFY A;  2FRA A;  2Y5B A;  3P5V A;  2DCB A;  3CH3 X;  1EF7 A;  5A24 A;  4P6G A;  3KFQ A;  3S3Q A;  1AYU A;  3GCB A;  1CV8 A;  2DC6 A;  2FYE A;  4MSX A;  2R9O A;  3H89 A;  3O1G A;  2YJB A;  1YK7 A;  4XUI A;  3QT4 A;  4YV8 A;  1MDW A;  3N4C A;  4AXM A;  1PXV A;  3KW9 A;  4CDC B;  7PCK A;  6PAD A;  4QRX A;  1KXR A;  4BQV A;  4X6H A;  1GMY A;  4MZS A;  4P6E A;  1ATK A;  1CTE A;  1BQI A;  4WA6 A;  4YYW A;  3OF8 A;  4W5C A;  4BPV A;  1PAD A;  1KHQ A;  1Q6K A;  5EGW A;  1MEG A;  2VHF A;  2ATO A;  4YYQ A;  4KLB A;  1DF0 A;  3IV2 A;  1THE A;  1AU0 A;  1NB5 A;  3HHI A;  2BDL A;  3D6S A;  4CDD B;  2AUX A;  3PBH A;  4CDF B;  1PPP A;  4QRV A;  1Y4H A;  3BPM A;  1MS6 A;  2DJG B;  1AU4 A;  4BSQ A;  4FIP A;  2OZ2 A;  3K9M A;  1F2B A;  4I07 A;  4I04 A;  3HWN A;  1AYV A;  2P86 A;  3U8E A;  3IHP A;  2AIM A;  1U9X A;  4QBB A;  3QJ3 A;  1QDQ A;  4XR7 A;  1YT7 A;  3RVX A;  2P0R A;  3DF0 A;  1TLO A;  1ZCM A;  1STF E;  4OEM A;  1JQP A;  4X6I A;  3I3T A;  1MEM A;  1YK8 A;  5PAD A;  3KWB X;  1NL6 A;  3OF9 A;  1MIR A;  1SP4 B;  1PPD A;  5FPW A;  1YVB A;  2OP3 A;  3KWZ A;  3RVV A;  1PE6 A;  2FO5 A;  5JA7 A;  1U5I A;  3OIS A;  2DC9 A;  2XU5 A;  3B79 A;  3CBK A;  2ACT A;  2E00 A;  3ERV A;  2PNS A;  3OVX A;  1KFU L;  1CVZ A;  5JH3 A;  4N8W A;  2GFO A;  1QOL A;  2CIO A;  3KKU A;  3OVZ A;  1F2A A;  1QXP A;  1A6R A;  1KHP A;  1FH0 A;  2DCD A;  4N79 A;  4K7C A;  2FRQ A;  2O6X A;  1EWP A;  3LXS A;  2NQG A;  1PPO A;  9PAP A;  2FUD A;  1CSB B;  3O0U A;  2B1N A;  4BS5 A;  3WXG A;  2AS8 A;  2DZY A;  2PBH A;  1Y08 A;  2FTD A;  1X9Y A;  1QMY A;  4I05 A;  3BOW A;  2YJ2 A;  4PI3 A;  4G54 A;  3BC3 A;  2XU1 A;  1PPN A;  2H7J A;  1GEC E;  3MTN A;  1XKG A;  3KX1 A;  1EWM A;  1YAL A;  1TL9 A;  1ME3 A;  2AVW A;  1AU2 A;  1K3B B;  4N4Z A;  1U9W A;  4MZO A;  2GHU A;  2DCA A;  3CH2 X;  1IWD A;  2AYN A;  3H8B A;  1GCB A;  5F02 A;  1NQC A;  5EF4 A;  2WBF X;  2DC7 A;  3F5V A;  2DJF B;  2G6D A;  3MHH A;  3P5X A;  2E03 A;  2E02 A;  2R9M A;  4DMX A;  2R9F A;  2BDZ A;  3NHE A;  4BS6 A;  1EWO A;  4W5B A;  1VSN A;  1KFX L;  2G8E A;  2FT2 A;  3KSE A;  1AIM A;  1M6D A;  3V6C A;  3USV A;  2C0Y A;  2PAD A;  3WXF A;  4CDE B;  3P5U A;  1ICF A;  1POP A;  2XU4 A;  2DC8 A;  2JQF R;  4QH6 A;  4AXL A;  4X6J A;  1AEC A;  3I06 A;  1MHW A;  1CJL A;  4PP2 E;  5CVM A;  1EWL A;  2NQI A;  4YYR A;  2PRE A;  1CPJ A;  3IEJ A;  1NPZ A;  2XU3 A;  3N3K A;  3HD3 A;  1HUC B;  2JQG R;  4Q8G A;  5CVO B;  4PP1 A;  3CBJ A;  2R6N A;  5CHT A;  1U9Q X;  4PAD A;  1AU3 A;  4YYV A;  3MOR A;  3K24 A;  2HD5 A;  4FJC A;  3BCN A;  2DCC A;  2HH5 A;  1GLO A;  3H7D A;  3V6E A;  1VJV A;  3MHS A;  4OEL A;  4Q8H A;  4ZUX U;  5J94 A;  3WXE A;  1PIP A;  3TNX A;  5CVN B;  3BPF A;  5K16 A;  4HWY A;  3H6S A;  3E1Z B;  3K8U A;  1BP4 A;  1F2C A;  2AU1 A;  2F1G A;  2E01 A;  2R9N A;  3ZUA A;  1S4V A;  3C9E A;  2AYO A;  4YYS A;  1CS8 A;  3BWK A;  2NQD B;  2B1M A;  3PW3 A;  4W4U A;  2Y6E A;  4QRG A;  1O0E A;  2OUL A;  2G8J A;  3HHA A;  1PBH A;  3PDF A;  1ITO A;  3N3G A;  2VHS A;  2NQA A;  4YYU A;  1ME4 A;  2F7D A;  3P5W A;  3S3R A;  2YJ8 A;  3M99 A;  5CHV A;  2AUZ A;  2P7U A;  2YJ9 A;  3H8C A;  2ARY A;  1CB5 A;  8PCH A;  2HXZ A;  2IBI A;  1ZIV A;  4RY2 A;  3IMA A;  1F29 A;  1SNK A;  1CQD A;  1BY8 A;  4FK5 A;  2DZZ A;  3PNR A;  1TU6 A;  3IUT A;  4YVA A;  2G7Y A;  3RVW A;  1PCI A;  1DEU A;  3AI8 A;  2CB5 A;  1NLJ A;  4CZW A;  4DMY A;  1NB3 A;  3F75 A;  1AYW A; 
#chains in the Genus database with same CATH topology
 1U9V A;  5E6J A;  2R9C A;  2FQ9 A;  2HHN A;  3IOQ A;  1BGO A;  2YJC A;  2IPP B;  5JZE A;  5EZS A;  3QSD A;  3LFY A;  2FRA A;  2Y5B A;  3P5V A;  2DCB A;  3CH3 X;  3IFU A;  1EF7 A;  4RF0 A;  5A24 A;  4P6G A;  3KFQ A;  4BOQ A;  3S3Q A;  1AYU A;  3GCB A;  1CV8 A;  2DC6 A;  2FYE A;  4MSX A;  2R9O A;  4A5U A;  3H89 A;  3O1G A;  2YJB A;  1YK7 A;  4XUI A;  3QT4 A;  4YV8 A;  1MDW A;  4OVZ A;  3N4C A;  4AXM A;  1PXV A;  3KW9 A;  4CDC B;  7PCK A;  6PAD A;  3W30 A;  4QRX A;  1KXR A;  4BQV A;  4X6H A;  1GMY A;  4MZS A;  4P6E A;  1ATK A;  4BOU A;  1CTE A;  1BQI A;  4WA6 A;  4YYW A;  3OF8 A;  4W5C A;  4BPV A;  1PAD A;  1KHQ A;  1Q6K A;  5EGW A;  1MEG A;  4XZX A;  2VHF A;  2ATO A;  4YYQ A;  4KLB A;  1DKI A;  1DF0 A;  3IV2 A;  4D8B A;  1THE A;  3PRM A;  1AU0 A;  1NB5 A;  3HHI A;  2BDL A;  2JRI A;  3D6S A;  4CDD B;  4MM3 B;  2AUX A;  3PBH A;  4CDF B;  1PPP A;  4QRV A;  1Y4H A;  3BPM A;  1MS6 A;  2DJG B;  1AU4 A;  4BSQ A;  4FIP A;  2OZ2 A;  3K9M A;  4ZTB A;  1F2B A;  4I07 A;  4I04 A;  3HWN A;  1AYV A;  2P86 A;  2AGA A;  3U8E A;  3IHP A;  2AIM A;  1U9X A;  4QBB A;  3QJ3 A;  1QDQ A;  4XR7 A;  1YT7 A;  3PHX A;  3BY4 A;  3RVX A;  4R3D A;  4BOS A;  2P0R A;  5KO3 A;  3DF0 A;  1TLO A;  1ZCM A;  1STF E;  4OEM A;  1JQP A;  4REZ A;  4X6I A;  3I3T A;  3PRP A;  4HXD B;  1MEM A;  1YK8 A;  5PAD A;  3KWB X;  1NL6 A;  3OF9 A;  1MIR A;  1SP4 B;  1PPD A;  5FPW A;  4BOZ A;  1PVJ A;  1YVB A;  2OP3 A;  3KWZ A;  3RVV A;  1PE6 A;  2FO5 A;  5JA7 A;  1U5I A;  3OIS A;  2DC9 A;  2XU5 A;  3B79 A;  3CBK A;  2ACT A;  2E00 A;  3ERV A;  2PNS A;  3OVX A;  1KFU L;  1CVZ A;  5JH3 A;  4N8W A;  2GFO A;  1QOL A;  2CIO A;  4WUR A;  3KKU A;  3OVZ A;  1F2A A;  1QXP A;  1A6R A;  1KHP A;  1FH0 A;  2DCD A;  4N79 A;  4K7C A;  2FRQ A;  2O6X A;  1EWP A;  3LXS A;  2NQG A;  1PPO A;  9PAP A;  2FUD A;  1CSB B;  3O0U A;  1YZB A;  2B1N A;  4BS5 A;  3WXG A;  2AS8 A;  2UZJ A;  3MP2 A;  2DZY A;  2PBH A;  1Y08 A;  2FTD A;  3PSE A;  1X9Y A;  1QMY A;  4I05 A;  3BOW A;  2YJ2 A;  4PI3 A;  4G54 A;  3BC3 A;  2XU1 A;  1PPN A;  2H7J A;  3B21 A;  1GEC E;  3MTN A;  1XKG A;  3KX1 A;  1EWM A;  1YAL A;  3TRK A;  3PT2 A;  1TL9 A;  1ME3 A;  2AVW A;  1AU2 A;  1K3B B;  4N4Z A;  1U9W A;  4MZO A;  2J7Q C;  2GHU A;  3C0R A;  2BTW B;  2DCA A;  4IP3 A;  4MI7 A;  3CH2 X;  4P16 A;  1IWD A;  2AYN A;  3OQC A;  3H8B A;  1GCB A;  2BU3 A;  3O65 A;  5F02 A;  3PHU A;  1NQC A;  5EF4 A;  2WBF X;  2DC7 A;  3F5V A;  2DJF B;  2G6D A;  3BB7 A;  3MHH A;  3RNV A;  3P5X A;  2E03 A;  2E02 A;  2R9M A;  4DMX A;  2R9F A;  2BDZ A;  3NHE A;  4BS6 A;  4D8I A;  2JTC A;  1EWO A;  4W5B A;  3E9S A;  1VSN A;  4RKX A;  1KFX L;  2G8E A;  2FT2 A;  3KSE A;  1AIM A;  1M6D A;  3V6C A;  3USV A;  2C0Y A;  2PAD A;  3WXF A;  4CDE B;  3P5U A;  1ICF A;  1POP A;  2XU4 A;  2DC8 A;  2JQF R;  4QH6 A;  4AXL A;  4X6J A;  1AEC A;  3I06 A;  1MHW A;  1CJL A;  4PP2 E;  5CVM A;  1EWL A;  4D8E A;  3BBA A;  2NQI A;  4YYR A;  2PRE A;  1CPJ A;  3IEJ A;  3PHW A;  1NPZ A;  2XU3 A;  3N3K A;  3HD3 A;  1HUC B;  3TMP A;  2JQG R;  4Q8G A;  5CVO B;  4PP1 A;  3CBJ A;  2R6N A;  5CHT A;  1U9Q X;  4PAD A;  1AU3 A;  4YYV A;  3MOR A;  3K24 A;  2HD5 A;  4OW0 A;  2FE8 A;  4FJC A;  3BCN A;  2DCC A;  2HH5 A;  1GLO A;  3H7D A;  3V6E A;  1VJV A;  3MHS A;  4OEL A;  4Q8H A;  4ZUX U;  2HWK A;  5J94 A;  3WXE A;  1PIP A;  3TNX A;  5CVN B;  3BPF A;  5K16 A;  4HWY A;  3H6S A;  3E1Z B;  3K8U A;  1BP4 A;  1UKF A;  1F2C A;  2AU1 A;  3MJ5 A;  2F1G A;  3MTV A;  2E01 A;  2R9N A;  3ZUA A;  1S4V A;  3C9E A;  2AYO A;  2Z84 A;  4YYS A;  1CS8 A;  3BWK A;  2NQD B;  2DOS A;  4RNA A;  2B1M A;  3PW3 A;  4W4U A;  2Y6E A;  4QRG A;  1O0E A;  2OUL A;  2G8J A;  3HHA A;  1PBH A;  3PDF A;  1ITO A;  3N3G A;  2VHS A;  3ZNH A;  2J7Q A;  2NQA A;  4YYU A;  1ME4 A;  2F7D A;  3P5W A;  3W31 A;  4RF1 A;  5EZQ A;  3S3R A;  2YJ8 A;  3M99 A;  4BOP A;  4PT5 A;  5CHV A;  4GUA A;  2AUZ A;  2P7U A;  2YJ9 A;  3H8C A;  2ARY A;  1CB5 A;  4IUM A;  4M0W A;  8PCH A;  2HXZ A;  2IBI A;  1ZIV A;  4RY2 A;  3IMA A;  1F29 A;  1SNK A;  1CQD A;  1BY8 A;  2BTW A;  4FK5 A;  2DZZ A;  3PNR A;  1TU6 A;  3IUT A;  4YVA A;  2G7Y A;  3RVW A;  1PCI A;  1DEU A;  3AI8 A;  2CB5 A;  1NLJ A;  4CZW A;  4DMY A;  1NB3 A;  4OVZ B;  3F75 A;  1AYW A; 
#chains in the Genus database with same CATH homology
 1U9V A;  2R9C A;  2FQ9 A;  2HHN A;  3IOQ A;  4GUZ A;  1BGO A;  2YJC A;  2IPP B;  3QSD A;  2BSZ A;  3LFY A;  2FRA A;  2Y5B A;  3P5V A;  2DCB A;  3CH3 X;  1EF7 A;  5A24 A;  4P6G A;  3KFQ A;  3S3Q A;  1AYU A;  3GCB A;  1CV8 A;  2DC6 A;  2FYE A;  4MSX A;  2R9O A;  3H89 A;  3O1G A;  2YJB A;  1YK7 A;  4XUI A;  3QT4 A;  4YV8 A;  1MDW A;  3N4C A;  4AXM A;  1W5R A;  1PXV A;  3KW9 A;  4CDC B;  7PCK A;  6PAD A;  4QRX A;  1KXR A;  4BQV A;  4X6H A;  1GMY A;  4MZS A;  4P6E A;  1ATK A;  1CTE A;  1BQI A;  4WA6 A;  4YYW A;  3OF8 A;  4W5C A;  4BPV A;  1PAD A;  1KHQ A;  1Q6K A;  5EGW A;  1MEG A;  2VHF A;  2ATO A;  4YYQ A;  4KLB A;  1DF0 A;  3IV2 A;  1THE A;  1AU0 A;  1NB5 A;  3HHI A;  2BDL A;  3D6S A;  4CDD B;  1GX3 A;  2AUX A;  3PBH A;  4CDF B;  1PPP A;  4QRV A;  1Y4H A;  4BGF A;  3BPM A;  1MS6 A;  2DJG B;  1AU4 A;  4BSQ A;  4FIP A;  2OZ2 A;  3K9M A;  1F2B A;  4I07 A;  4I04 A;  3HWN A;  1AYV A;  2P86 A;  3U8E A;  3IHP A;  2AIM A;  1U9X A;  4QBB A;  3QJ3 A;  1QDQ A;  4XR7 A;  1YT7 A;  3LTW A;  3RVX A;  2P0R A;  3DF0 A;  1TLO A;  1ZCM A;  1STF E;  4OEM A;  1JQP A;  4X6I A;  3I3T A;  1MEM A;  1YK8 A;  5PAD A;  3KWB X;  1NL6 A;  3OF9 A;  1MIR A;  1SP4 B;  1PPD A;  5FPW A;  1YVB A;  2OP3 A;  3KWZ A;  3RVV A;  1PE6 A;  2FO5 A;  5JA7 A;  1U5I A;  3OIS A;  2DC9 A;  2XU5 A;  3B79 A;  3CBK A;  1E2T A;  2ACT A;  2E00 A;  3ERV A;  2PNS A;  3OVX A;  4NV7 A;  1KFU L;  1CVZ A;  5JH3 A;  4N8W A;  2GFO A;  1QOL A;  2CIO A;  3KKU A;  3OVZ A;  1F2A A;  1QXP A;  1A6R A;  1KHP A;  1FH0 A;  2DCD A;  4N79 A;  4K7C A;  2FRQ A;  2O6X A;  1EWP A;  3LXS A;  2NQG A;  1PPO A;  9PAP A;  2FUD A;  1CSB B;  3O0U A;  2B1N A;  4BS5 A;  3WXG A;  2AS8 A;  2DZY A;  2PBH A;  1Y08 A;  2FTD A;  1X9Y A;  1QMY A;  4I05 A;  3BOW A;  3D9W A;  2YJ2 A;  4PI3 A;  4G54 A;  1W4T A;  4B55 A;  3BC3 A;  2XU1 A;  1PPN A;  2H7J A;  1GEC E;  3MTN A;  1XKG A;  3KX1 A;  1EWM A;  1YAL A;  1TL9 A;  1ME3 A;  2AVW A;  1AU2 A;  1K3B B;  4N4Z A;  1U9W A;  4MZO A;  2GHU A;  2DCA A;  3CH2 X;  1IWD A;  2AYN A;  3H8B A;  1GCB A;  5F02 A;  1NQC A;  5EF4 A;  2WBF X;  2DC7 A;  3F5V A;  2DJF B;  2G6D A;  3MHH A;  3P5X A;  2E03 A;  2VFC A;  2E02 A;  2R9M A;  4DMX A;  2R9F A;  4NV8 A;  2BDZ A;  3NHE A;  4BS6 A;  2VFB A;  1EWO A;  4W5B A;  1VSN A;  1KFX L;  2G8E A;  2FT2 A;  3KSE A;  1AIM A;  1M6D A;  3V6C A;  3USV A;  2C0Y A;  2PAD A;  3WXF A;  4CDE B;  3P5U A;  1ICF A;  1POP A;  2XU4 A;  2DC8 A;  2JQF R;  4QH6 A;  4AXL A;  4X6J A;  1AEC A;  3I06 A;  1MHW A;  1CJL A;  4PP2 E;  5CVM A;  1EWL A;  2NQI A;  4YYR A;  2PRE A;  1CPJ A;  3IEJ A;  1NPZ A;  2XU3 A;  3N3K A;  3HD3 A;  1HUC B;  4C5P A;  2JQG R;  4Q8G A;  5CVO B;  4PP1 A;  3CBJ A;  2R6N A;  5CHT A;  1U9Q X;  4PAD A;  1AU3 A;  4YYV A;  3MOR A;  3K24 A;  2HD5 A;  4FJC A;  3BCN A;  2DCC A;  2HH5 A;  1GLO A;  3H7D A;  3V6E A;  1VJV A;  3MHS A;  4OEL A;  4Q8H A;  4ZUX U;  5J94 A;  3WXE A;  1PIP A;  3TNX A;  5CVN B;  3BPF A;  5K16 A;  4HWY A;  3H6S A;  3E1Z B;  3K8U A;  1BP4 A;  1F2C A;  2AU1 A;  2F1G A;  2E01 A;  2R9N A;  3ZUA A;  1S4V A;  3C9E A;  2AYO A;  4YYS A;  1CS8 A;  3BWK A;  2NQD B;  2B1M A;  3PW3 A;  4W4U A;  2Y6E A;  4QRG A;  1O0E A;  2OUL A;  2G8J A;  3HHA A;  1PBH A;  3PDF A;  1ITO A;  3N3G A;  2VHS A;  2NQA A;  4YYU A;  1ME4 A;  2F7D A;  3P5W A;  3S3R A;  2YJ8 A;  3M99 A;  5CHV A;  2AUZ A;  2P7U A;  2YJ9 A;  3H8C A;  2ARY A;  1CB5 A;  8PCH A;  2HXZ A;  2IBI A;  1ZIV A;  4RY2 A;  3IMA A;  1F29 A;  1SNK A;  1CQD A;  1BY8 A;  4FK5 A;  1W6F A;  2DZZ A;  3PNR A;  1TU6 A;  3IUT A;  4YVA A;  2G7Y A;  3RVW A;  1PCI A;  1DEU A;  3AI8 A;  2CB5 A;  1NLJ A;  4CZW A;  4DMY A;  1NB3 A;  3F75 A;  1AYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...