1BP4A

Use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PAPAIN
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bp4A00
2NQAA 4QRGA 4N4ZA 4Q8HA 4QRXA 4MZSA 2YJ9A 2PNSA 1PE6A 3MTNA 3RVXA 4W5CA 4PADA 3I06A 1VSNA 4I04A 2AYNA 3BPFA 4Q8GA 2PREA 3WXEA 4YYVA 2FYEA 1QOLA 1TU6A 4CDCB 4PI3A 1GMYA 2E00A 3BOWA 1GCBA 4W4UA 4PP1A 5CVNB 2FTDA 1EWPA 4YV8A 4QH6A 3H8BA 1S4VA 3ZUAA 1AIMA 2Y6EA 1F2AA 1PPOA 1CS8A 2B1MA 1QDQA 2DCBA 1TL9A 5CHVA 1CJLA 3QT4A 4W5BA 1ME3A 2OP3A 1CVZA 2AUXA 3MHHA 1YK7A 3ERVA 3KFQA 2FO5A 3KX1A 4FIPA 2YJ2A 3H6SA 2JQGR 1YT7A 1AYWA 3V6EA 3MHSA 3OISA 1XKGA 2E03A 3PW3A 4BPVA 1DEUA 1VJVA 3CBJA 2WBFX 3F5VA 4G54A 4OEMA 3P5UA 3OVZA 1CQDA 3LXSA 2G7YA 3KKUA 4K7CA 2FQ9A 3D6SA 1YVBA 1PPPA 3CBKA 4BS5A 3HD3A 1MHWA 2DC6A 1NL6A 2Y5BA 3H7DA 4KLBA 4MZOA 2VHFA 2DZZA 3NHEA 3V6CA 1KFXL 2GFOA 5EF4A 1ZCMA 4YYRA 2DC7A 1EWLA 2OZ2A 4OELA 1M6DA 3O1GA 2XU4A 1GECE 3K9MA 2YJBA 1PXVA 4FK5A 1THEA 2AU1A 1CSBB 2DC9A 2HXZA 1PADA 3K24A 2AYOA 1IWDA 2H7JA 3IEJA 4CDDB 2NQIA 2IBIA 2F7DA 1STFE 5EGWA 3PDFA 2P86A 4X6HA 3BPMA 1KXRA 2G6DA 1K3BB 3BCNA 1BQIA 2O6XA 2JQFR 2YJCA 2AVWA 1KHQA 1POPA 2AUZA 4BS6A 4XR7A 4ZUXU 1ME4A 4PP2E 3KWBX 4P6GA 4HWYA 3K8UA 1U9WA 1CTEA 2DJGB 2G8JA 4I07A 3P5VA 2XU5A 5PADA 1U9VA 1NPZA 3BC3A 1TLOA 3IMAA 1BY8A 1EWOA 2NQGA 3CH2X 1PBHA 2DCAA 4N79A 3IOQA 1U9QX 1KHPA 4YVAA 1NQCA 8PCHA 5CHTA 4MSXA 4AXMA 1SP4B 3DF0A 1NB3A 5A24A 3M99A 1CV8A 3KW9A 1PPNA 1AU2A 3S3RA 3H89A 2R9NA 5CVOB 4X6IA 3N3KA 3KSEA 7PCKA 1MEMA 4DMXA 1HUCB 1MEGA 2OULA 2ACTA 4I05A 4X6JA 2DJFB 2DCCA 1U5IA 2DZYA 3OVXA 3HHAA 2AS8A 2CB5A 1Q6KA 1CB5A 1ICFA 4CDFB 1MDWA 3P5WA 3HHIA 2XU1A 1ZIVA 3CH3X 3GCBA 3RVWA 2F1GA 3OF8A 3AI8A 2FT2A 4YYQA 2PBHA 3IV2A 3QJ3A 2FRAA 5JA7A 3O0UA 2CIOA 3E1ZB 5CVMA 3MORA 4YYSA 5FPWA 2C0YA 2R9FA 2VHSA 2GHUA 5J94A 2ATOA 3N3GA 4YYUA 1F29A 2HHNA 1AYVA 1F2BA 3C9EA 1U9XA 3P5XA 4YYWA 1QMYA 2FUDA 1PCIA 1GLOA 2HD5A 1X9YA 1PIPA 1ITOA 2R9OA 4BQVA 2E01A 1JQPA 2IPPB 2B1NA 1QXPA 3S3QA 2R9CA 4QBBA 2YJ8A 2ARYA 1EF7A 2NQDB 2PADA 3IUTA 3USVA 4CDEB 1AECA 1EWMA 2HH5A 1KFUL 3QSDA 3RVVA 2P0RA 3PBHA 2R6NA 4CZWA 3TNXA 2P7UA 3LFYA 2AIMA 1O0EA 3H8CA 1F2CA 1YALA 3U8EA 4BSQA 3F75A 1BGOA 1Y08A 2BDLA 5F02A 4RY2A 5K16A 4XUIA 3WXFA 2G8EA 9PAPA 4N8WA 1NLJA 4DMYA 1MIRA 2DC8A 5JH3A 2E02A 1NB5A 3IHPA 1AU4A 3B79A 6PADA 2BDZA 4P6EA 1SNKA 1FH0A 3N4CA 3HWNA 1AU3A 1DF0A 3KWZA 4WA6A 1MS6A 4AXLA 3BWKA 4FJCA 1A6RA 1Y4HA 3I3TA 1BP4A 2R9MA 3PNRA 3OF9A 1YK8A 1AU0A 4QRVA 2DCDA 1AYUA 1ATKA 3WXGA 1CPJA 1PPDA 2FRQA 2XU3A
chains in the Genus database with same CATH superfamily
2NQAA 4QRGA 4N4ZA 4Q8HA 4QRXA 4MZSA 2YJ9A 2PNSA 1PE6A 3MTNA 3RVXA 4W5CA 4PADA 4D8EA 3I06A 1VSNA 4I04A 2AYNA 3BPFA 4Q8GA 2PREA 3WXEA 3C0RA 4YYVA 2FYEA 1QOLA 3BBAA 1TU6A 4CDCB 4PI3A 3PRPA 5E6JA 1GMYA 2E00A 3BOWA 2J7QA 1GCBA 2UZJA 4W4UA 4PP1A 4IP3A 5CVNB 2FTDA 1EWPA 4YV8A 4QH6A 3H8BA 3PHWA 1S4VA 3ZUAA 1AIMA 2Y6EA 1F2AA 1PPOA 1CS8A 2B1MA 1QDQA 2DCBA 1TL9A 5CHVA 1CJLA 3QT4A 4W5BA 1ME3A 2OP3A 1CVZA 2AUXA 3MHHA 1YK7A 3ERVA 3KFQA 2FO5A 3KX1A 4FIPA 4M0WA 2YJ2A 3H6SA 2JQGR 1YT7A 1AYWA 3V6EA 3MHSA 3OISA 3PSEA 4PT5A 1XKGA 2E03A 3PW3A 4BPVA 1DEUA 1VJVA 3CBJA 2WBFX 3F5VA 4G54A 3PHUA 4OEMA 3P5UA 3OVZA 1CQDA 3LXSA 2G7YA 3KKUA 4K7CA 2FQ9A 3D6SA 1YVBA 1PPPA 3CBKA 4BS5A 3HD3A 1MHWA 4RKXA 2DC6A 1NL6A 2Y5BA 3H7DA 4KLBA 4MZOA 2VHFA 2DZZA 3NHEA 1YZBA 4OVZB 3V6CA 3B21A 1KFXL 2GFOA 5EF4A 1ZCMA 4YYRA 4MI7A 3RNVA 2DC7A 1EWLA 2OZ2A 2JRIA 4OELA 1M6DA 3O1GA 1PVJA 2XU4A 1GECE 3K9MA 2YJBA 3MJ5A 1PXVA 4FK5A 1THEA 2AU1A 4BOSA 1CSBB 2DC9A 2HXZA 1PADA 3K24A 2AYOA 1IWDA 2H7JA 3IEJA 4CDDB 3MP2A 2NQIA 2IBIA 4BOUA 2F7DA 2BU3A 1STFE 5EGWA 3PDFA 2P86A 2JTCA 1UKFA 4X6HA 3BPMA 4BOPA 1KXRA 4GUAA 2G6DA 1K3BB 3BCNA 1BQIA 2O6XA 2AGAA 2JQFR 2YJCA 3IFUA 2AVWA 1KHQA 1POPA 2AUZA 4BS6A 4XR7A 4ZUXU 1ME4A 4PP2E 3KWBX 4P6GA 4HWYA 3K8UA 1U9WA 1CTEA 2DJGB 2G8JA 4I07A 3W30A 3P5VA 2XU5A 2BTWB 5PADA 1U9VA 3MTVA 1NPZA 3PHXA 3BC3A 1TLOA 4OVZA 3IMAA 1BY8A 1EWOA 2NQGA 3CH2X 1PBHA 2DCAA 4N79A 3IOQA 1U9QX 1KHPA 4YVAA 1NQCA 8PCHA 5CHTA 4MSXA 4AXMA 1SP4B 3DF0A 1NB3A 5A24A 3M99A 1CV8A 4IUMA 3KW9A 1PPNA 1AU2A 3S3RA 3H89A 2DOSA 2R9NA 5CVOB 4X6IA 5JZEA 3N3KA 5EZSA 3KSEA 7PCKA 1MEMA 4DMXA 1HUCB 1MEGA 2OULA 2ACTA 4I05A 4ZTBA 4X6JA 2DJFB 2DCCA 1U5IA 2DZYA 3OVXA 3HHAA 2AS8A 3TRKA 2CB5A 1Q6KA 1CB5A 1ICFA 4CDFB 1MDWA 3P5WA 3PT2A 3HHIA 2XU1A 1ZIVA 3CH3X 3GCBA 3RVWA 2F1GA 3OF8A 3AI8A 2FT2A 4YYQA 5KO3A 3ZNHA 2PBHA 3IV2A 3QJ3A 2FRAA 2FE8A 5JA7A 5EZQA 3BB7A 2HWKA 3O0UA 2CIOA 3E1ZB 5CVMA 3MORA 4YYSA 5FPWA 4RF0A 2C0YA 2R9FA 2VHSA 2GHUA 5J94A 2ATOA 3N3GA 4YYUA 1F29A 2BTWA 4D8IA 2HHNA 1AYVA 1F2BA 3C9EA 1U9XA 3P5XA 4YYWA 1QMYA 3TMPA 2FUDA 1PCIA 1GLOA 2HD5A 1X9YA 1PIPA 4MM3B 1ITOA 1DKIA 3O65A 2R9OA 4BQVA 2E01A 1JQPA 2IPPB 3BY4A 2B1NA 1QXPA 3S3QA 2R9CA 4QBBA 2YJ8A 2ARYA 4REZA 4OW0A 1EF7A 4R3DA 2NQDB 2PADA 4P16A 3IUTA 3USVA 3PRMA 3W31A 1AECA 2J7QC 4CDEB 4D8BA 2Z84A 4RF1A 4RNAA 1EWMA 4HXDB 2HH5A 1KFUL 3QSDA 3RVVA 2P0RA 3PBHA 2R6NA 4CZWA 3TNXA 2P7UA 3LFYA 2AIMA 1O0EA 3H8CA 1F2CA 1YALA 3U8EA 4BSQA 3F75A 1BGOA 1Y08A 2BDLA 5F02A 4RY2A 5K16A 4A5UA 4XZXA 4XUIA 4WURA 3WXFA 2G8EA 9PAPA 4N8WA 1NLJA 4DMYA 1MIRA 2DC8A 5JH3A 3E9SA 2E02A 1NB5A 3IHPA 1AU4A 3B79A 6PADA 2BDZA 3OQCA 4P6EA 1SNKA 1FH0A 3N4CA 3HWNA 1AU3A 1DF0A 3KWZA 4WA6A 1MS6A 4AXLA 4BOQA 3BWKA 4FJCA 1A6RA 1Y4HA 3I3TA 4BOZA 1BP4A 2R9MA 3PNRA 3OF9A 1YK8A 1AU0A 4QRVA 2DCDA 1AYUA 1ATKA 3WXGA 1CPJA 1PPDA 2FRQA 2XU3A
chains in the Genus database with same CATH topology
2NQAA 4QRGA 4N4ZA 4Q8HA 4QRXA 4MZSA 2YJ9A 2PNSA 1PE6A 3MTNA 3RVXA 4W5CA 4PADA 3I06A 1VSNA 4I04A 2AYNA 3BPFA 4Q8GA 2PREA 3WXEA 4YYVA 2FYEA 1QOLA 1TU6A 4CDCB 4PI3A 1GMYA 2E00A 3BOWA 4C5PA 1GCBA 4W4UA 4PP1A 5CVNB 2FTDA 1W4TA 1EWPA 4YV8A 4QH6A 3H8BA 1S4VA 3ZUAA 1AIMA 2Y6EA 1F2AA 4NV7A 1PPOA 1CS8A 2B1MA 1QDQA 2DCBA 1TL9A 5CHVA 1CJLA 3QT4A 4W5BA 1ME3A 2OP3A 1CVZA 2AUXA 3MHHA 1YK7A 3ERVA 3KFQA 2FO5A 3KX1A 4FIPA 2YJ2A 3H6SA 2JQGR 1YT7A 1AYWA 3V6EA 3MHSA 3OISA 1XKGA 2E03A 3PW3A 4BPVA 1DEUA 1VJVA 3CBJA 2VFCA 2WBFX 3F5VA 4G54A 4OEMA 3P5UA 3OVZA 1CQDA 3LXSA 2G7YA 3KKUA 4K7CA 2FQ9A 3D6SA 1YVBA 1PPPA 3CBKA 4BS5A 3HD3A 1MHWA 2DC6A 1NL6A 2Y5BA 3H7DA 4KLBA 4MZOA 2VHFA 2DZZA 3NHEA 3V6CA 1KFXL 2GFOA 5EF4A 1ZCMA 4YYRA 2DC7A 1EWLA 2OZ2A 4OELA 1M6DA 3O1GA 2XU4A 1GECE 3K9MA 2YJBA 1PXVA 4FK5A 1THEA 2AU1A 1CSBB 2DC9A 2HXZA 1PADA 3K24A 2AYOA 1IWDA 2H7JA 3IEJA 4CDDB 4BGFA 2NQIA 2IBIA 2F7DA 1STFE 5EGWA 3PDFA 2P86A 4X6HA 3BPMA 1KXRA 2G6DA 1K3BB 3BCNA 1BQIA 2O6XA 2JQFR 2YJCA 2AVWA 1KHQA 1POPA 2AUZA 4BS6A 4XR7A 4ZUXU 4PP2E 1ME4A 3KWBX 4P6GA 4HWYA 3K8UA 1U9WA 1CTEA 2DJGB 2G8JA 4I07A 3P5VA 2XU5A 5PADA 1U9VA 1NPZA 3BC3A 1TLOA 3IMAA 1BY8A 1EWOA 2NQGA 3CH2X 1PBHA 2DCAA 4N79A 3IOQA 1U9QX 1KHPA 4YVAA 1NQCA 8PCHA 5CHTA 4MSXA 4AXMA 1SP4B 3DF0A 1NB3A 5A24A 3M99A 1CV8A 3KW9A 1PPNA 1AU2A 3S3RA 3H89A 2R9NA 5CVOB 4X6IA 3N3KA 3KSEA 7PCKA 1MEMA 4DMXA 1HUCB 1GX3A 1MEGA 2OULA 2ACTA 4I05A 4X6JA 2DJFB 2DCCA 1U5IA 2DZYA 3OVXA 3HHAA 2AS8A 2CB5A 1Q6KA 1CB5A 1ICFA 4CDFB 1MDWA 3P5WA 3HHIA 2XU1A 1ZIVA 3CH3X 3GCBA 3RVWA 2F1GA 3OF8A 3AI8A 2FT2A 4YYQA 2PBHA 3IV2A 3QJ3A 2FRAA 5JA7A 3O0UA 1W5RA 2CIOA 4GUZA 3E1ZB 5CVMA 3MORA 4YYSA 5FPWA 2VFBA 2C0YA 2R9FA 2VHSA 2GHUA 5J94A 2ATOA 3N3GA 4YYUA 1F29A 2HHNA 1AYVA 1F2BA 3C9EA 1U9XA 3P5XA 4YYWA 1QMYA 2FUDA 1PCIA 1GLOA 2HD5A 1X9YA 1PIPA 1E2TA 1ITOA 2R9OA 4BQVA 2E01A 1JQPA 2IPPB 2B1NA 1QXPA 3S3QA 2R9CA 4QBBA 2YJ8A 2ARYA 1W6FA 1EF7A 2NQDB 2PADA 3IUTA 3USVA 4CDEB 1AECA 3D9WA 1EWMA 2HH5A 1KFUL 3LTWA 3QSDA 3RVVA 2P0RA 3PBHA 2R6NA 4CZWA 3TNXA 2P7UA 3LFYA 2AIMA 1O0EA 2BSZA 3H8CA 1F2CA 1YALA 3U8EA 4BSQA 3F75A 1BGOA 1Y08A 2BDLA 5F02A 4RY2A 5K16A 4B55A 4XUIA 3WXFA 2G8EA 4NV8A 9PAPA 4N8WA 1NLJA 4DMYA 1MIRA 2DC8A 5JH3A 2E02A 1NB5A 3IHPA 1AU4A 3B79A 6PADA 2BDZA 4P6EA 1SNKA 1FH0A 3N4CA 3HWNA 1AU3A 1DF0A 3KWZA 4WA6A 1MS6A 4AXLA 3BWKA 4FJCA 1A6RA 1Y4HA 3I3TA 1BP4A 2R9MA 3PNRA 3OF9A 1YK8A 1AU0A 4QRVA 2DCDA 1AYUA 1ATKA 3WXGA 1CPJA 1PPDA 2FRQA 2XU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQA A;  4QRG A;  4N4Z A;  4Q8H A;  4QRX A;  4MZS A;  2YJ9 A;  2PNS A;  1PE6 A;  3MTN A;  3RVX A;  4W5C A;  4PAD A;  3I06 A;  1VSN A;  4I04 A;  2AYN A;  3BPF A;  4Q8G A;  2PRE A;  3WXE A;  4YYV A;  2FYE A;  1QOL A;  1TU6 A;  4CDC B;  4PI3 A;  1GMY A;  2E00 A;  3BOW A;  1GCB A;  4W4U A;  4PP1 A;  5CVN B;  2FTD A;  1EWP A;  4YV8 A;  4QH6 A;  3H8B A;  1S4V A;  3ZUA A;  1AIM A;  2Y6E A;  1F2A A;  1PPO A;  1CS8 A;  2B1M A;  1QDQ A;  2DCB A;  1TL9 A;  5CHV A;  1CJL A;  3QT4 A;  4W5B A;  1ME3 A;  2OP3 A;  1CVZ A;  2AUX A;  3MHH A;  1YK7 A;  3ERV A;  3KFQ A;  2FO5 A;  3KX1 A;  4FIP A;  2YJ2 A;  3H6S A;  2JQG R;  1YT7 A;  1AYW A;  3V6E A;  3MHS A;  3OIS A;  1XKG A;  2E03 A;  3PW3 A;  4BPV A;  1DEU A;  1VJV A;  3CBJ A;  2WBF X;  3F5V A;  4G54 A;  4OEM A;  3P5U A;  3OVZ A;  1CQD A;  3LXS A;  2G7Y A;  3KKU A;  4K7C A;  2FQ9 A;  3D6S A;  1YVB A;  1PPP A;  3CBK A;  4BS5 A;  3HD3 A;  1MHW A;  2DC6 A;  1NL6 A;  2Y5B A;  3H7D A;  4KLB A;  4MZO A;  2VHF A;  2DZZ A;  3NHE A;  3V6C A;  1KFX L;  2GFO A;  5EF4 A;  1ZCM A;  4YYR A;  2DC7 A;  1EWL A;  2OZ2 A;  4OEL A;  1M6D A;  3O1G A;  2XU4 A;  1GEC E;  3K9M A;  2YJB A;  1PXV A;  4FK5 A;  1THE A;  2AU1 A;  1CSB B;  2DC9 A;  2HXZ A;  1PAD A;  3K24 A;  2AYO A;  1IWD A;  2H7J A;  3IEJ A;  4CDD B;  2NQI A;  2IBI A;  2F7D A;  1STF E;  5EGW A;  3PDF A;  2P86 A;  4X6H A;  3BPM A;  1KXR A;  2G6D A;  1K3B B;  3BCN A;  1BQI A;  2O6X A;  2JQF R;  2YJC A;  2AVW A;  1KHQ A;  1POP A;  2AUZ A;  4BS6 A;  4XR7 A;  4ZUX U;  1ME4 A;  4PP2 E;  3KWB X;  4P6G A;  4HWY A;  3K8U A;  1U9W A;  1CTE A;  2DJG B;  2G8J A;  4I07 A;  3P5V A;  2XU5 A;  5PAD A;  1U9V A;  1NPZ A;  3BC3 A;  1TLO A;  3IMA A;  1BY8 A;  1EWO A;  2NQG A;  3CH2 X;  1PBH A;  2DCA A;  4N79 A;  3IOQ A;  1U9Q X;  1KHP A;  4YVA A;  1NQC A;  8PCH A;  5CHT A;  4MSX A;  4AXM A;  1SP4 B;  3DF0 A;  1NB3 A;  5A24 A;  3M99 A;  1CV8 A;  3KW9 A;  1PPN A;  1AU2 A;  3S3R A;  3H89 A;  2R9N A;  5CVO B;  4X6I A;  3N3K A;  3KSE A;  7PCK A;  1MEM A;  4DMX A;  1HUC B;  1MEG A;  2OUL A;  2ACT A;  4I05 A;  4X6J A;  2DJF B;  2DCC A;  1U5I A;  2DZY A;  3OVX A;  3HHA A;  2AS8 A;  2CB5 A;  1Q6K A;  1CB5 A;  1ICF A;  4CDF B;  1MDW A;  3P5W A;  3HHI A;  2XU1 A;  1ZIV A;  3CH3 X;  3GCB A;  3RVW A;  2F1G A;  3OF8 A;  3AI8 A;  2FT2 A;  4YYQ A;  2PBH A;  3IV2 A;  3QJ3 A;  2FRA A;  5JA7 A;  3O0U A;  2CIO A;  3E1Z B;  5CVM A;  3MOR A;  4YYS A;  5FPW A;  2C0Y A;  2R9F A;  2VHS A;  2GHU A;  5J94 A;  2ATO A;  3N3G A;  4YYU A;  1F29 A;  2HHN A;  1AYV A;  1F2B A;  3C9E A;  1U9X A;  3P5X A;  4YYW A;  1QMY A;  2FUD A;  1PCI A;  1GLO A;  2HD5 A;  1X9Y A;  1PIP A;  1ITO A;  2R9O A;  4BQV A;  2E01 A;  1JQP A;  2IPP B;  2B1N A;  1QXP A;  3S3Q A;  2R9C A;  4QBB A;  2YJ8 A;  2ARY A;  1EF7 A;  2NQD B;  2PAD A;  3IUT A;  3USV A;  4CDE B;  1AEC A;  1EWM A;  2HH5 A;  1KFU L;  3QSD A;  3RVV A;  2P0R A;  3PBH A;  2R6N A;  4CZW A;  3TNX A;  2P7U A;  3LFY A;  2AIM A;  1O0E A;  3H8C A;  1F2C A;  1YAL A;  3U8E A;  4BSQ A;  3F75 A;  1BGO A;  1Y08 A;  2BDL A;  5F02 A;  4RY2 A;  5K16 A;  4XUI A;  3WXF A;  2G8E A;  9PAP A;  4N8W A;  1NLJ A;  4DMY A;  1MIR A;  2DC8 A;  5JH3 A;  2E02 A;  1NB5 A;  3IHP A;  1AU4 A;  3B79 A;  6PAD A;  2BDZ A;  4P6E A;  1SNK A;  1FH0 A;  3N4C A;  3HWN A;  1AU3 A;  1DF0 A;  3KWZ A;  4WA6 A;  1MS6 A;  4AXL A;  3BWK A;  4FJC A;  1A6R A;  1Y4H A;  3I3T A;  1BP4 A;  2R9M A;  3PNR A;  3OF9 A;  1YK8 A;  1AU0 A;  4QRV A;  2DCD A;  1AYU A;  1ATK A;  3WXG A;  1CPJ A;  1PPD A;  2FRQ A;  2XU3 A; 
#chains in the Genus database with same CATH topology
 2NQA A;  4QRG A;  4N4Z A;  4Q8H A;  4QRX A;  4MZS A;  2YJ9 A;  2PNS A;  1PE6 A;  3MTN A;  3RVX A;  4W5C A;  4PAD A;  4D8E A;  3I06 A;  1VSN A;  4I04 A;  2AYN A;  3BPF A;  4Q8G A;  2PRE A;  3WXE A;  3C0R A;  4YYV A;  2FYE A;  1QOL A;  3BBA A;  1TU6 A;  4CDC B;  4PI3 A;  3PRP A;  5E6J A;  1GMY A;  2E00 A;  3BOW A;  2J7Q A;  1GCB A;  2UZJ A;  4W4U A;  4PP1 A;  4IP3 A;  5CVN B;  2FTD A;  1EWP A;  4YV8 A;  4QH6 A;  3H8B A;  3PHW A;  1S4V A;  3ZUA A;  1AIM A;  2Y6E A;  1F2A A;  1PPO A;  1CS8 A;  2B1M A;  1QDQ A;  2DCB A;  1TL9 A;  5CHV A;  1CJL A;  3QT4 A;  4W5B A;  1ME3 A;  2OP3 A;  1CVZ A;  2AUX A;  3MHH A;  1YK7 A;  3ERV A;  3KFQ A;  2FO5 A;  3KX1 A;  4FIP A;  4M0W A;  2YJ2 A;  3H6S A;  2JQG R;  1YT7 A;  1AYW A;  3V6E A;  3MHS A;  3OIS A;  3PSE A;  4PT5 A;  1XKG A;  2E03 A;  3PW3 A;  4BPV A;  1DEU A;  1VJV A;  3CBJ A;  2WBF X;  3F5V A;  4G54 A;  3PHU A;  4OEM A;  3P5U A;  3OVZ A;  1CQD A;  3LXS A;  2G7Y A;  3KKU A;  4K7C A;  2FQ9 A;  3D6S A;  1YVB A;  1PPP A;  3CBK A;  4BS5 A;  3HD3 A;  1MHW A;  4RKX A;  2DC6 A;  1NL6 A;  2Y5B A;  3H7D A;  4KLB A;  4MZO A;  2VHF A;  2DZZ A;  3NHE A;  1YZB A;  4OVZ B;  3V6C A;  3B21 A;  1KFX L;  2GFO A;  5EF4 A;  1ZCM A;  4YYR A;  4MI7 A;  3RNV A;  2DC7 A;  1EWL A;  2OZ2 A;  2JRI A;  4OEL A;  1M6D A;  3O1G A;  1PVJ A;  2XU4 A;  1GEC E;  3K9M A;  2YJB A;  3MJ5 A;  1PXV A;  4FK5 A;  1THE A;  2AU1 A;  4BOS A;  1CSB B;  2DC9 A;  2HXZ A;  1PAD A;  3K24 A;  2AYO A;  1IWD A;  2H7J A;  3IEJ A;  4CDD B;  3MP2 A;  2NQI A;  2IBI A;  4BOU A;  2F7D A;  2BU3 A;  1STF E;  5EGW A;  3PDF A;  2P86 A;  2JTC A;  1UKF A;  4X6H A;  3BPM A;  4BOP A;  1KXR A;  4GUA A;  2G6D A;  1K3B B;  3BCN A;  1BQI A;  2O6X A;  2AGA A;  2JQF R;  2YJC A;  3IFU A;  2AVW A;  1KHQ A;  1POP A;  2AUZ A;  4BS6 A;  4XR7 A;  4ZUX U;  1ME4 A;  4PP2 E;  3KWB X;  4P6G A;  4HWY A;  3K8U A;  1U9W A;  1CTE A;  2DJG B;  2G8J A;  4I07 A;  3W30 A;  3P5V A;  2XU5 A;  2BTW B;  5PAD A;  1U9V A;  3MTV A;  1NPZ A;  3PHX A;  3BC3 A;  1TLO A;  4OVZ A;  3IMA A;  1BY8 A;  1EWO A;  2NQG A;  3CH2 X;  1PBH A;  2DCA A;  4N79 A;  3IOQ A;  1U9Q X;  1KHP A;  4YVA A;  1NQC A;  8PCH A;  5CHT A;  4MSX A;  4AXM A;  1SP4 B;  3DF0 A;  1NB3 A;  5A24 A;  3M99 A;  1CV8 A;  4IUM A;  3KW9 A;  1PPN A;  1AU2 A;  3S3R A;  3H89 A;  2DOS A;  2R9N A;  5CVO B;  4X6I A;  5JZE A;  3N3K A;  5EZS A;  3KSE A;  7PCK A;  1MEM A;  4DMX A;  1HUC B;  1MEG A;  2OUL A;  2ACT A;  4I05 A;  4ZTB A;  4X6J A;  2DJF B;  2DCC A;  1U5I A;  2DZY A;  3OVX A;  3HHA A;  2AS8 A;  3TRK A;  2CB5 A;  1Q6K A;  1CB5 A;  1ICF A;  4CDF B;  1MDW A;  3P5W A;  3PT2 A;  3HHI A;  2XU1 A;  1ZIV A;  3CH3 X;  3GCB A;  3RVW A;  2F1G A;  3OF8 A;  3AI8 A;  2FT2 A;  4YYQ A;  5KO3 A;  3ZNH A;  2PBH A;  3IV2 A;  3QJ3 A;  2FRA A;  2FE8 A;  5JA7 A;  5EZQ A;  3BB7 A;  2HWK A;  3O0U A;  2CIO A;  3E1Z B;  5CVM A;  3MOR A;  4YYS A;  5FPW A;  4RF0 A;  2C0Y A;  2R9F A;  2VHS A;  2GHU A;  5J94 A;  2ATO A;  3N3G A;  4YYU A;  1F29 A;  2BTW A;  4D8I A;  2HHN A;  1AYV A;  1F2B A;  3C9E A;  1U9X A;  3P5X A;  4YYW A;  1QMY A;  3TMP A;  2FUD A;  1PCI A;  1GLO A;  2HD5 A;  1X9Y A;  1PIP A;  4MM3 B;  1ITO A;  1DKI A;  3O65 A;  2R9O A;  4BQV A;  2E01 A;  1JQP A;  2IPP B;  3BY4 A;  2B1N A;  1QXP A;  3S3Q A;  2R9C A;  4QBB A;  2YJ8 A;  2ARY A;  4REZ A;  4OW0 A;  1EF7 A;  4R3D A;  2NQD B;  2PAD A;  4P16 A;  3IUT A;  3USV A;  3PRM A;  3W31 A;  1AEC A;  2J7Q C;  4CDE B;  4D8B A;  2Z84 A;  4RF1 A;  4RNA A;  1EWM A;  4HXD B;  2HH5 A;  1KFU L;  3QSD A;  3RVV A;  2P0R A;  3PBH A;  2R6N A;  4CZW A;  3TNX A;  2P7U A;  3LFY A;  2AIM A;  1O0E A;  3H8C A;  1F2C A;  1YAL A;  3U8E A;  4BSQ A;  3F75 A;  1BGO A;  1Y08 A;  2BDL A;  5F02 A;  4RY2 A;  5K16 A;  4A5U A;  4XZX A;  4XUI A;  4WUR A;  3WXF A;  2G8E A;  9PAP A;  4N8W A;  1NLJ A;  4DMY A;  1MIR A;  2DC8 A;  5JH3 A;  3E9S A;  2E02 A;  1NB5 A;  3IHP A;  1AU4 A;  3B79 A;  6PAD A;  2BDZ A;  3OQC A;  4P6E A;  1SNK A;  1FH0 A;  3N4C A;  3HWN A;  1AU3 A;  1DF0 A;  3KWZ A;  4WA6 A;  1MS6 A;  4AXL A;  4BOQ A;  3BWK A;  4FJC A;  1A6R A;  1Y4H A;  3I3T A;  4BOZ A;  1BP4 A;  2R9M A;  3PNR A;  3OF9 A;  1YK8 A;  1AU0 A;  4QRV A;  2DCD A;  1AYU A;  1ATK A;  3WXG A;  1CPJ A;  1PPD A;  2FRQ A;  2XU3 A; 
#chains in the Genus database with same CATH homology
 2NQA A;  4QRG A;  4N4Z A;  4Q8H A;  4QRX A;  4MZS A;  2YJ9 A;  2PNS A;  1PE6 A;  3MTN A;  3RVX A;  4W5C A;  4PAD A;  3I06 A;  1VSN A;  4I04 A;  2AYN A;  3BPF A;  4Q8G A;  2PRE A;  3WXE A;  4YYV A;  2FYE A;  1QOL A;  1TU6 A;  4CDC B;  4PI3 A;  1GMY A;  2E00 A;  3BOW A;  4C5P A;  1GCB A;  4W4U A;  4PP1 A;  5CVN B;  2FTD A;  1W4T A;  1EWP A;  4YV8 A;  4QH6 A;  3H8B A;  1S4V A;  3ZUA A;  1AIM A;  2Y6E A;  1F2A A;  4NV7 A;  1PPO A;  1CS8 A;  2B1M A;  1QDQ A;  2DCB A;  1TL9 A;  5CHV A;  1CJL A;  3QT4 A;  4W5B A;  1ME3 A;  2OP3 A;  1CVZ A;  2AUX A;  3MHH A;  1YK7 A;  3ERV A;  3KFQ A;  2FO5 A;  3KX1 A;  4FIP A;  2YJ2 A;  3H6S A;  2JQG R;  1YT7 A;  1AYW A;  3V6E A;  3MHS A;  3OIS A;  1XKG A;  2E03 A;  3PW3 A;  4BPV A;  1DEU A;  1VJV A;  3CBJ A;  2VFC A;  2WBF X;  3F5V A;  4G54 A;  4OEM A;  3P5U A;  3OVZ A;  1CQD A;  3LXS A;  2G7Y A;  3KKU A;  4K7C A;  2FQ9 A;  3D6S A;  1YVB A;  1PPP A;  3CBK A;  4BS5 A;  3HD3 A;  1MHW A;  2DC6 A;  1NL6 A;  2Y5B A;  3H7D A;  4KLB A;  4MZO A;  2VHF A;  2DZZ A;  3NHE A;  3V6C A;  1KFX L;  2GFO A;  5EF4 A;  1ZCM A;  4YYR A;  2DC7 A;  1EWL A;  2OZ2 A;  4OEL A;  1M6D A;  3O1G A;  2XU4 A;  1GEC E;  3K9M A;  2YJB A;  1PXV A;  4FK5 A;  1THE A;  2AU1 A;  1CSB B;  2DC9 A;  2HXZ A;  1PAD A;  3K24 A;  2AYO A;  1IWD A;  2H7J A;  3IEJ A;  4CDD B;  4BGF A;  2NQI A;  2IBI A;  2F7D A;  1STF E;  5EGW A;  3PDF A;  2P86 A;  4X6H A;  3BPM A;  1KXR A;  2G6D A;  1K3B B;  3BCN A;  1BQI A;  2O6X A;  2JQF R;  2YJC A;  2AVW A;  1KHQ A;  1POP A;  2AUZ A;  4BS6 A;  4XR7 A;  4ZUX U;  4PP2 E;  1ME4 A;  3KWB X;  4P6G A;  4HWY A;  3K8U A;  1U9W A;  1CTE A;  2DJG B;  2G8J A;  4I07 A;  3P5V A;  2XU5 A;  5PAD A;  1U9V A;  1NPZ A;  3BC3 A;  1TLO A;  3IMA A;  1BY8 A;  1EWO A;  2NQG A;  3CH2 X;  1PBH A;  2DCA A;  4N79 A;  3IOQ A;  1U9Q X;  1KHP A;  4YVA A;  1NQC A;  8PCH A;  5CHT A;  4MSX A;  4AXM A;  1SP4 B;  3DF0 A;  1NB3 A;  5A24 A;  3M99 A;  1CV8 A;  3KW9 A;  1PPN A;  1AU2 A;  3S3R A;  3H89 A;  2R9N A;  5CVO B;  4X6I A;  3N3K A;  3KSE A;  7PCK A;  1MEM A;  4DMX A;  1HUC B;  1GX3 A;  1MEG A;  2OUL A;  2ACT A;  4I05 A;  4X6J A;  2DJF B;  2DCC A;  1U5I A;  2DZY A;  3OVX A;  3HHA A;  2AS8 A;  2CB5 A;  1Q6K A;  1CB5 A;  1ICF A;  4CDF B;  1MDW A;  3P5W A;  3HHI A;  2XU1 A;  1ZIV A;  3CH3 X;  3GCB A;  3RVW A;  2F1G A;  3OF8 A;  3AI8 A;  2FT2 A;  4YYQ A;  2PBH A;  3IV2 A;  3QJ3 A;  2FRA A;  5JA7 A;  3O0U A;  1W5R A;  2CIO A;  4GUZ A;  3E1Z B;  5CVM A;  3MOR A;  4YYS A;  5FPW A;  2VFB A;  2C0Y A;  2R9F A;  2VHS A;  2GHU A;  5J94 A;  2ATO A;  3N3G A;  4YYU A;  1F29 A;  2HHN A;  1AYV A;  1F2B A;  3C9E A;  1U9X A;  3P5X A;  4YYW A;  1QMY A;  2FUD A;  1PCI A;  1GLO A;  2HD5 A;  1X9Y A;  1PIP A;  1E2T A;  1ITO A;  2R9O A;  4BQV A;  2E01 A;  1JQP A;  2IPP B;  2B1N A;  1QXP A;  3S3Q A;  2R9C A;  4QBB A;  2YJ8 A;  2ARY A;  1W6F A;  1EF7 A;  2NQD B;  2PAD A;  3IUT A;  3USV A;  4CDE B;  1AEC A;  3D9W A;  1EWM A;  2HH5 A;  1KFU L;  3LTW A;  3QSD A;  3RVV A;  2P0R A;  3PBH A;  2R6N A;  4CZW A;  3TNX A;  2P7U A;  3LFY A;  2AIM A;  1O0E A;  2BSZ A;  3H8C A;  1F2C A;  1YAL A;  3U8E A;  4BSQ A;  3F75 A;  1BGO A;  1Y08 A;  2BDL A;  5F02 A;  4RY2 A;  5K16 A;  4B55 A;  4XUI A;  3WXF A;  2G8E A;  4NV8 A;  9PAP A;  4N8W A;  1NLJ A;  4DMY A;  1MIR A;  2DC8 A;  5JH3 A;  2E02 A;  1NB5 A;  3IHP A;  1AU4 A;  3B79 A;  6PAD A;  2BDZ A;  4P6E A;  1SNK A;  1FH0 A;  3N4C A;  3HWN A;  1AU3 A;  1DF0 A;  3KWZ A;  4WA6 A;  1MS6 A;  4AXL A;  3BWK A;  4FJC A;  1A6R A;  1Y4H A;  3I3T A;  1BP4 A;  2R9M A;  3PNR A;  3OF9 A;  1YK8 A;  1AU0 A;  4QRV A;  2DCD A;  1AYU A;  1ATK A;  3WXG A;  1CPJ A;  1PPD A;  2FRQ A;  2XU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...