1BP4A

Use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites.
pubmed doi rcsb
molecule tags Hydrolase
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bp4A00
2DJFB 4BQVA 1PPNA 5FPWA 5JH3A 4YYSA 2NQGA 3H89A 2XU3A 2H7JA 4W5BA 2B1MA 1PIPA 1M6DA 1GMYA 3ZUAA 1O0EA 3IUTA 4CDDB 5CHVA 3BPMA 1CPJA 1BGOA 4OELA 5PADA 4N4ZA 5J94A 2FRQA 1AU0A 3RVWA 2DC9A 3D6SA 3MHHA 2P7UA 2PREA 1MHWA 4ZUXU 4I05A 2AUXA 3V6EA 1PXVA 1ME3A 4X6JA 1EWLA 2CB5A 4YVAA 5EF4A 3IMAA 1AU3A 1U9WA 2P86A 1DF0A 1GLOA 1CQDA 2AS8A 6PADA 3BPFA 1NQCA 2DC6A 3BC3A 3HHIA 2ATOA 1AYUA 2OULA 4YV8A 2HHNA 1ZIVA 2Y5BA 2R9CA 3HHAA 2Y6EA 1PPOA 5K16A 2OZ2A 4G54A 3PBHA 4QRVA 3BCNA 2AYOA 2AIMA 3OF8A 4K7CA 2GFOA 2O6XA 2XU5A 3WXFA 2C0YA 4XR7A 3WXEA 5F02A 3USVA 2AUZA 4X6IA 2YJBA 3O0UA 3DF0A 3O1GA 3RVVA 2HH5A 1PBHA 3KW9A 4HWYA 1PE6A 2GHUA 1YT7A 1GCBA 1QXPA 1AYVA 1KHPA 2R9OA 1NL6A 3V6CA 2OP3A 3CH2X 3CBJA 1AU4A 1F2AA 4YYUA 2HD5A 3S3QA 3I3TA 4DMXA 1EWMA 2AVWA 1KXRA 2VHSA 3N4CA 2DC8A 1U9VA 3KFQA 1CTEA 2F7DA 4DMYA 2FRAA 8PCHA 1NB5A 3P5WA 1MDWA 2G8EA 1NLJA 4Q8GA 2XU1A 4RY2A 2AU1A 1MIRA 1BQIA 2NQDB 1CV8A 3M99A 2DCBA 2WBFX 1VSNA 1AIMA 2DCDA 5JA7A 1MS6A 3OVXA 1EWPA 4N79A 2FQ9A 4PP1A 1THEA 4QH6A 2BDLA 3N3GA 3QJ3A 1MEMA 1POPA 1GECE 2VHFA 3QT4A 1YK8A 4PADA 3IEJA 2YJ9A 3IHPA 4Q8HA 3LFYA 1YALA 2G8JA 4BSQA 1PCIA 4YYRA 1BY8A 3CBKA 1Y08A 3F75A 3KKUA 5CVNB 1AYWA 2HXZA 1EF7A 3H8CA 2YJ8A 2DJGB 1K3BB 2DCCA 5EGWA 2BDZA 4XUIA 5CVOB 3PW3A 4QRGA 1SP4B 2G7YA 2AYNA 4YYQA 3P5VA 2YJ2A 5CVMA 1KFXL 2P0RA 1QOLA 1U5IA 3N3KA 1SNKA 2PADA 1S4VA 1BP4A 3P5UA 1AU2A 2B1NA 4OEMA 1MEGA 1XKGA 2R6NA 1F2BA 9PAPA 3IOQA 4FK5A 2DCAA 2ACTA 4PP2E 1STFE 4MZOA 1EWOA 3NHEA 1TL9A 3WXGA 2E03A 2FUDA 4CDEB 2F1GA 1QDQA 1TLOA 3H6SA 3CH3X 1F2CA 1TU6A 2IPPB 2R9FA 3PDFA 1DEUA 3OF9A 4QRXA 3QSDA 1HUCB 3B79A 1ME4A 4QBBA 2DZZA 2E01A 4CDFB 3S3RA 4I07A 4MZSA 7PCKA 1U9XA 1NB3A 1FH0A 4BS5A 1ATKA 1JQPA 1PADA 2XU4A 1VJVA 2FYEA 5CHTA 3K8UA 4KLBA 3I06A 3BOWA 2FO5A 3HWNA 3KX1A 2FTDA 1CVZA 2JQGR 2R9NA 4BS6A 2JQFR 5A24A 1ZCMA 4PI3A 1KHQA 3RVXA 1QMYA 2G6DA 3KSEA 4FJCA 3H8BA 4YYVA 2YJCA 3U8EA 3KWBX 4FIPA 4X6HA 1YK7A 1CSBB 4AXLA 1CB5A 2NQAA 4W5CA 1KFUL 2E00A 2PNSA 3HD3A 3MORA 1PPPA 2E02A 4CDCB 4YYWA 3K9MA 3PNRA 1Q6KA 3OISA 1CJLA 2FT2A 3K24A 1Y4HA 3OVZA 4P6GA 3MTNA 1NPZA 3BWKA 3P5XA 1ICFA 3KWZA 1X9YA 3GCBA 2NQIA 2DZYA 2R9MA 2ARYA 1F29A 1YVBA 1PPDA 3IV2A 2DC7A 1CS8A 4P6EA 1IWDA 4N8WA 2CIOA 3E1ZB 3F5VA 3TNXA 1A6RA 3MHSA 4BPVA 4CZWA 4AXMA 1ITOA 3ERVA 1AECA 3C9EA 2PBHA 4W4UA 4I04A 3H7DA 4MSXA 4WA6A 1U9QX 3LXSA 3AI8A 2IBIA
chains in the Genus database with same CATH superfamily
2DJFB 4BQVA 1PPNA 5FPWA 5JH3A 4YYSA 2NQGA 3H89A 2XU3A 2H7JA 4W5BA 4M0WA 2B1MA 1PIPA 1M6DA 3PHXA 1GMYA 3ZUAA 1O0EA 3IUTA 4CDDB 5CHVA 3BPMA 1CPJA 1BGOA 4OELA 5PADA 4N4ZA 5J94A 2FRQA 1AU0A 3RVWA 2DC9A 3D6SA 3MHHA 2P7UA 2PREA 1MHWA 4ZUXU 4I05A 2AUXA 3BB7A 3V6EA 1PXVA 1ME3A 4X6JA 1EWLA 2CB5A 4YVAA 4PT5A 5EF4A 4BOSA 3IMAA 1AU3A 1U9WA 2P86A 1DF0A 2JTCA 1GLOA 1CQDA 2AS8A 6PADA 3BPFA 1NQCA 2DC6A 3BC3A 3HHIA 2ATOA 1AYUA 2OULA 4YV8A 2HHNA 1ZIVA 2Y5BA 2R9CA 3HHAA 4BOUA 2Y6EA 1PPOA 5K16A 2OZ2A 4XZXA 4G54A 3PBHA 4QRVA 3BCNA 2AYOA 2AGAA 2AIMA 3OF8A 5EZSA 4K7CA 3PHWA 5EZQA 2J7QA 2GFOA 2O6XA 2XU5A 2DOSA 3MTVA 3WXFA 2C0YA 4XR7A 3WXEA 5F02A 3USVA 2AUZA 4X6IA 2YJBA 3O0UA 3DF0A 3O1GA 3RVVA 2HH5A 1PBHA 3KW9A 4HWYA 1PE6A 2BTWA 2GHUA 1YT7A 1GCBA 1QXPA 1AYVA 1KHPA 2R9OA 1NL6A 3V6CA 2OP3A 3CH2X 3CBJA 1AU4A 1F2AA 2HWKA 4YYUA 2HD5A 3S3QA 3I3TA 4DMXA 1EWMA 3PSEA 2AVWA 1KXRA 2VHSA 3N4CA 2DC8A 1UKFA 1U9VA 4D8BA 3KFQA 1CTEA 2F7DA 4DMYA 2FRAA 8PCHA 4BOZA 1NB5A 3P5WA 1MDWA 2G8EA 1NLJA 4Q8GA 2XU1A 4RY2A 2AU1A 1MIRA 3C0RA 4RF0A 2J7QC 1BQIA 5JZEA 4HXDB 2NQDB 1CV8A 3M99A 2DCBA 2WBFX 1VSNA 1AIMA 2DCDA 5JA7A 4D8IA 1MS6A 3OVXA 3BY4A 1EWPA 4N79A 2FQ9A 4PP1A 1THEA 4QH6A 2BDLA 3N3GA 2FE8A 3QJ3A 1MEMA 1POPA 1GECE 2VHFA 3QT4A 1PVJA 1YK8A 4PADA 3IEJA 2YJ9A 3IHPA 4Q8HA 3LFYA 1YALA 2G8JA 4WURA 4BSQA 1PCIA 4YYRA 1BY8A 3CBKA 1Y08A 3F75A 3KKUA 3W31A 5CVNB 3MP2A 1AYWA 2HXZA 4BOPA 4A5UA 1EF7A 4GUAA 3H8CA 2YJ8A 2DJGB 1K3BB 2DCCA 5EGWA 3BBAA 2BDZA 4XUIA 5CVOB 3PW3A 3IFUA 4QRGA 4RF1A 3TMPA 1SP4B 2G7YA 2AYNA 4YYQA 3P5VA 2YJ2A 5CVMA 1KFXL 2P0RA 1QOLA 1U5IA 3N3KA 1SNKA 2PADA 4BOQA 1S4VA 1BP4A 3P5UA 2IBIA 3MJ5A 3PRMA 5KO3A 1AU2A 2B1NA 4OEMA 1MEGA 1XKGA 2R6NA 1F2BA 9PAPA 3IOQA 4FK5A 2DCAA 2ACTA 4PP2E 1STFE 4MZOA 1EWOA 3NHEA 2Z84A 1TL9A 3WXGA 2E03A 2FUDA 4MM3B 4CDEB 2F1GA 4MI7A 1QDQA 1TLOA 3H6SA 3CH3X 1F2CA 1TU6A 2BU3A 4ZTBA 2IPPB 4RKXA 2R9FA 3ZNHA 3PDFA 1DEUA 3OF9A 3PRPA 1YZBA 4QRXA 3QSDA 3E9SA 4P16A 1HUCB 3B79A 1ME4A 4QBBA 2DZZA 2E01A 4CDFB 3S3RA 4I07A 4MZSA 7PCKA 1U9XA 1NB3A 1FH0A 4BS5A 1ATKA 1JQPA 3RNVA 1PADA 2XU4A 1VJVA 2FYEA 5CHTA 3K8UA 4KLBA 3I06A 3BOWA 2FO5A 3HWNA 3KX1A 2FTDA 1CVZA 2JQGR 2R9NA 4BS6A 2JQFR 5A24A 1ZCMA 4PI3A 1KHQA 3RVXA 1QMYA 2G6DA 3KSEA 1DKIA 4FJCA 3OQCA 3H8BA 4YYVA 2YJCA 3U8EA 3PT2A 3KWBX 4FIPA 4X6HA 1YK7A 4OVZA 1CSBB 4AXLA 1CB5A 2NQAA 4W5CA 1KFUL 2E00A 2PNSA 3HD3A 3MORA 1PPPA 2E02A 4CDCB 4OVZB 4YYWA 4IUMA 3K9MA 3PNRA 1Q6KA 3OISA 1CJLA 2FT2A 3K24A 1Y4HA 3OVZA 4P6GA 3MTNA 1NPZA 3BWKA 3P5XA 1ICFA 3KWZA 4D8EA 1X9YA 3GCBA 2NQIA 2DZYA 3O65A 2R9MA 2ARYA 1F29A 1YVBA 1PPDA 2UZJA 3IV2A 2DC7A 1CS8A 4P6EA 1IWDA 4N8WA 4OW0A 3TRKA 4IP3A 2CIOA 3E1ZB 3F5VA 3B21A 2BTWB 3TNXA 3W30A 1A6RA 3MHSA 5E6JA 4BPVA 4CZWA 4AXMA 4REZA 2JRIA 1ITOA 3ERVA 1AECA 3C9EA 2PBHA 4W4UA 4I04A 3H7DA 4MSXA 4WA6A 4RNAA 1U9QX 4R3DA 3LXSA 3AI8A 3PHUA
chains in the Genus database with same CATH topology
2DJFB 4BQVA 1PPNA 5FPWA 5JH3A 4YYSA 2NQGA 3H89A 2XU3A 2H7JA 4W5BA 2B1MA 1PIPA 1M6DA 1GMYA 3ZUAA 1O0EA 3IUTA 4CDDB 5CHVA 3BPMA 1CPJA 1BGOA 4OELA 5PADA 4N4ZA 5J94A 2FRQA 1AU0A 3RVWA 2DC9A 3D6SA 3MHHA 4BGFA 2P7UA 2PREA 1MHWA 4ZUXU 4I05A 2AUXA 3V6EA 1PXVA 1ME3A 4X6JA 1EWLA 2CB5A 4YVAA 5EF4A 3IMAA 1AU3A 1U9WA 2P86A 1DF0A 1GLOA 1CQDA 2AS8A 6PADA 3BPFA 1NQCA 2DC6A 3BC3A 3HHIA 2ATOA 1AYUA 2OULA 4YV8A 2HHNA 1ZIVA 2Y5BA 2R9CA 3HHAA 2Y6EA 1E2TA 1PPOA 5K16A 2OZ2A 4G54A 3PBHA 4QRVA 3BCNA 2AYOA 2AIMA 3OF8A 4K7CA 2GFOA 2O6XA 2XU5A 3WXFA 2C0YA 4XR7A 3WXEA 5F02A 3USVA 2AUZA 4X6IA 2YJBA 3O0UA 3DF0A 3O1GA 3RVVA 2HH5A 1PBHA 3KW9A 4HWYA 1PE6A 4NV8A 2GHUA 1YT7A 1GCBA 1QXPA 1AYVA 1KHPA 2R9OA 1NL6A 3V6CA 2OP3A 3CH2X 3CBJA 1AU4A 1F2AA 4YYUA 1GX3A 2HD5A 3S3QA 3I3TA 3D9WA 1W4TA 4DMXA 1EWMA 1W6FA 1KXRA 2AVWA 2VHSA 2DC8A 3N4CA 1U9VA 3KFQA 1CTEA 2F7DA 4DMYA 2FRAA 8PCHA 1NB5A 3P5WA 4B55A 1MDWA 2G8EA 1NLJA 4Q8GA 2XU1A 4RY2A 2AU1A 1MIRA 1BQIA 2NQDB 1CV8A 3M99A 2DCBA 2WBFX 1VSNA 1AIMA 2DCDA 5JA7A 1MS6A 3OVXA 1EWPA 4N79A 3LTWA 2FQ9A 4PP1A 1THEA 4QH6A 2BDLA 3N3GA 2BSZA 3QJ3A 1MEMA 1POPA 1GECE 2VHFA 3QT4A 1YK8A 4PADA 3IEJA 2YJ9A 3IHPA 4Q8HA 3LFYA 1YALA 2G8JA 4BSQA 1PCIA 4YYRA 1BY8A 3CBKA 1Y08A 3F75A 3KKUA 5CVNB 1AYWA 2HXZA 1EF7A 3H8CA 2YJ8A 2DJGB 1K3BB 2DCCA 5EGWA 2BDZA 4XUIA 5CVOB 3PW3A 4QRGA 1SP4B 2G7YA 2AYNA 4GUZA 4YYQA 3P5VA 2YJ2A 5CVMA 1KFXL 2P0RA 1QOLA 1U5IA 3N3KA 1SNKA 2PADA 1S4VA 1BP4A 3P5UA 1AU2A 2B1NA 4OEMA 1MEGA 1XKGA 2R6NA 1F2BA 9PAPA 3IOQA 4FK5A 2DCAA 2ACTA 4PP2E 1STFE 4MZOA 1EWOA 3NHEA 1TL9A 3WXGA 2E03A 2FUDA 4CDEB 2F1GA 1QDQA 2VFCA 1TLOA 3H6SA 3CH3X 1F2CA 1TU6A 2IPPB 2R9FA 3PDFA 1DEUA 3OF9A 4QRXA 3QSDA 1HUCB 3B79A 1ME4A 4QBBA 2DZZA 2E01A 4CDFB 3S3RA 4I07A 4MZSA 7PCKA 1U9XA 1NB3A 1FH0A 4BS5A 1ATKA 1JQPA 1PADA 2XU4A 1VJVA 2FYEA 5CHTA 3K8UA 4KLBA 3I06A 3BOWA 2FO5A 3HWNA 3KX1A 2FTDA 1CVZA 1W5RA 2JQGR 2R9NA 4BS6A 2JQFR 5A24A 1ZCMA 4PI3A 1KHQA 3RVXA 1QMYA 2G6DA 3KSEA 4FJCA 3H8BA 4C5PA 4YYVA 2YJCA 3U8EA 3KWBX 4FIPA 4X6HA 1YK7A 1CSBB 4AXLA 1CB5A 2NQAA 4W5CA 1KFUL 2E00A 2PNSA 3HD3A 3MORA 1PPPA 2E02A 4CDCB 4YYWA 3K9MA 3PNRA 1Q6KA 3OISA 1CJLA 2FT2A 3K24A 1Y4HA 3OVZA 4P6GA 3MTNA 1NPZA 3BWKA 3P5XA 1ICFA 3KWZA 1X9YA 3GCBA 2NQIA 2DZYA 4NV7A 2R9MA 2ARYA 1F29A 1YVBA 1PPDA 3IV2A 2DC7A 1CS8A 4P6EA 1IWDA 4N8WA 2CIOA 3E1ZB 3F5VA 3TNXA 1A6RA 3MHSA 4BPVA 2VFBA 4CZWA 4AXMA 1ITOA 3ERVA 1AECA 3C9EA 2PBHA 4W4UA 4I04A 3H7DA 4MSXA 4WA6A 1U9QX 3LXSA 3AI8A 2IBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJF B;  4BQV A;  1PPN A;  5FPW A;  5JH3 A;  4YYS A;  2NQG A;  3H89 A;  2XU3 A;  2H7J A;  4W5B A;  2B1M A;  1PIP A;  1M6D A;  1GMY A;  3ZUA A;  1O0E A;  3IUT A;  4CDD B;  5CHV A;  3BPM A;  1CPJ A;  1BGO A;  4OEL A;  5PAD A;  4N4Z A;  5J94 A;  2FRQ A;  1AU0 A;  3RVW A;  2DC9 A;  3D6S A;  3MHH A;  2P7U A;  2PRE A;  1MHW A;  4ZUX U;  4I05 A;  2AUX A;  3V6E A;  1PXV A;  1ME3 A;  4X6J A;  1EWL A;  2CB5 A;  4YVA A;  5EF4 A;  3IMA A;  1AU3 A;  1U9W A;  2P86 A;  1DF0 A;  1GLO A;  1CQD A;  2AS8 A;  6PAD A;  3BPF A;  1NQC A;  2DC6 A;  3BC3 A;  3HHI A;  2ATO A;  1AYU A;  2OUL A;  4YV8 A;  2HHN A;  1ZIV A;  2Y5B A;  2R9C A;  3HHA A;  2Y6E A;  1PPO A;  5K16 A;  2OZ2 A;  4G54 A;  3PBH A;  4QRV A;  3BCN A;  2AYO A;  2AIM A;  3OF8 A;  4K7C A;  2GFO A;  2O6X A;  2XU5 A;  3WXF A;  2C0Y A;  4XR7 A;  3WXE A;  5F02 A;  3USV A;  2AUZ A;  4X6I A;  2YJB A;  3O0U A;  3DF0 A;  3O1G A;  3RVV A;  2HH5 A;  1PBH A;  3KW9 A;  4HWY A;  1PE6 A;  2GHU A;  1YT7 A;  1GCB A;  1QXP A;  1AYV A;  1KHP A;  2R9O A;  1NL6 A;  3V6C A;  2OP3 A;  3CH2 X;  3CBJ A;  1AU4 A;  1F2A A;  4YYU A;  2HD5 A;  3S3Q A;  3I3T A;  4DMX A;  1EWM A;  2AVW A;  1KXR A;  2VHS A;  3N4C A;  2DC8 A;  1U9V A;  3KFQ A;  1CTE A;  2F7D A;  4DMY A;  2FRA A;  8PCH A;  1NB5 A;  3P5W A;  1MDW A;  2G8E A;  1NLJ A;  4Q8G A;  2XU1 A;  4RY2 A;  2AU1 A;  1MIR A;  1BQI A;  2NQD B;  1CV8 A;  3M99 A;  2DCB A;  2WBF X;  1VSN A;  1AIM A;  2DCD A;  5JA7 A;  1MS6 A;  3OVX A;  1EWP A;  4N79 A;  2FQ9 A;  4PP1 A;  1THE A;  4QH6 A;  2BDL A;  3N3G A;  3QJ3 A;  1MEM A;  1POP A;  1GEC E;  2VHF A;  3QT4 A;  1YK8 A;  4PAD A;  3IEJ A;  2YJ9 A;  3IHP A;  4Q8H A;  3LFY A;  1YAL A;  2G8J A;  4BSQ A;  1PCI A;  4YYR A;  1BY8 A;  3CBK A;  1Y08 A;  3F75 A;  3KKU A;  5CVN B;  1AYW A;  2HXZ A;  1EF7 A;  3H8C A;  2YJ8 A;  2DJG B;  1K3B B;  2DCC A;  5EGW A;  2BDZ A;  4XUI A;  5CVO B;  3PW3 A;  4QRG A;  1SP4 B;  2G7Y A;  2AYN A;  4YYQ A;  3P5V A;  2YJ2 A;  5CVM A;  1KFX L;  2P0R A;  1QOL A;  1U5I A;  3N3K A;  1SNK A;  2PAD A;  1S4V A;  1BP4 A;  3P5U A;  1AU2 A;  2B1N A;  4OEM A;  1MEG A;  1XKG A;  2R6N A;  1F2B A;  9PAP A;  3IOQ A;  4FK5 A;  2DCA A;  2ACT A;  4PP2 E;  1STF E;  4MZO A;  1EWO A;  3NHE A;  1TL9 A;  3WXG A;  2E03 A;  2FUD A;  4CDE B;  2F1G A;  1QDQ A;  1TLO A;  3H6S A;  3CH3 X;  1F2C A;  1TU6 A;  2IPP B;  2R9F A;  3PDF A;  1DEU A;  3OF9 A;  4QRX A;  3QSD A;  1HUC B;  3B79 A;  1ME4 A;  4QBB A;  2DZZ A;  2E01 A;  4CDF B;  3S3R A;  4I07 A;  4MZS A;  7PCK A;  1U9X A;  1NB3 A;  1FH0 A;  4BS5 A;  1ATK A;  1JQP A;  1PAD A;  2XU4 A;  1VJV A;  2FYE A;  5CHT A;  3K8U A;  4KLB A;  3I06 A;  3BOW A;  2FO5 A;  3HWN A;  3KX1 A;  2FTD A;  1CVZ A;  2JQG R;  2R9N A;  4BS6 A;  2JQF R;  5A24 A;  1ZCM A;  4PI3 A;  1KHQ A;  3RVX A;  1QMY A;  2G6D A;  3KSE A;  4FJC A;  3H8B A;  4YYV A;  2YJC A;  3U8E A;  3KWB X;  4FIP A;  4X6H A;  1YK7 A;  1CSB B;  4AXL A;  1CB5 A;  2NQA A;  4W5C A;  1KFU L;  2E00 A;  2PNS A;  3HD3 A;  3MOR A;  1PPP A;  2E02 A;  4CDC B;  4YYW A;  3K9M A;  3PNR A;  1Q6K A;  3OIS A;  1CJL A;  2FT2 A;  3K24 A;  1Y4H A;  3OVZ A;  4P6G A;  3MTN A;  1NPZ A;  3BWK A;  3P5X A;  1ICF A;  3KWZ A;  1X9Y A;  3GCB A;  2NQI A;  2DZY A;  2R9M A;  2ARY A;  1F29 A;  1YVB A;  1PPD A;  3IV2 A;  2DC7 A;  1CS8 A;  4P6E A;  1IWD A;  4N8W A;  2CIO A;  3E1Z B;  3F5V A;  3TNX A;  1A6R A;  3MHS A;  4BPV A;  4CZW A;  4AXM A;  1ITO A;  3ERV A;  1AEC A;  3C9E A;  2PBH A;  4W4U A;  4I04 A;  3H7D A;  4MSX A;  4WA6 A;  1U9Q X;  3LXS A;  3AI8 A;  2IBI A; 
#chains in the Genus database with same CATH topology
 2DJF B;  4BQV A;  1PPN A;  5FPW A;  5JH3 A;  4YYS A;  2NQG A;  3H89 A;  2XU3 A;  2H7J A;  4W5B A;  4M0W A;  2B1M A;  1PIP A;  1M6D A;  3PHX A;  1GMY A;  3ZUA A;  1O0E A;  3IUT A;  4CDD B;  5CHV A;  3BPM A;  1CPJ A;  1BGO A;  4OEL A;  5PAD A;  4N4Z A;  5J94 A;  2FRQ A;  1AU0 A;  3RVW A;  2DC9 A;  3D6S A;  3MHH A;  2P7U A;  2PRE A;  1MHW A;  4ZUX U;  4I05 A;  2AUX A;  3BB7 A;  3V6E A;  1PXV A;  1ME3 A;  4X6J A;  1EWL A;  2CB5 A;  4YVA A;  4PT5 A;  5EF4 A;  4BOS A;  3IMA A;  1AU3 A;  1U9W A;  2P86 A;  1DF0 A;  2JTC A;  1GLO A;  1CQD A;  2AS8 A;  6PAD A;  3BPF A;  1NQC A;  2DC6 A;  3BC3 A;  3HHI A;  2ATO A;  1AYU A;  2OUL A;  4YV8 A;  2HHN A;  1ZIV A;  2Y5B A;  2R9C A;  3HHA A;  4BOU A;  2Y6E A;  1PPO A;  5K16 A;  2OZ2 A;  4XZX A;  4G54 A;  3PBH A;  4QRV A;  3BCN A;  2AYO A;  2AGA A;  2AIM A;  3OF8 A;  5EZS A;  4K7C A;  3PHW A;  5EZQ A;  2J7Q A;  2GFO A;  2O6X A;  2XU5 A;  2DOS A;  3MTV A;  3WXF A;  2C0Y A;  4XR7 A;  3WXE A;  5F02 A;  3USV A;  2AUZ A;  4X6I A;  2YJB A;  3O0U A;  3DF0 A;  3O1G A;  3RVV A;  2HH5 A;  1PBH A;  3KW9 A;  4HWY A;  1PE6 A;  2BTW A;  2GHU A;  1YT7 A;  1GCB A;  1QXP A;  1AYV A;  1KHP A;  2R9O A;  1NL6 A;  3V6C A;  2OP3 A;  3CH2 X;  3CBJ A;  1AU4 A;  1F2A A;  2HWK A;  4YYU A;  2HD5 A;  3S3Q A;  3I3T A;  4DMX A;  1EWM A;  3PSE A;  2AVW A;  1KXR A;  2VHS A;  3N4C A;  2DC8 A;  1UKF A;  1U9V A;  4D8B A;  3KFQ A;  1CTE A;  2F7D A;  4DMY A;  2FRA A;  8PCH A;  4BOZ A;  1NB5 A;  3P5W A;  1MDW A;  2G8E A;  1NLJ A;  4Q8G A;  2XU1 A;  4RY2 A;  2AU1 A;  1MIR A;  3C0R A;  4RF0 A;  2J7Q C;  1BQI A;  5JZE A;  4HXD B;  2NQD B;  1CV8 A;  3M99 A;  2DCB A;  2WBF X;  1VSN A;  1AIM A;  2DCD A;  5JA7 A;  4D8I A;  1MS6 A;  3OVX A;  3BY4 A;  1EWP A;  4N79 A;  2FQ9 A;  4PP1 A;  1THE A;  4QH6 A;  2BDL A;  3N3G A;  2FE8 A;  3QJ3 A;  1MEM A;  1POP A;  1GEC E;  2VHF A;  3QT4 A;  1PVJ A;  1YK8 A;  4PAD A;  3IEJ A;  2YJ9 A;  3IHP A;  4Q8H A;  3LFY A;  1YAL A;  2G8J A;  4WUR A;  4BSQ A;  1PCI A;  4YYR A;  1BY8 A;  3CBK A;  1Y08 A;  3F75 A;  3KKU A;  3W31 A;  5CVN B;  3MP2 A;  1AYW A;  2HXZ A;  4BOP A;  4A5U A;  1EF7 A;  4GUA A;  3H8C A;  2YJ8 A;  2DJG B;  1K3B B;  2DCC A;  5EGW A;  3BBA A;  2BDZ A;  4XUI A;  5CVO B;  3PW3 A;  3IFU A;  4QRG A;  4RF1 A;  3TMP A;  1SP4 B;  2G7Y A;  2AYN A;  4YYQ A;  3P5V A;  2YJ2 A;  5CVM A;  1KFX L;  2P0R A;  1QOL A;  1U5I A;  3N3K A;  1SNK A;  2PAD A;  4BOQ A;  1S4V A;  1BP4 A;  3P5U A;  2IBI A;  3MJ5 A;  3PRM A;  5KO3 A;  1AU2 A;  2B1N A;  4OEM A;  1MEG A;  1XKG A;  2R6N A;  1F2B A;  9PAP A;  3IOQ A;  4FK5 A;  2DCA A;  2ACT A;  4PP2 E;  1STF E;  4MZO A;  1EWO A;  3NHE A;  2Z84 A;  1TL9 A;  3WXG A;  2E03 A;  2FUD A;  4MM3 B;  4CDE B;  2F1G A;  4MI7 A;  1QDQ A;  1TLO A;  3H6S A;  3CH3 X;  1F2C A;  1TU6 A;  2BU3 A;  4ZTB A;  2IPP B;  4RKX A;  2R9F A;  3ZNH A;  3PDF A;  1DEU A;  3OF9 A;  3PRP A;  1YZB A;  4QRX A;  3QSD A;  3E9S A;  4P16 A;  1HUC B;  3B79 A;  1ME4 A;  4QBB A;  2DZZ A;  2E01 A;  4CDF B;  3S3R A;  4I07 A;  4MZS A;  7PCK A;  1U9X A;  1NB3 A;  1FH0 A;  4BS5 A;  1ATK A;  1JQP A;  3RNV A;  1PAD A;  2XU4 A;  1VJV A;  2FYE A;  5CHT A;  3K8U A;  4KLB A;  3I06 A;  3BOW A;  2FO5 A;  3HWN A;  3KX1 A;  2FTD A;  1CVZ A;  2JQG R;  2R9N A;  4BS6 A;  2JQF R;  5A24 A;  1ZCM A;  4PI3 A;  1KHQ A;  3RVX A;  1QMY A;  2G6D A;  3KSE A;  1DKI A;  4FJC A;  3OQC A;  3H8B A;  4YYV A;  2YJC A;  3U8E A;  3PT2 A;  3KWB X;  4FIP A;  4X6H A;  1YK7 A;  4OVZ A;  1CSB B;  4AXL A;  1CB5 A;  2NQA A;  4W5C A;  1KFU L;  2E00 A;  2PNS A;  3HD3 A;  3MOR A;  1PPP A;  2E02 A;  4CDC B;  4OVZ B;  4YYW A;  4IUM A;  3K9M A;  3PNR A;  1Q6K A;  3OIS A;  1CJL A;  2FT2 A;  3K24 A;  1Y4H A;  3OVZ A;  4P6G A;  3MTN A;  1NPZ A;  3BWK A;  3P5X A;  1ICF A;  3KWZ A;  4D8E A;  1X9Y A;  3GCB A;  2NQI A;  2DZY A;  3O65 A;  2R9M A;  2ARY A;  1F29 A;  1YVB A;  1PPD A;  2UZJ A;  3IV2 A;  2DC7 A;  1CS8 A;  4P6E A;  1IWD A;  4N8W A;  4OW0 A;  3TRK A;  4IP3 A;  2CIO A;  3E1Z B;  3F5V A;  3B21 A;  2BTW B;  3TNX A;  3W30 A;  1A6R A;  3MHS A;  5E6J A;  4BPV A;  4CZW A;  4AXM A;  4REZ A;  2JRI A;  1ITO A;  3ERV A;  1AEC A;  3C9E A;  2PBH A;  4W4U A;  4I04 A;  3H7D A;  4MSX A;  4WA6 A;  4RNA A;  1U9Q X;  4R3D A;  3LXS A;  3AI8 A;  3PHU A; 
#chains in the Genus database with same CATH homology
 2DJF B;  4BQV A;  1PPN A;  5FPW A;  5JH3 A;  4YYS A;  2NQG A;  3H89 A;  2XU3 A;  2H7J A;  4W5B A;  2B1M A;  1PIP A;  1M6D A;  1GMY A;  3ZUA A;  1O0E A;  3IUT A;  4CDD B;  5CHV A;  3BPM A;  1CPJ A;  1BGO A;  4OEL A;  5PAD A;  4N4Z A;  5J94 A;  2FRQ A;  1AU0 A;  3RVW A;  2DC9 A;  3D6S A;  3MHH A;  4BGF A;  2P7U A;  2PRE A;  1MHW A;  4ZUX U;  4I05 A;  2AUX A;  3V6E A;  1PXV A;  1ME3 A;  4X6J A;  1EWL A;  2CB5 A;  4YVA A;  5EF4 A;  3IMA A;  1AU3 A;  1U9W A;  2P86 A;  1DF0 A;  1GLO A;  1CQD A;  2AS8 A;  6PAD A;  3BPF A;  1NQC A;  2DC6 A;  3BC3 A;  3HHI A;  2ATO A;  1AYU A;  2OUL A;  4YV8 A;  2HHN A;  1ZIV A;  2Y5B A;  2R9C A;  3HHA A;  2Y6E A;  1E2T A;  1PPO A;  5K16 A;  2OZ2 A;  4G54 A;  3PBH A;  4QRV A;  3BCN A;  2AYO A;  2AIM A;  3OF8 A;  4K7C A;  2GFO A;  2O6X A;  2XU5 A;  3WXF A;  2C0Y A;  4XR7 A;  3WXE A;  5F02 A;  3USV A;  2AUZ A;  4X6I A;  2YJB A;  3O0U A;  3DF0 A;  3O1G A;  3RVV A;  2HH5 A;  1PBH A;  3KW9 A;  4HWY A;  1PE6 A;  4NV8 A;  2GHU A;  1YT7 A;  1GCB A;  1QXP A;  1AYV A;  1KHP A;  2R9O A;  1NL6 A;  3V6C A;  2OP3 A;  3CH2 X;  3CBJ A;  1AU4 A;  1F2A A;  4YYU A;  1GX3 A;  2HD5 A;  3S3Q A;  3I3T A;  3D9W A;  1W4T A;  4DMX A;  1EWM A;  1W6F A;  1KXR A;  2AVW A;  2VHS A;  2DC8 A;  3N4C A;  1U9V A;  3KFQ A;  1CTE A;  2F7D A;  4DMY A;  2FRA A;  8PCH A;  1NB5 A;  3P5W A;  4B55 A;  1MDW A;  2G8E A;  1NLJ A;  4Q8G A;  2XU1 A;  4RY2 A;  2AU1 A;  1MIR A;  1BQI A;  2NQD B;  1CV8 A;  3M99 A;  2DCB A;  2WBF X;  1VSN A;  1AIM A;  2DCD A;  5JA7 A;  1MS6 A;  3OVX A;  1EWP A;  4N79 A;  3LTW A;  2FQ9 A;  4PP1 A;  1THE A;  4QH6 A;  2BDL A;  3N3G A;  2BSZ A;  3QJ3 A;  1MEM A;  1POP A;  1GEC E;  2VHF A;  3QT4 A;  1YK8 A;  4PAD A;  3IEJ A;  2YJ9 A;  3IHP A;  4Q8H A;  3LFY A;  1YAL A;  2G8J A;  4BSQ A;  1PCI A;  4YYR A;  1BY8 A;  3CBK A;  1Y08 A;  3F75 A;  3KKU A;  5CVN B;  1AYW A;  2HXZ A;  1EF7 A;  3H8C A;  2YJ8 A;  2DJG B;  1K3B B;  2DCC A;  5EGW A;  2BDZ A;  4XUI A;  5CVO B;  3PW3 A;  4QRG A;  1SP4 B;  2G7Y A;  2AYN A;  4GUZ A;  4YYQ A;  3P5V A;  2YJ2 A;  5CVM A;  1KFX L;  2P0R A;  1QOL A;  1U5I A;  3N3K A;  1SNK A;  2PAD A;  1S4V A;  1BP4 A;  3P5U A;  1AU2 A;  2B1N A;  4OEM A;  1MEG A;  1XKG A;  2R6N A;  1F2B A;  9PAP A;  3IOQ A;  4FK5 A;  2DCA A;  2ACT A;  4PP2 E;  1STF E;  4MZO A;  1EWO A;  3NHE A;  1TL9 A;  3WXG A;  2E03 A;  2FUD A;  4CDE B;  2F1G A;  1QDQ A;  2VFC A;  1TLO A;  3H6S A;  3CH3 X;  1F2C A;  1TU6 A;  2IPP B;  2R9F A;  3PDF A;  1DEU A;  3OF9 A;  4QRX A;  3QSD A;  1HUC B;  3B79 A;  1ME4 A;  4QBB A;  2DZZ A;  2E01 A;  4CDF B;  3S3R A;  4I07 A;  4MZS A;  7PCK A;  1U9X A;  1NB3 A;  1FH0 A;  4BS5 A;  1ATK A;  1JQP A;  1PAD A;  2XU4 A;  1VJV A;  2FYE A;  5CHT A;  3K8U A;  4KLB A;  3I06 A;  3BOW A;  2FO5 A;  3HWN A;  3KX1 A;  2FTD A;  1CVZ A;  1W5R A;  2JQG R;  2R9N A;  4BS6 A;  2JQF R;  5A24 A;  1ZCM A;  4PI3 A;  1KHQ A;  3RVX A;  1QMY A;  2G6D A;  3KSE A;  4FJC A;  3H8B A;  4C5P A;  4YYV A;  2YJC A;  3U8E A;  3KWB X;  4FIP A;  4X6H A;  1YK7 A;  1CSB B;  4AXL A;  1CB5 A;  2NQA A;  4W5C A;  1KFU L;  2E00 A;  2PNS A;  3HD3 A;  3MOR A;  1PPP A;  2E02 A;  4CDC B;  4YYW A;  3K9M A;  3PNR A;  1Q6K A;  3OIS A;  1CJL A;  2FT2 A;  3K24 A;  1Y4H A;  3OVZ A;  4P6G A;  3MTN A;  1NPZ A;  3BWK A;  3P5X A;  1ICF A;  3KWZ A;  1X9Y A;  3GCB A;  2NQI A;  2DZY A;  4NV7 A;  2R9M A;  2ARY A;  1F29 A;  1YVB A;  1PPD A;  3IV2 A;  2DC7 A;  1CS8 A;  4P6E A;  1IWD A;  4N8W A;  2CIO A;  3E1Z B;  3F5V A;  3TNX A;  1A6R A;  3MHS A;  4BPV A;  2VFB A;  4CZW A;  4AXM A;  1ITO A;  3ERV A;  1AEC A;  3C9E A;  2PBH A;  4W4U A;  4I04 A;  3H7D A;  4MSX A;  4WA6 A;  1U9Q X;  3LXS A;  3AI8 A;  2IBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...