1BP4A

Use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PAPAIN
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bp4A00
2R9NA 1QMYA 4FJCA 4YYWA 2ARYA 4PI3A 1O0EA 4CDEB 2G8JA 1YK7A 3ZUAA 1NLJA 4YYVA 1MHWA 5EGWA 2FO5A 3BPFA 2R9FA 4Q8GA 3IOQA 3KW9A 5JH3A 2HHNA 2XU3A 5CHTA 1PCIA 2IBIA 1CB5A 1XKGA 3H8BA 1YT7A 1IWDA 2DZZA 3I06A 3KX1A 3S3RA 1AU2A 3F5VA 3HHAA 2OZ2A 2R9MA 1BP4A 1AECA 1PADA 2DC7A 2F7DA 5F02A 1Y4HA 3P5WA 2VHFA 1ZCMA 2GFOA 4RY2A 2PBHA 2Y5BA 1EWOA 2YJBA 2XU1A 3CBJA 2G6DA 2AU1A 1CVZA 3WXGA 3P5UA 2DJFB 2FT2A 1YK8A 2BDZA 7PCKA 4I04A 2YJ8A 2AUXA 2O6XA 3TNXA 3M99A 3PW3A 1JQPA 1ICFA 3OF9A 3DF0A 1ME3A 2G8EA 4XUIA 2B1MA 2DCCA 3CBKA 2DZYA 4BQVA 3OVZA 1QDQA 2NQAA 4BS5A 1YALA 1YVBA 5EF4A 2P0RA 1KXRA 1BY8A 4P6GA 3PDFA 4G54A 3WXFA 1EWLA 3MTNA 1PPPA 2XU4A 2NQIA 1EWMA 2H7JA 3WXEA 3BPMA 3LXSA 1AYWA 4YYUA 1GMYA 2CB5A 4XR7A 2P7UA 4P6EA 3KWZA 2PADA 4BPVA 3HWNA 3BWKA 3CH3X 2XU5A 1NB3A 3OF8A 2C0YA 3MORA 2DC8A 3N3GA 1U5IA 1KFXL 3MHSA 2G7YA 1BQIA 3H6SA 1NQCA 4X6JA 4QH6A 3OISA 4YYQA 3BCNA 3O1GA 1KHPA 3H7DA 1NB5A 4QBBA 3S3QA 6PADA 2PNSA 1FH0A 8PCHA 1STFE 2AYNA 1THEA 5CVMA 1CSBB 5CVNB 4PADA 5PADA 4YYRA 1MDWA 2HXZA 1CPJA 3OVXA 1PPNA 3HHIA 3QSDA 2ACTA 1NL6A 1NPZA 3IMAA 1AU3A 1QOLA 4OELA 1AIMA 2FUDA 3IHPA 3B79A 3BC3A 2NQDB 4BS6A 4Q8HA 1U9WA 1PBHA 2WBFX 2HH5A 2VHSA 3RVXA 2PREA 1ZIVA 2FRAA 3QT4A 1Q6KA 2DCDA 2AIMA 5JA7A 4I05A 4KLBA 2F1GA 2IPPB 4DMYA 2JQFR 3F75A 1PE6A 3KKUA 5CVOB 1ME4A 1S4VA 4CDDB 1DEUA 3U8EA 3CH2X 3K24A 2AYOA 2NQGA 2B1NA 1X9YA 3H89A 3NHEA 4WA6A 2GHUA 3AI8A 5A24A 2BDLA 1M6DA 4N8WA 3IEJA 2DJGB 2E00A 1DF0A 1EF7A 4AXMA 1Y08A 3P5XA 1PPOA 3GCBA 4N4ZA 2OP3A 4FIPA 3P5VA 1HUCB 2AUZA 1AYUA 1MS6A 2CIOA 1A6RA 2AVWA 2DC6A 9PAPA 4PP2E 1CTEA 4OEMA 1EWPA 3O0UA 3MHHA 2R9OA 3HD3A 4N79A 1AU0A 3LFYA 2FQ9A 1PPDA 1K3BB 4PP1A 1KHQA 3RVVA 3E1ZB 1QXPA 2FTDA 3ERVA 1KFUL 1F29A 4I07A 1TU6A 2Y6EA 4X6IA 4K7CA 2E02A 5K16A 5FPWA 1U9XA 3K9MA 2YJ9A 2YJCA 4FK5A 1CQDA 3QJ3A 1BGOA 2OULA 2YJ2A 2HD5A 3C9EA 3V6CA 5J94A 1CJLA 3I3TA 3IV2A 1POPA 2FRQA 3USVA 3H8CA 1F2BA 4CDCB 1GCBA 1ATKA 4YV8A 4AXLA 4YVAA 2R9CA 4W4UA 4QRXA 2DCBA 4W5BA 4ZUXU 1CS8A 1TLOA 1VSNA 1TL9A 4DMXA 1F2AA 2P86A 3PBHA 1U9VA 3V6EA 1PIPA 3RVWA 4HWYA 1GLOA 2E03A 1MEMA 4MSXA 2DC9A 1SP4B 3N3KA 3N4CA 2AS8A 3D6SA 1F2CA 1PXVA 2JQGR 3KFQA 1U9QX 4YYSA 1GECE 3PNRA 1VJVA 4QRGA 5CHVA 4CDFB 2R6NA 4X6HA 4BSQA 4MZOA 1ITOA 4CZWA 3K8UA 2DCAA 3IUTA 3BOWA 3KSEA 1CV8A 4MZSA 1MIRA 4QRVA 2E01A 1SNKA 1AU4A 1MEGA 1AYVA 2ATOA 4W5CA 3KWBX 2FYEA
chains in the Genus database with same CATH superfamily
2R9NA 1QMYA 4FJCA 4YYWA 2ARYA 4PI3A 1O0EA 4IUMA 4CDEB 2G8JA 3O65A 1YK7A 3ZUAA 3PHUA 1NLJA 4ZTBA 4YYVA 1MHWA 5EGWA 2FO5A 3BPFA 2R9FA 4Q8GA 3TMPA 3IOQA 3KW9A 5JH3A 2HHNA 2XU3A 5CHTA 1PCIA 2IBIA 1CB5A 1XKGA 3H8BA 1YT7A 3RNVA 1IWDA 2DZZA 3I06A 1DKIA 3KX1A 5EZSA 3S3RA 1AU2A 3F5VA 3HHAA 2OZ2A 2R9MA 1BP4A 1AECA 1PADA 4P16A 2DC7A 2F7DA 4GUAA 5F02A 1Y4HA 3P5WA 2VHFA 1ZCMA 2GFOA 4M0WA 4RY2A 2PBHA 2DOSA 2Y5BA 4XZXA 1EWOA 2YJBA 2XU1A 3CBJA 2G6DA 2AU1A 1CVZA 3PRPA 3WXGA 3P5UA 2DJFB 2FT2A 1YK8A 2BDZA 7PCKA 4I04A 2YJ8A 2AUXA 2O6XA 3TNXA 3M99A 3PW3A 1JQPA 1ICFA 3OF9A 3DF0A 4BOSA 3C0RA 1ME3A 2G8EA 4XUIA 2B1MA 2DCCA 4D8BA 3CBKA 4A5UA 2DZYA 2J7QC 4BQVA 3OVZA 3MTVA 2J7QA 1QDQA 2BTWB 2NQAA 4BS5A 1YALA 1YVBA 5EF4A 2P0RA 1KXRA 4RF0A 1BY8A 5E6JA 3BB7A 4P6GA 3PDFA 4G54A 3WXFA 4HXDB 1EWLA 3MTNA 1PPPA 3W31A 2XU4A 2NQIA 1EWMA 2H7JA 3MJ5A 3WXEA 3BPMA 3LXSA 1AYWA 4YYUA 1GMYA 2CB5A 4XR7A 2P7UA 4P6EA 3KWZA 2PADA 3BBAA 4BPVA 1UKFA 3HWNA 3BWKA 3CH3X 2XU5A 1NB3A 5JZEA 3OF8A 2C0YA 3MORA 2DC8A 3N3GA 2Z84A 3PSEA 1U5IA 1KFXL 3MHSA 2G7YA 1BQIA 3H6SA 1NQCA 4X6JA 4QH6A 4BOUA 3OISA 4YYQA 4RKXA 3BCNA 3O1GA 1KHPA 3H7DA 1NB5A 4QBBA 3S3QA 6PADA 2PNSA 1FH0A 3E9SA 8PCHA 1STFE 2AYNA 1THEA 5CVMA 1CSBB 5CVNB 4PADA 4RNAA 5PADA 4YYRA 1MDWA 2HXZA 1CPJA 3OVXA 1PPNA 3HHIA 4PT5A 3QSDA 2ACTA 1NL6A 1NPZA 3IMAA 1AU3A 1QOLA 4OELA 5EZQA 1AIMA 2FUDA 3IHPA 3B79A 3BC3A 2NQDB 4BS6A 4Q8HA 2HWKA 1U9WA 1PBHA 2WBFX 2HH5A 2VHSA 3PRMA 3OQCA 2PREA 3RVXA 2AGAA 5KO3A 1ZIVA 2FRAA 3QT4A 3TRKA 1Q6KA 2DCDA 2AIMA 5JA7A 4I05A 4KLBA 2F1GA 2IPPB 4DMYA 2JQFR 3F75A 1PE6A 3KKUA 5CVOB 1ME4A 4BOPA 2JRIA 3B21A 4D8EA 1S4VA 4CDDB 1DEUA 3U8EA 3CH2X 4OVZB 3ZNHA 3K24A 4BOZA 2AYOA 2NQGA 3IFUA 2B1NA 1X9YA 3H89A 3NHEA 4RF1A 4WA6A 2GHUA 3AI8A 5A24A 2BDLA 1M6DA 4N8WA 3IEJA 2DJGB 2E00A 1DF0A 1PVJA 1EF7A 4AXMA 2BTWA 1Y08A 3P5XA 1PPOA 3GCBA 4N4ZA 2OP3A 4FIPA 3P5VA 1HUCB 2AUZA 1AYUA 2FE8A 1MS6A 4D8IA 2CIOA 1A6RA 2AVWA 2DC6A 9PAPA 4PP2E 1CTEA 4OEMA 1EWPA 3O0UA 3MHHA 4MI7A 2R9OA 3HD3A 4IP3A 4N79A 1AU0A 3LFYA 2FQ9A 2JTCA 1PPDA 1K3BB 4PP1A 1KHQA 3RVVA 3E1ZB 1QXPA 2FTDA 3ERVA 3PHWA 1KFUL 1F29A 4I07A 1TU6A 2Y6EA 4X6IA 4K7CA 2E02A 5K16A 5FPWA 1U9XA 3K9MA 2YJ9A 2YJCA 4FK5A 1CQDA 3QJ3A 1BGOA 2OULA 2YJ2A 2HD5A 3C9EA 3V6CA 5J94A 1CJLA 4WURA 3I3TA 3IV2A 1POPA 3BY4A 2FRQA 3USVA 3H8CA 1F2BA 4CDCB 1GCBA 3W30A 1ATKA 4YV8A 4REZA 4AXLA 4YVAA 2R9CA 4W4UA 4QRXA 2DCBA 4W5BA 4ZUXU 1CS8A 1TLOA 1VSNA 3MP2A 1TL9A 4DMXA 1F2AA 4OW0A 2P86A 3PBHA 1U9VA 3V6EA 1PIPA 3RVWA 4HWYA 1GLOA 2E03A 1MEMA 4BOQA 3PT2A 2UZJA 3PHXA 4MSXA 2DC9A 1SP4B 3N3KA 3N4CA 2AS8A 3D6SA 1F2CA 1PXVA 2JQGR 3KFQA 1U9QX 4OVZA 2BU3A 4YYSA 1GECE 3PNRA 1VJVA 4QRGA 5CHVA 4CDFB 2R6NA 4X6HA 4BSQA 4MZOA 1YZBA 1ITOA 4CZWA 3K8UA 2DCAA 3IUTA 3BOWA 3KSEA 1CV8A 4R3DA 4MZSA 1MIRA 4QRVA 2E01A 1SNKA 1AU4A 1MEGA 1AYVA 2ATOA 4W5CA 3KWBX 4MM3B 2FYEA
chains in the Genus database with same CATH topology
2R9NA 1QMYA 4FJCA 4YYWA 2ARYA 4PI3A 1O0EA 4CDEB 2G8JA 1YK7A 3ZUAA 1NLJA 4YYVA 1MHWA 5EGWA 2FO5A 3BPFA 2R9FA 4Q8GA 3IOQA 3KW9A 5JH3A 2HHNA 2XU3A 5CHTA 1PCIA 2IBIA 1CB5A 1XKGA 3H8BA 1YT7A 1IWDA 2DZZA 3I06A 3KX1A 3S3RA 1AU2A 3F5VA 3HHAA 2OZ2A 2R9MA 1BP4A 1AECA 1PADA 2DC7A 2F7DA 5F02A 4GUZA 1E2TA 1Y4HA 3P5WA 2VHFA 1W5RA 1ZCMA 2GFOA 4RY2A 2PBHA 2Y5BA 1EWOA 2YJBA 2XU1A 3CBJA 2G6DA 2AU1A 1CVZA 3WXGA 3P5UA 2DJFB 2FT2A 1YK8A 2BDZA 7PCKA 4I04A 2YJ8A 2AUXA 2O6XA 3TNXA 3M99A 3PW3A 1JQPA 1ICFA 3OF9A 3DF0A 4C5PA 1ME3A 2G8EA 4XUIA 2B1MA 2DCCA 3CBKA 2DZYA 4BQVA 3OVZA 1QDQA 2NQAA 4BS5A 1YALA 1YVBA 5EF4A 2P0RA 1KXRA 1BY8A 4P6GA 3PDFA 4G54A 3WXFA 1EWLA 3MTNA 1PPPA 2XU4A 2NQIA 1EWMA 2H7JA 3WXEA 3LTWA 3BPMA 3LXSA 1AYWA 4YYUA 1GMYA 2CB5A 4XR7A 2P7UA 4P6EA 3KWZA 2PADA 4B55A 4BPVA 3HWNA 3BWKA 3CH3X 2XU5A 1NB3A 3OF8A 2C0YA 3MORA 2DC8A 3N3GA 1U5IA 1KFXL 3MHSA 2G7YA 1BQIA 3H6SA 4X6JA 1NQCA 4QH6A 3OISA 4YYQA 3BCNA 3O1GA 1KHPA 3H7DA 1NB5A 4QBBA 3S3QA 6PADA 2PNSA 1FH0A 8PCHA 1STFE 2AYNA 1THEA 5CVMA 1CSBB 5CVNB 4PADA 5PADA 4YYRA 1MDWA 2HXZA 1CPJA 3OVXA 1PPNA 3HHIA 3QSDA 2ACTA 1NL6A 1NPZA 3IMAA 1AU3A 1QOLA 4OELA 1AIMA 2FUDA 3IHPA 3B79A 3BC3A 2NQDB 4BS6A 4Q8HA 1U9WA 1PBHA 2WBFX 2HH5A 2VHSA 3RVXA 2PREA 1ZIVA 2FRAA 3QT4A 1Q6KA 2DCDA 2AIMA 5JA7A 4I05A 4KLBA 2F1GA 2IPPB 4DMYA 2JQFR 3F75A 1PE6A 3KKUA 5CVOB 1ME4A 1S4VA 4CDDB 1DEUA 3U8EA 3CH2X 3K24A 2AYOA 2NQGA 2B1NA 1X9YA 3H89A 3NHEA 4WA6A 2GHUA 3AI8A 5A24A 2BDLA 1M6DA 4N8WA 3IEJA 2DJGB 2E00A 1DF0A 1EF7A 4AXMA 1Y08A 3P5XA 1PPOA 3D9WA 4NV8A 3GCBA 4N4ZA 2OP3A 2VFCA 4FIPA 3P5VA 1HUCB 2AUZA 1AYUA 1GX3A 1MS6A 4NV7A 2CIOA 1A6RA 2AVWA 2DC6A 9PAPA 4PP2E 1CTEA 4OEMA 1EWPA 3O0UA 4BGFA 3MHHA 2R9OA 3HD3A 4N79A 1AU0A 3LFYA 2FQ9A 1PPDA 1K3BB 4PP1A 1KHQA 3RVVA 3E1ZB 1QXPA 2FTDA 3ERVA 1KFUL 1F29A 4I07A 1TU6A 2Y6EA 4X6IA 4K7CA 2E02A 5K16A 5FPWA 1U9XA 3K9MA 2YJ9A 2YJCA 4FK5A 1CQDA 3QJ3A 1BGOA 2OULA 2YJ2A 2HD5A 3C9EA 3V6CA 5J94A 1CJLA 3I3TA 3IV2A 1POPA 2FRQA 3USVA 3H8CA 1F2BA 4CDCB 1GCBA 1ATKA 4YV8A 4AXLA 4YVAA 2R9CA 4W4UA 4QRXA 2DCBA 4W5BA 4ZUXU 1CS8A 1TLOA 1VSNA 1TL9A 4DMXA 1F2AA 2P86A 3PBHA 1U9VA 3V6EA 1PIPA 3RVWA 4HWYA 1GLOA 2E03A 1MEMA 4MSXA 2DC9A 1SP4B 3N3KA 3N4CA 2AS8A 3D6SA 1F2CA 1PXVA 2JQGR 3KFQA 1U9QX 4YYSA 1GECE 3PNRA 1VJVA 4QRGA 5CHVA 4CDFB 2R6NA 4X6HA 2BSZA 4BSQA 4MZOA 1W4TA 1ITOA 4CZWA 3K8UA 2DCAA 3IUTA 3BOWA 3KSEA 1CV8A 2VFBA 4MZSA 1MIRA 4QRVA 2E01A 1SNKA 1AU4A 1MEGA 1AYVA 1W6FA 2ATOA 4W5CA 3KWBX 2FYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9N A;  1QMY A;  4FJC A;  4YYW A;  2ARY A;  4PI3 A;  1O0E A;  4CDE B;  2G8J A;  1YK7 A;  3ZUA A;  1NLJ A;  4YYV A;  1MHW A;  5EGW A;  2FO5 A;  3BPF A;  2R9F A;  4Q8G A;  3IOQ A;  3KW9 A;  5JH3 A;  2HHN A;  2XU3 A;  5CHT A;  1PCI A;  2IBI A;  1CB5 A;  1XKG A;  3H8B A;  1YT7 A;  1IWD A;  2DZZ A;  3I06 A;  3KX1 A;  3S3R A;  1AU2 A;  3F5V A;  3HHA A;  2OZ2 A;  2R9M A;  1BP4 A;  1AEC A;  1PAD A;  2DC7 A;  2F7D A;  5F02 A;  1Y4H A;  3P5W A;  2VHF A;  1ZCM A;  2GFO A;  4RY2 A;  2PBH A;  2Y5B A;  1EWO A;  2YJB A;  2XU1 A;  3CBJ A;  2G6D A;  2AU1 A;  1CVZ A;  3WXG A;  3P5U A;  2DJF B;  2FT2 A;  1YK8 A;  2BDZ A;  7PCK A;  4I04 A;  2YJ8 A;  2AUX A;  2O6X A;  3TNX A;  3M99 A;  3PW3 A;  1JQP A;  1ICF A;  3OF9 A;  3DF0 A;  1ME3 A;  2G8E A;  4XUI A;  2B1M A;  2DCC A;  3CBK A;  2DZY A;  4BQV A;  3OVZ A;  1QDQ A;  2NQA A;  4BS5 A;  1YAL A;  1YVB A;  5EF4 A;  2P0R A;  1KXR A;  1BY8 A;  4P6G A;  3PDF A;  4G54 A;  3WXF A;  1EWL A;  3MTN A;  1PPP A;  2XU4 A;  2NQI A;  1EWM A;  2H7J A;  3WXE A;  3BPM A;  3LXS A;  1AYW A;  4YYU A;  1GMY A;  2CB5 A;  4XR7 A;  2P7U A;  4P6E A;  3KWZ A;  2PAD A;  4BPV A;  3HWN A;  3BWK A;  3CH3 X;  2XU5 A;  1NB3 A;  3OF8 A;  2C0Y A;  3MOR A;  2DC8 A;  3N3G A;  1U5I A;  1KFX L;  3MHS A;  2G7Y A;  1BQI A;  3H6S A;  1NQC A;  4X6J A;  4QH6 A;  3OIS A;  4YYQ A;  3BCN A;  3O1G A;  1KHP A;  3H7D A;  1NB5 A;  4QBB A;  3S3Q A;  6PAD A;  2PNS A;  1FH0 A;  8PCH A;  1STF E;  2AYN A;  1THE A;  5CVM A;  1CSB B;  5CVN B;  4PAD A;  5PAD A;  4YYR A;  1MDW A;  2HXZ A;  1CPJ A;  3OVX A;  1PPN A;  3HHI A;  3QSD A;  2ACT A;  1NL6 A;  1NPZ A;  3IMA A;  1AU3 A;  1QOL A;  4OEL A;  1AIM A;  2FUD A;  3IHP A;  3B79 A;  3BC3 A;  2NQD B;  4BS6 A;  4Q8H A;  1U9W A;  1PBH A;  2WBF X;  2HH5 A;  2VHS A;  3RVX A;  2PRE A;  1ZIV A;  2FRA A;  3QT4 A;  1Q6K A;  2DCD A;  2AIM A;  5JA7 A;  4I05 A;  4KLB A;  2F1G A;  2IPP B;  4DMY A;  2JQF R;  3F75 A;  1PE6 A;  3KKU A;  5CVO B;  1ME4 A;  1S4V A;  4CDD B;  1DEU A;  3U8E A;  3CH2 X;  3K24 A;  2AYO A;  2NQG A;  2B1N A;  1X9Y A;  3H89 A;  3NHE A;  4WA6 A;  2GHU A;  3AI8 A;  5A24 A;  2BDL A;  1M6D A;  4N8W A;  3IEJ A;  2DJG B;  2E00 A;  1DF0 A;  1EF7 A;  4AXM A;  1Y08 A;  3P5X A;  1PPO A;  3GCB A;  4N4Z A;  2OP3 A;  4FIP A;  3P5V A;  1HUC B;  2AUZ A;  1AYU A;  1MS6 A;  2CIO A;  1A6R A;  2AVW A;  2DC6 A;  9PAP A;  4PP2 E;  1CTE A;  4OEM A;  1EWP A;  3O0U A;  3MHH A;  2R9O A;  3HD3 A;  4N79 A;  1AU0 A;  3LFY A;  2FQ9 A;  1PPD A;  1K3B B;  4PP1 A;  1KHQ A;  3RVV A;  3E1Z B;  1QXP A;  2FTD A;  3ERV A;  1KFU L;  1F29 A;  4I07 A;  1TU6 A;  2Y6E A;  4X6I A;  4K7C A;  2E02 A;  5K16 A;  5FPW A;  1U9X A;  3K9M A;  2YJ9 A;  2YJC A;  4FK5 A;  1CQD A;  3QJ3 A;  1BGO A;  2OUL A;  2YJ2 A;  2HD5 A;  3C9E A;  3V6C A;  5J94 A;  1CJL A;  3I3T A;  3IV2 A;  1POP A;  2FRQ A;  3USV A;  3H8C A;  1F2B A;  4CDC B;  1GCB A;  1ATK A;  4YV8 A;  4AXL A;  4YVA A;  2R9C A;  4W4U A;  4QRX A;  2DCB A;  4W5B A;  4ZUX U;  1CS8 A;  1TLO A;  1VSN A;  1TL9 A;  4DMX A;  1F2A A;  2P86 A;  3PBH A;  1U9V A;  3V6E A;  1PIP A;  3RVW A;  4HWY A;  1GLO A;  2E03 A;  1MEM A;  4MSX A;  2DC9 A;  1SP4 B;  3N3K A;  3N4C A;  2AS8 A;  3D6S A;  1F2C A;  1PXV A;  2JQG R;  3KFQ A;  1U9Q X;  4YYS A;  1GEC E;  3PNR A;  1VJV A;  4QRG A;  5CHV A;  4CDF B;  2R6N A;  4X6H A;  4BSQ A;  4MZO A;  1ITO A;  4CZW A;  3K8U A;  2DCA A;  3IUT A;  3BOW A;  3KSE A;  1CV8 A;  4MZS A;  1MIR A;  4QRV A;  2E01 A;  1SNK A;  1AU4 A;  1MEG A;  1AYV A;  2ATO A;  4W5C A;  3KWB X;  2FYE A; 
#chains in the Genus database with same CATH topology
 2R9N A;  1QMY A;  4FJC A;  4YYW A;  2ARY A;  4PI3 A;  1O0E A;  4IUM A;  4CDE B;  2G8J A;  3O65 A;  1YK7 A;  3ZUA A;  3PHU A;  1NLJ A;  4ZTB A;  4YYV A;  1MHW A;  5EGW A;  2FO5 A;  3BPF A;  2R9F A;  4Q8G A;  3TMP A;  3IOQ A;  3KW9 A;  5JH3 A;  2HHN A;  2XU3 A;  5CHT A;  1PCI A;  2IBI A;  1CB5 A;  1XKG A;  3H8B A;  1YT7 A;  3RNV A;  1IWD A;  2DZZ A;  3I06 A;  1DKI A;  3KX1 A;  5EZS A;  3S3R A;  1AU2 A;  3F5V A;  3HHA A;  2OZ2 A;  2R9M A;  1BP4 A;  1AEC A;  1PAD A;  4P16 A;  2DC7 A;  2F7D A;  4GUA A;  5F02 A;  1Y4H A;  3P5W A;  2VHF A;  1ZCM A;  2GFO A;  4M0W A;  4RY2 A;  2PBH A;  2DOS A;  2Y5B A;  4XZX A;  1EWO A;  2YJB A;  2XU1 A;  3CBJ A;  2G6D A;  2AU1 A;  1CVZ A;  3PRP A;  3WXG A;  3P5U A;  2DJF B;  2FT2 A;  1YK8 A;  2BDZ A;  7PCK A;  4I04 A;  2YJ8 A;  2AUX A;  2O6X A;  3TNX A;  3M99 A;  3PW3 A;  1JQP A;  1ICF A;  3OF9 A;  3DF0 A;  4BOS A;  3C0R A;  1ME3 A;  2G8E A;  4XUI A;  2B1M A;  2DCC A;  4D8B A;  3CBK A;  4A5U A;  2DZY A;  2J7Q C;  4BQV A;  3OVZ A;  3MTV A;  2J7Q A;  1QDQ A;  2BTW B;  2NQA A;  4BS5 A;  1YAL A;  1YVB A;  5EF4 A;  2P0R A;  1KXR A;  4RF0 A;  1BY8 A;  5E6J A;  3BB7 A;  4P6G A;  3PDF A;  4G54 A;  3WXF A;  4HXD B;  1EWL A;  3MTN A;  1PPP A;  3W31 A;  2XU4 A;  2NQI A;  1EWM A;  2H7J A;  3MJ5 A;  3WXE A;  3BPM A;  3LXS A;  1AYW A;  4YYU A;  1GMY A;  2CB5 A;  4XR7 A;  2P7U A;  4P6E A;  3KWZ A;  2PAD A;  3BBA A;  4BPV A;  1UKF A;  3HWN A;  3BWK A;  3CH3 X;  2XU5 A;  1NB3 A;  5JZE A;  3OF8 A;  2C0Y A;  3MOR A;  2DC8 A;  3N3G A;  2Z84 A;  3PSE A;  1U5I A;  1KFX L;  3MHS A;  2G7Y A;  1BQI A;  3H6S A;  1NQC A;  4X6J A;  4QH6 A;  4BOU A;  3OIS A;  4YYQ A;  4RKX A;  3BCN A;  3O1G A;  1KHP A;  3H7D A;  1NB5 A;  4QBB A;  3S3Q A;  6PAD A;  2PNS A;  1FH0 A;  3E9S A;  8PCH A;  1STF E;  2AYN A;  1THE A;  5CVM A;  1CSB B;  5CVN B;  4PAD A;  4RNA A;  5PAD A;  4YYR A;  1MDW A;  2HXZ A;  1CPJ A;  3OVX A;  1PPN A;  3HHI A;  4PT5 A;  3QSD A;  2ACT A;  1NL6 A;  1NPZ A;  3IMA A;  1AU3 A;  1QOL A;  4OEL A;  5EZQ A;  1AIM A;  2FUD A;  3IHP A;  3B79 A;  3BC3 A;  2NQD B;  4BS6 A;  4Q8H A;  2HWK A;  1U9W A;  1PBH A;  2WBF X;  2HH5 A;  2VHS A;  3PRM A;  3OQC A;  2PRE A;  3RVX A;  2AGA A;  5KO3 A;  1ZIV A;  2FRA A;  3QT4 A;  3TRK A;  1Q6K A;  2DCD A;  2AIM A;  5JA7 A;  4I05 A;  4KLB A;  2F1G A;  2IPP B;  4DMY A;  2JQF R;  3F75 A;  1PE6 A;  3KKU A;  5CVO B;  1ME4 A;  4BOP A;  2JRI A;  3B21 A;  4D8E A;  1S4V A;  4CDD B;  1DEU A;  3U8E A;  3CH2 X;  4OVZ B;  3ZNH A;  3K24 A;  4BOZ A;  2AYO A;  2NQG A;  3IFU A;  2B1N A;  1X9Y A;  3H89 A;  3NHE A;  4RF1 A;  4WA6 A;  2GHU A;  3AI8 A;  5A24 A;  2BDL A;  1M6D A;  4N8W A;  3IEJ A;  2DJG B;  2E00 A;  1DF0 A;  1PVJ A;  1EF7 A;  4AXM A;  2BTW A;  1Y08 A;  3P5X A;  1PPO A;  3GCB A;  4N4Z A;  2OP3 A;  4FIP A;  3P5V A;  1HUC B;  2AUZ A;  1AYU A;  2FE8 A;  1MS6 A;  4D8I A;  2CIO A;  1A6R A;  2AVW A;  2DC6 A;  9PAP A;  4PP2 E;  1CTE A;  4OEM A;  1EWP A;  3O0U A;  3MHH A;  4MI7 A;  2R9O A;  3HD3 A;  4IP3 A;  4N79 A;  1AU0 A;  3LFY A;  2FQ9 A;  2JTC A;  1PPD A;  1K3B B;  4PP1 A;  1KHQ A;  3RVV A;  3E1Z B;  1QXP A;  2FTD A;  3ERV A;  3PHW A;  1KFU L;  1F29 A;  4I07 A;  1TU6 A;  2Y6E A;  4X6I A;  4K7C A;  2E02 A;  5K16 A;  5FPW A;  1U9X A;  3K9M A;  2YJ9 A;  2YJC A;  4FK5 A;  1CQD A;  3QJ3 A;  1BGO A;  2OUL A;  2YJ2 A;  2HD5 A;  3C9E A;  3V6C A;  5J94 A;  1CJL A;  4WUR A;  3I3T A;  3IV2 A;  1POP A;  3BY4 A;  2FRQ A;  3USV A;  3H8C A;  1F2B A;  4CDC B;  1GCB A;  3W30 A;  1ATK A;  4YV8 A;  4REZ A;  4AXL A;  4YVA A;  2R9C A;  4W4U A;  4QRX A;  2DCB A;  4W5B A;  4ZUX U;  1CS8 A;  1TLO A;  1VSN A;  3MP2 A;  1TL9 A;  4DMX A;  1F2A A;  4OW0 A;  2P86 A;  3PBH A;  1U9V A;  3V6E A;  1PIP A;  3RVW A;  4HWY A;  1GLO A;  2E03 A;  1MEM A;  4BOQ A;  3PT2 A;  2UZJ A;  3PHX A;  4MSX A;  2DC9 A;  1SP4 B;  3N3K A;  3N4C A;  2AS8 A;  3D6S A;  1F2C A;  1PXV A;  2JQG R;  3KFQ A;  1U9Q X;  4OVZ A;  2BU3 A;  4YYS A;  1GEC E;  3PNR A;  1VJV A;  4QRG A;  5CHV A;  4CDF B;  2R6N A;  4X6H A;  4BSQ A;  4MZO A;  1YZB A;  1ITO A;  4CZW A;  3K8U A;  2DCA A;  3IUT A;  3BOW A;  3KSE A;  1CV8 A;  4R3D A;  4MZS A;  1MIR A;  4QRV A;  2E01 A;  1SNK A;  1AU4 A;  1MEG A;  1AYV A;  2ATO A;  4W5C A;  3KWB X;  4MM3 B;  2FYE A; 
#chains in the Genus database with same CATH homology
 2R9N A;  1QMY A;  4FJC A;  4YYW A;  2ARY A;  4PI3 A;  1O0E A;  4CDE B;  2G8J A;  1YK7 A;  3ZUA A;  1NLJ A;  4YYV A;  1MHW A;  5EGW A;  2FO5 A;  3BPF A;  2R9F A;  4Q8G A;  3IOQ A;  3KW9 A;  5JH3 A;  2HHN A;  2XU3 A;  5CHT A;  1PCI A;  2IBI A;  1CB5 A;  1XKG A;  3H8B A;  1YT7 A;  1IWD A;  2DZZ A;  3I06 A;  3KX1 A;  3S3R A;  1AU2 A;  3F5V A;  3HHA A;  2OZ2 A;  2R9M A;  1BP4 A;  1AEC A;  1PAD A;  2DC7 A;  2F7D A;  5F02 A;  4GUZ A;  1E2T A;  1Y4H A;  3P5W A;  2VHF A;  1W5R A;  1ZCM A;  2GFO A;  4RY2 A;  2PBH A;  2Y5B A;  1EWO A;  2YJB A;  2XU1 A;  3CBJ A;  2G6D A;  2AU1 A;  1CVZ A;  3WXG A;  3P5U A;  2DJF B;  2FT2 A;  1YK8 A;  2BDZ A;  7PCK A;  4I04 A;  2YJ8 A;  2AUX A;  2O6X A;  3TNX A;  3M99 A;  3PW3 A;  1JQP A;  1ICF A;  3OF9 A;  3DF0 A;  4C5P A;  1ME3 A;  2G8E A;  4XUI A;  2B1M A;  2DCC A;  3CBK A;  2DZY A;  4BQV A;  3OVZ A;  1QDQ A;  2NQA A;  4BS5 A;  1YAL A;  1YVB A;  5EF4 A;  2P0R A;  1KXR A;  1BY8 A;  4P6G A;  3PDF A;  4G54 A;  3WXF A;  1EWL A;  3MTN A;  1PPP A;  2XU4 A;  2NQI A;  1EWM A;  2H7J A;  3WXE A;  3LTW A;  3BPM A;  3LXS A;  1AYW A;  4YYU A;  1GMY A;  2CB5 A;  4XR7 A;  2P7U A;  4P6E A;  3KWZ A;  2PAD A;  4B55 A;  4BPV A;  3HWN A;  3BWK A;  3CH3 X;  2XU5 A;  1NB3 A;  3OF8 A;  2C0Y A;  3MOR A;  2DC8 A;  3N3G A;  1U5I A;  1KFX L;  3MHS A;  2G7Y A;  1BQI A;  3H6S A;  4X6J A;  1NQC A;  4QH6 A;  3OIS A;  4YYQ A;  3BCN A;  3O1G A;  1KHP A;  3H7D A;  1NB5 A;  4QBB A;  3S3Q A;  6PAD A;  2PNS A;  1FH0 A;  8PCH A;  1STF E;  2AYN A;  1THE A;  5CVM A;  1CSB B;  5CVN B;  4PAD A;  5PAD A;  4YYR A;  1MDW A;  2HXZ A;  1CPJ A;  3OVX A;  1PPN A;  3HHI A;  3QSD A;  2ACT A;  1NL6 A;  1NPZ A;  3IMA A;  1AU3 A;  1QOL A;  4OEL A;  1AIM A;  2FUD A;  3IHP A;  3B79 A;  3BC3 A;  2NQD B;  4BS6 A;  4Q8H A;  1U9W A;  1PBH A;  2WBF X;  2HH5 A;  2VHS A;  3RVX A;  2PRE A;  1ZIV A;  2FRA A;  3QT4 A;  1Q6K A;  2DCD A;  2AIM A;  5JA7 A;  4I05 A;  4KLB A;  2F1G A;  2IPP B;  4DMY A;  2JQF R;  3F75 A;  1PE6 A;  3KKU A;  5CVO B;  1ME4 A;  1S4V A;  4CDD B;  1DEU A;  3U8E A;  3CH2 X;  3K24 A;  2AYO A;  2NQG A;  2B1N A;  1X9Y A;  3H89 A;  3NHE A;  4WA6 A;  2GHU A;  3AI8 A;  5A24 A;  2BDL A;  1M6D A;  4N8W A;  3IEJ A;  2DJG B;  2E00 A;  1DF0 A;  1EF7 A;  4AXM A;  1Y08 A;  3P5X A;  1PPO A;  3D9W A;  4NV8 A;  3GCB A;  4N4Z A;  2OP3 A;  2VFC A;  4FIP A;  3P5V A;  1HUC B;  2AUZ A;  1AYU A;  1GX3 A;  1MS6 A;  4NV7 A;  2CIO A;  1A6R A;  2AVW A;  2DC6 A;  9PAP A;  4PP2 E;  1CTE A;  4OEM A;  1EWP A;  3O0U A;  4BGF A;  3MHH A;  2R9O A;  3HD3 A;  4N79 A;  1AU0 A;  3LFY A;  2FQ9 A;  1PPD A;  1K3B B;  4PP1 A;  1KHQ A;  3RVV A;  3E1Z B;  1QXP A;  2FTD A;  3ERV A;  1KFU L;  1F29 A;  4I07 A;  1TU6 A;  2Y6E A;  4X6I A;  4K7C A;  2E02 A;  5K16 A;  5FPW A;  1U9X A;  3K9M A;  2YJ9 A;  2YJC A;  4FK5 A;  1CQD A;  3QJ3 A;  1BGO A;  2OUL A;  2YJ2 A;  2HD5 A;  3C9E A;  3V6C A;  5J94 A;  1CJL A;  3I3T A;  3IV2 A;  1POP A;  2FRQ A;  3USV A;  3H8C A;  1F2B A;  4CDC B;  1GCB A;  1ATK A;  4YV8 A;  4AXL A;  4YVA A;  2R9C A;  4W4U A;  4QRX A;  2DCB A;  4W5B A;  4ZUX U;  1CS8 A;  1TLO A;  1VSN A;  1TL9 A;  4DMX A;  1F2A A;  2P86 A;  3PBH A;  1U9V A;  3V6E A;  1PIP A;  3RVW A;  4HWY A;  1GLO A;  2E03 A;  1MEM A;  4MSX A;  2DC9 A;  1SP4 B;  3N3K A;  3N4C A;  2AS8 A;  3D6S A;  1F2C A;  1PXV A;  2JQG R;  3KFQ A;  1U9Q X;  4YYS A;  1GEC E;  3PNR A;  1VJV A;  4QRG A;  5CHV A;  4CDF B;  2R6N A;  4X6H A;  2BSZ A;  4BSQ A;  4MZO A;  1W4T A;  1ITO A;  4CZW A;  3K8U A;  2DCA A;  3IUT A;  3BOW A;  3KSE A;  1CV8 A;  2VFB A;  4MZS A;  1MIR A;  4QRV A;  2E01 A;  1SNK A;  1AU4 A;  1MEG A;  1AYV A;  1W6F A;  2ATO A;  4W5C A;  3KWB X;  2FYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...