3IUTA

The crystal structure of cruzain in complex with a tetrafluorophenoxymethyl ketone inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLAEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDGAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cruzipain
publication title Nonpeptidic tetrafluorophenoxymethyl ketone cruzain inhibitors as promising new leads for chagas disease chemotherapy.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 68
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3iutA00
3RVXA 4W4UA 3E1ZB 4Q8HA 2HXZA 3K9MA 4YYWA 3PBHA 4N8WA 3KSEA 2DC8A 2R9FA 5A24A 3DF0A 1MEGA 4YYUA 4CDEB 4HWYA 2WBFX 2FO5A 3MHHA 1EF7A 1U9VA 1F2AA 3BPMA 2IBIA 1BP4A 1AU3A 3H7DA 1F2BA 3ZUAA 1KFXL 2B1MA 4AXMA 6PADA 2P7UA 3HWNA 4X6HA 1ZCMA 3P5VA 4QRGA 3KX1A 4FIPA 2DC9A 5CVNB 1NPZA 2F7DA 2E00A 2OP3A 4YVAA 1QDQA 1Y08A 2C0YA 9PAPA 1CS8A 4W5CA 3BOWA 4I04A 3P5WA 3NHEA 1GCBA 3IV2A 4I07A 4OEMA 3IMAA 3N3KA 1NB3A 3H6SA 1YALA 2XU3A 4CDFB 2DC7A 1SNKA 4YV8A 4FK5A 3OF8A 1PPNA 2XU4A 2CB5A 2NQDB 3GCBA 3IUTA 2E03A 2NQIA 3RVVA 4BS6A 3QSDA 2AYNA 1BQIA 1FH0A 4CDDB 3IEJA 4QH6A 3QJ3A 1PPPA 3H89A 3LXSA 3CH2X 1ATKA 2R9NA 2PBHA 2R9OA 1CVZA 2ARYA 4KLBA 1THEA 5EF4A 1MEMA 1ME3A 2BDLA 1U9WA 1YK8A 4G54A 3K24A 1PIPA 1AU4A 1MIRA 3D6SA 1S4VA 4P6GA 1O0EA 1AIMA 1Y4HA 3K8UA 1GMYA 3IOQA 4XUIA 3MTNA 1CV8A 1ICFA 2DZZA 1YVBA 1EWPA 2XU5A 1BGOA 3IHPA 2PADA 2FRAA 1AU0A 4YYQA 3N4CA 1TLOA 1YK7A 4W5BA 5JA7A 3PDFA 1K3BB 2AU1A 2B1NA 4X6JA 1NLJA 2F1GA 1MDWA 4BSQA 8PCHA 4X6IA 2JQFR 1AECA 1CPJA 4MSXA 1CJLA 4RY2A 3PW3A 5CHVA 3WXEA 2YJ8A 1CSBB 4CDCB 3PNRA 1U9QX 2G8EA 4BS5A 5J94A 1BY8A 1TU6A 2GFOA 2VHSA 2R9CA 4QRXA 1SP4B 2DCAA 3MHSA 4XR7A 3KWZA 2FUDA 4FJCA 2DC6A 3O0UA 3KW9A 5PADA 4N79A 1QOLA 2R9MA 2E01A 1GLOA 2G6DA 2DJGB 2AUXA 3ERVA 2R6NA 1MHWA 2FTDA 4PADA 2YJCA 1PPOA 2Y5BA 1EWOA 3WXGA 2O6XA 3V6EA 3P5XA 1CB5A 1ITOA 5CHTA 3WXFA 7PCKA 4K7CA 3USVA 3P5UA 3U8EA 1F2CA 3F75A 2IPPB 1POPA 2OZ2A 1VSNA 1QMYA 1PE6A 3N3GA 2PNSA 2YJ2A 2DCBA 3HHAA 2CIOA 1ME4A 1KFUL 3CH3X 2G7YA 1MS6A 2OULA 2AUZA 3H8BA 2P86A 2G8JA 4PP2E 3KWBX 3KKUA 4YYSA 4OELA 5JH3A 1ZIVA 2NQAA 3RVWA 3BC3A 2ATOA 3OVXA 3CBJA 1NQCA 2Y6EA 2GHUA 1U5IA 1PXVA 3V6CA 1EWLA 4ZUXU 4N4ZA 1X9YA 5CVMA 4YYVA 2H7JA 3BCNA 3B79A 3MORA 4AXLA 1STFE 2FRQA 3OISA 3HD3A 1YT7A 4PI3A 4CZWA 2NQGA 5FPWA 1JQPA 2P0RA 2XU1A 3M99A 1F29A 1KXRA 5CVOB 3OF9A 5EGWA 3I06A 1NB5A 1GECE 2HD5A 4MZSA 2HH5A 3AI8A 2DJFB 2DCCA 3F5VA 4P6EA 3QT4A 1DEUA 1VJVA 4BQVA 2YJ9A 3S3QA 1KHQA 1PCIA 3CBKA 4YYRA 1CTEA 1IWDA 1U9XA 2AIMA 1DF0A 3TNXA 4I05A 1KHPA 2DZYA 4Q8GA 3KFQA 2HHNA 3O1GA 2ACTA 1TL9A 2FYEA 3BWKA 1HUCB 1PPDA 4DMXA 5F02A 4BPVA 1M6DA 2AS8A 4PP1A 1QXPA 3I3TA 2DCDA 4DMYA 2FT2A 5K16A 1PBHA 2BDZA 1EWMA 1AYWA 2E02A 3LFYA 1XKGA 2AVWA 1A6RA 2YJBA 2FQ9A 3C9EA 4WA6A 3OVZA 1NL6A 2VHFA 3BPFA 4QBBA 4QRVA 1AU2A 1PADA 1AYUA 4MZOA 3HHIA 1AYVA 2PREA 2JQGR 2AYOA 1Q6KA 3S3RA 3H8CA 1CQDA
chains in the Genus database with same CATH superfamily
3RVXA 4W4UA 3E1ZB 4Q8HA 2HXZA 3K9MA 4YYWA 3PBHA 4BOZA 4N8WA 3KSEA 2DC8A 2R9FA 5A24A 3DF0A 3PHUA 1MEGA 4YYUA 3RNVA 4CDEB 3TRKA 4HWYA 2WBFX 2FO5A 3MHHA 1EF7A 1U9VA 1F2AA 3BPMA 2IBIA 1BP4A 5E6JA 1AU3A 3H7DA 1F2BA 3ZUAA 1KFXL 2B1MA 4AXMA 6PADA 2P7UA 3HWNA 5EZSA 4X6HA 1ZCMA 3P5VA 4RKXA 4QRGA 3KX1A 4FIPA 2DC9A 5CVNB 1NPZA 2F7DA 2E00A 2OP3A 4YVAA 1QDQA 1Y08A 2C0YA 9PAPA 3PRMA 1CS8A 4W5CA 3BOWA 4I04A 3P5WA 3NHEA 1GCBA 3IV2A 4I07A 4OEMA 1UKFA 2FE8A 3IMAA 3N3KA 5EZQA 1NB3A 3H6SA 1YALA 2XU3A 4CDFB 2DC7A 1SNKA 4YV8A 4FK5A 3OF8A 4M0WA 1PPNA 2XU4A 2CB5A 2NQDB 3GCBA 3IUTA 2E03A 2NQIA 4D8IA 2HWKA 3RVVA 4BS6A 3QSDA 2AYNA 1BQIA 1FH0A 4CDDB 3IEJA 4QH6A 3QJ3A 1PPPA 3H89A 3LXSA 3CH2X 1ATKA 4D8EA 2R9NA 2PBHA 2R9OA 1CVZA 2ARYA 4KLBA 1THEA 3IFUA 5EF4A 3W31A 1MEMA 1ME3A 2BDLA 2JTCA 1U9WA 1YK8A 4G54A 3K24A 1PIPA 3E9SA 1AU4A 1MIRA 4BOUA 3MTVA 3D6SA 1S4VA 4P6GA 1O0EA 4OVZB 1AIMA 1Y4HA 3K8UA 1GMYA 3IOQA 4XUIA 3MTNA 1CV8A 1ICFA 2DZZA 4MI7A 1YVBA 1EWPA 2XU5A 1BGOA 3IHPA 2PADA 2FRAA 1AU0A 4YYQA 3N4CA 1TLOA 1YK7A 4W5BA 5JA7A 3PDFA 3MP2A 1K3BB 2AU1A 2B1NA 4X6JA 2DOSA 1NLJA 2F1GA 3ZNHA 1MDWA 4OVZA 4BSQA 8PCHA 4X6IA 2JQFR 1AECA 1CPJA 4MSXA 1CJLA 4RF1A 5JZEA 4RY2A 4ZTBA 3PW3A 5CHVA 3WXEA 2YJ8A 3TMPA 1CSBB 4CDCB 3PNRA 1U9QX 2JRIA 2G8EA 4BOPA 4BS5A 5J94A 4R3DA 1BY8A 1TU6A 2GFOA 2VHSA 2R9CA 4QRXA 3PSEA 1SP4B 4HXDB 2DCAA 3MHSA 4XR7A 3KWZA 3PT2A 2FUDA 4FJCA 2DC6A 3B21A 3O0UA 2J7QA 3C0RA 3KW9A 5PADA 4N79A 1QOLA 2R9MA 2E01A 1DKIA 1GLOA 4IP3A 2G6DA 2DJGB 2AUXA 3PHWA 3ERVA 2R6NA 1MHWA 2FTDA 4PADA 2YJCA 1PPOA 2Y5BA 1EWOA 3WXGA 4P16A 2O6XA 3V6EA 3PHXA 3BBAA 3P5XA 1CB5A 1ITOA 5CHTA 3WXFA 7PCKA 4K7CA 3USVA 3P5UA 3U8EA 1F2CA 3F75A 2IPPB 1POPA 2OZ2A 4RNAA 1VSNA 1QMYA 1PE6A 3N3GA 2PNSA 2YJ2A 2DCBA 3MJ5A 3HHAA 2CIOA 1ME4A 1KFUL 3CH3X 2G7YA 1MS6A 2OULA 2AUZA 3BB7A 3H8BA 2P86A 2G8JA 4PP2E 3KWBX 3KKUA 4YYSA 4OELA 4OW0A 5JH3A 1ZIVA 2NQAA 3RVWA 3BC3A 2ATOA 3OVXA 3CBJA 1NQCA 2Y6EA 4RF0A 2GHUA 1U5IA 1PXVA 3V6CA 1EWLA 4ZUXU 4N4ZA 4GUAA 1X9YA 5CVMA 4YYVA 2H7JA 3BCNA 3B79A 3MORA 3O65A 4AXLA 4IUMA 1STFE 2FRQA 3OISA 3HD3A 1YT7A 4PI3A 4CZWA 2NQGA 5FPWA 1JQPA 2P0RA 2XU1A 3M99A 3OQCA 1F29A 1KXRA 5CVOB 3OF9A 5EGWA 3I06A 1NB5A 1GECE 2HD5A 2BTWB 4MZSA 5KO3A 2HH5A 3AI8A 2DJFB 2DCCA 3F5VA 4P6EA 3QT4A 1DEUA 3BY4A 1VJVA 4BQVA 2YJ9A 4XZXA 3S3QA 1KHQA 1PCIA 3CBKA 4YYRA 1CTEA 1IWDA 1U9XA 2AIMA 1DF0A 3TNXA 4I05A 1KHPA 2DZYA 4MM3B 2BTWA 4Q8GA 1PVJA 4WURA 3KFQA 2HHNA 3O1GA 2ACTA 1TL9A 2FYEA 3BWKA 1HUCB 1PPDA 4DMXA 5F02A 4BPVA 1M6DA 2AS8A 4PP1A 1QXPA 3I3TA 2DCDA 4DMYA 2FT2A 5K16A 1PBHA 2AGAA 2BDZA 1EWMA 1AYWA 2E02A 3LFYA 1XKGA 2AVWA 1A6RA 1YZBA 4BOQA 2YJBA 2FQ9A 2Z84A 3C9EA 3W30A 4WA6A 4PT5A 2UZJA 3OVZA 1NL6A 2VHFA 3BPFA 4QBBA 4QRVA 1AU2A 1PADA 1AYUA 2BU3A 4MZOA 3HHIA 1AYVA 4REZA 2PREA 4D8BA 2J7QC 2JQGR 4BOSA 2AYOA 4A5UA 1Q6KA 3S3RA 3PRPA 3H8CA 1CQDA
chains in the Genus database with same CATH topology
3RVXA 4W4UA 3E1ZB 4Q8HA 2HXZA 3K9MA 4YYWA 1W5RA 3PBHA 4N8WA 3KSEA 2DC8A 2R9FA 5A24A 3DF0A 1MEGA 4YYUA 4CDEB 4HWYA 2WBFX 2FO5A 3MHHA 1EF7A 1U9VA 1F2AA 3BPMA 2IBIA 1BP4A 1AU3A 3H7DA 1F2BA 3ZUAA 1KFXL 2B1MA 4AXMA 6PADA 2P7UA 3HWNA 4X6HA 1ZCMA 3P5VA 4QRGA 3KX1A 4FIPA 2DC9A 5CVNB 1NPZA 2F7DA 2E00A 2OP3A 4YVAA 3LTWA 1QDQA 1Y08A 2C0YA 9PAPA 1CS8A 4W5CA 3BOWA 4I04A 3P5WA 3NHEA 1GCBA 3IV2A 4I07A 4OEMA 3IMAA 3N3KA 1NB3A 3H6SA 1YALA 2XU3A 4CDFB 2DC7A 1SNKA 4YV8A 4FK5A 3OF8A 1PPNA 2XU4A 2CB5A 2NQDB 4GUZA 3GCBA 3IUTA 2E03A 2NQIA 3RVVA 4BS6A 3QSDA 2AYNA 1BQIA 1FH0A 4CDDB 3IEJA 4QH6A 3QJ3A 1PPPA 3H89A 3LXSA 3CH2X 1ATKA 2R9NA 2PBHA 2R9OA 1CVZA 2ARYA 4KLBA 1THEA 5EF4A 1MEMA 1ME3A 2BDLA 1U9WA 1YK8A 4G54A 3K24A 1PIPA 1AU4A 1MIRA 2VFCA 3D6SA 1S4VA 4P6GA 1O0EA 1AIMA 1Y4HA 3K8UA 4C5PA 1GMYA 3IOQA 4XUIA 3MTNA 1CV8A 1ICFA 2DZZA 4BGFA 1YVBA 1EWPA 2XU5A 1BGOA 3IHPA 2PADA 4NV7A 2FRAA 1AU0A 4YYQA 3N4CA 1TLOA 1YK7A 4W5BA 5JA7A 3PDFA 1K3BB 2AU1A 2B1NA 4X6JA 1NLJA 2F1GA 1MDWA 4BSQA 8PCHA 4X6IA 2JQFR 1AECA 1CPJA 1E2TA 1CJLA 4MSXA 4RY2A 3PW3A 5CHVA 3WXEA 2YJ8A 1CSBB 4CDCB 3PNRA 1U9QX 2G8EA 4BS5A 5J94A 1BY8A 1TU6A 2GFOA 2VHSA 2R9CA 4QRXA 1SP4B 2DCAA 3MHSA 4XR7A 3KWZA 2FUDA 4FJCA 2DC6A 3O0UA 3D9WA 3KW9A 5PADA 4N79A 1QOLA 2R9MA 2BSZA 2E01A 2VFBA 1GLOA 2G6DA 2DJGB 2AUXA 3ERVA 2R6NA 1MHWA 2FTDA 4PADA 2YJCA 1PPOA 2Y5BA 1EWOA 3WXGA 2O6XA 3V6EA 3P5XA 1CB5A 1ITOA 5CHTA 3WXFA 7PCKA 4K7CA 3USVA 3P5UA 3U8EA 1F2CA 3F75A 2IPPB 1POPA 2OZ2A 1VSNA 1QMYA 1PE6A 3N3GA 2PNSA 2YJ2A 2DCBA 3HHAA 2CIOA 1ME4A 1KFUL 3CH3X 2G7YA 1MS6A 2OULA 2AUZA 3H8BA 2P86A 2G8JA 4PP2E 3KWBX 3KKUA 4YYSA 4OELA 5JH3A 1ZIVA 2NQAA 3RVWA 3BC3A 2ATOA 3OVXA 3CBJA 1NQCA 2Y6EA 2GHUA 1U5IA 1PXVA 3V6CA 1EWLA 4ZUXU 4N4ZA 1X9YA 5CVMA 1W4TA 4YYVA 2H7JA 3BCNA 3B79A 3MORA 4AXLA 4B55A 1STFE 2FRQA 3OISA 3HD3A 1YT7A 4PI3A 4CZWA 2NQGA 5FPWA 1JQPA 2P0RA 2XU1A 3M99A 1F29A 1KXRA 5CVOB 3OF9A 5EGWA 3I06A 1NB5A 1GECE 2HD5A 4MZSA 2HH5A 3AI8A 2DJFB 2DCCA 3F5VA 4P6EA 3QT4A 1DEUA 1VJVA 4BQVA 2YJ9A 3S3QA 1KHQA 1PCIA 3CBKA 4YYRA 1CTEA 1IWDA 1U9XA 4NV8A 2AIMA 1DF0A 3TNXA 4I05A 1KHPA 2DZYA 4Q8GA 3KFQA 2HHNA 3O1GA 2ACTA 1GX3A 1TL9A 2FYEA 3BWKA 1HUCB 1PPDA 4DMXA 5F02A 4BPVA 1M6DA 2AS8A 4PP1A 1QXPA 3I3TA 2DCDA 4DMYA 2FT2A 5K16A 1PBHA 2BDZA 1EWMA 1AYWA 1W6FA 2E02A 3LFYA 1XKGA 2AVWA 1A6RA 2YJBA 2FQ9A 3C9EA 4WA6A 3OVZA 1NL6A 2VHFA 3BPFA 4QBBA 4QRVA 1AU2A 1PADA 1AYUA 4MZOA 3HHIA 1AYVA 2PREA 2JQGR 2AYOA 1Q6KA 3S3RA 3H8CA 1CQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVX A;  4W4U A;  3E1Z B;  4Q8H A;  2HXZ A;  3K9M A;  4YYW A;  3PBH A;  4N8W A;  3KSE A;  2DC8 A;  2R9F A;  5A24 A;  3DF0 A;  1MEG A;  4YYU A;  4CDE B;  4HWY A;  2WBF X;  2FO5 A;  3MHH A;  1EF7 A;  1U9V A;  1F2A A;  3BPM A;  2IBI A;  1BP4 A;  1AU3 A;  3H7D A;  1F2B A;  3ZUA A;  1KFX L;  2B1M A;  4AXM A;  6PAD A;  2P7U A;  3HWN A;  4X6H A;  1ZCM A;  3P5V A;  4QRG A;  3KX1 A;  4FIP A;  2DC9 A;  5CVN B;  1NPZ A;  2F7D A;  2E00 A;  2OP3 A;  4YVA A;  1QDQ A;  1Y08 A;  2C0Y A;  9PAP A;  1CS8 A;  4W5C A;  3BOW A;  4I04 A;  3P5W A;  3NHE A;  1GCB A;  3IV2 A;  4I07 A;  4OEM A;  3IMA A;  3N3K A;  1NB3 A;  3H6S A;  1YAL A;  2XU3 A;  4CDF B;  2DC7 A;  1SNK A;  4YV8 A;  4FK5 A;  3OF8 A;  1PPN A;  2XU4 A;  2CB5 A;  2NQD B;  3GCB A;  3IUT A;  2E03 A;  2NQI A;  3RVV A;  4BS6 A;  3QSD A;  2AYN A;  1BQI A;  1FH0 A;  4CDD B;  3IEJ A;  4QH6 A;  3QJ3 A;  1PPP A;  3H89 A;  3LXS A;  3CH2 X;  1ATK A;  2R9N A;  2PBH A;  2R9O A;  1CVZ A;  2ARY A;  4KLB A;  1THE A;  5EF4 A;  1MEM A;  1ME3 A;  2BDL A;  1U9W A;  1YK8 A;  4G54 A;  3K24 A;  1PIP A;  1AU4 A;  1MIR A;  3D6S A;  1S4V A;  4P6G A;  1O0E A;  1AIM A;  1Y4H A;  3K8U A;  1GMY A;  3IOQ A;  4XUI A;  3MTN A;  1CV8 A;  1ICF A;  2DZZ A;  1YVB A;  1EWP A;  2XU5 A;  1BGO A;  3IHP A;  2PAD A;  2FRA A;  1AU0 A;  4YYQ A;  3N4C A;  1TLO A;  1YK7 A;  4W5B A;  5JA7 A;  3PDF A;  1K3B B;  2AU1 A;  2B1N A;  4X6J A;  1NLJ A;  2F1G A;  1MDW A;  4BSQ A;  8PCH A;  4X6I A;  2JQF R;  1AEC A;  1CPJ A;  4MSX A;  1CJL A;  4RY2 A;  3PW3 A;  5CHV A;  3WXE A;  2YJ8 A;  1CSB B;  4CDC B;  3PNR A;  1U9Q X;  2G8E A;  4BS5 A;  5J94 A;  1BY8 A;  1TU6 A;  2GFO A;  2VHS A;  2R9C A;  4QRX A;  1SP4 B;  2DCA A;  3MHS A;  4XR7 A;  3KWZ A;  2FUD A;  4FJC A;  2DC6 A;  3O0U A;  3KW9 A;  5PAD A;  4N79 A;  1QOL A;  2R9M A;  2E01 A;  1GLO A;  2G6D A;  2DJG B;  2AUX A;  3ERV A;  2R6N A;  1MHW A;  2FTD A;  4PAD A;  2YJC A;  1PPO A;  2Y5B A;  1EWO A;  3WXG A;  2O6X A;  3V6E A;  3P5X A;  1CB5 A;  1ITO A;  5CHT A;  3WXF A;  7PCK A;  4K7C A;  3USV A;  3P5U A;  3U8E A;  1F2C A;  3F75 A;  2IPP B;  1POP A;  2OZ2 A;  1VSN A;  1QMY A;  1PE6 A;  3N3G A;  2PNS A;  2YJ2 A;  2DCB A;  3HHA A;  2CIO A;  1ME4 A;  1KFU L;  3CH3 X;  2G7Y A;  1MS6 A;  2OUL A;  2AUZ A;  3H8B A;  2P86 A;  2G8J A;  4PP2 E;  3KWB X;  3KKU A;  4YYS A;  4OEL A;  5JH3 A;  1ZIV A;  2NQA A;  3RVW A;  3BC3 A;  2ATO A;  3OVX A;  3CBJ A;  1NQC A;  2Y6E A;  2GHU A;  1U5I A;  1PXV A;  3V6C A;  1EWL A;  4ZUX U;  4N4Z A;  1X9Y A;  5CVM A;  4YYV A;  2H7J A;  3BCN A;  3B79 A;  3MOR A;  4AXL A;  1STF E;  2FRQ A;  3OIS A;  3HD3 A;  1YT7 A;  4PI3 A;  4CZW A;  2NQG A;  5FPW A;  1JQP A;  2P0R A;  2XU1 A;  3M99 A;  1F29 A;  1KXR A;  5CVO B;  3OF9 A;  5EGW A;  3I06 A;  1NB5 A;  1GEC E;  2HD5 A;  4MZS A;  2HH5 A;  3AI8 A;  2DJF B;  2DCC A;  3F5V A;  4P6E A;  3QT4 A;  1DEU A;  1VJV A;  4BQV A;  2YJ9 A;  3S3Q A;  1KHQ A;  1PCI A;  3CBK A;  4YYR A;  1CTE A;  1IWD A;  1U9X A;  2AIM A;  1DF0 A;  3TNX A;  4I05 A;  1KHP A;  2DZY A;  4Q8G A;  3KFQ A;  2HHN A;  3O1G A;  2ACT A;  1TL9 A;  2FYE A;  3BWK A;  1HUC B;  1PPD A;  4DMX A;  5F02 A;  4BPV A;  1M6D A;  2AS8 A;  4PP1 A;  1QXP A;  3I3T A;  2DCD A;  4DMY A;  2FT2 A;  5K16 A;  1PBH A;  2BDZ A;  1EWM A;  1AYW A;  2E02 A;  3LFY A;  1XKG A;  2AVW A;  1A6R A;  2YJB A;  2FQ9 A;  3C9E A;  4WA6 A;  3OVZ A;  1NL6 A;  2VHF A;  3BPF A;  4QBB A;  4QRV A;  1AU2 A;  1PAD A;  1AYU A;  4MZO A;  3HHI A;  1AYV A;  2PRE A;  2JQG R;  2AYO A;  1Q6K A;  3S3R A;  3H8C A;  1CQD A; 
#chains in the Genus database with same CATH topology
 3RVX A;  4W4U A;  3E1Z B;  4Q8H A;  2HXZ A;  3K9M A;  4YYW A;  3PBH A;  4BOZ A;  4N8W A;  3KSE A;  2DC8 A;  2R9F A;  5A24 A;  3DF0 A;  3PHU A;  1MEG A;  4YYU A;  3RNV A;  4CDE B;  3TRK A;  4HWY A;  2WBF X;  2FO5 A;  3MHH A;  1EF7 A;  1U9V A;  1F2A A;  3BPM A;  2IBI A;  1BP4 A;  5E6J A;  1AU3 A;  3H7D A;  1F2B A;  3ZUA A;  1KFX L;  2B1M A;  4AXM A;  6PAD A;  2P7U A;  3HWN A;  5EZS A;  4X6H A;  1ZCM A;  3P5V A;  4RKX A;  4QRG A;  3KX1 A;  4FIP A;  2DC9 A;  5CVN B;  1NPZ A;  2F7D A;  2E00 A;  2OP3 A;  4YVA A;  1QDQ A;  1Y08 A;  2C0Y A;  9PAP A;  3PRM A;  1CS8 A;  4W5C A;  3BOW A;  4I04 A;  3P5W A;  3NHE A;  1GCB A;  3IV2 A;  4I07 A;  4OEM A;  1UKF A;  2FE8 A;  3IMA A;  3N3K A;  5EZQ A;  1NB3 A;  3H6S A;  1YAL A;  2XU3 A;  4CDF B;  2DC7 A;  1SNK A;  4YV8 A;  4FK5 A;  3OF8 A;  4M0W A;  1PPN A;  2XU4 A;  2CB5 A;  2NQD B;  3GCB A;  3IUT A;  2E03 A;  2NQI A;  4D8I A;  2HWK A;  3RVV A;  4BS6 A;  3QSD A;  2AYN A;  1BQI A;  1FH0 A;  4CDD B;  3IEJ A;  4QH6 A;  3QJ3 A;  1PPP A;  3H89 A;  3LXS A;  3CH2 X;  1ATK A;  4D8E A;  2R9N A;  2PBH A;  2R9O A;  1CVZ A;  2ARY A;  4KLB A;  1THE A;  3IFU A;  5EF4 A;  3W31 A;  1MEM A;  1ME3 A;  2BDL A;  2JTC A;  1U9W A;  1YK8 A;  4G54 A;  3K24 A;  1PIP A;  3E9S A;  1AU4 A;  1MIR A;  4BOU A;  3MTV A;  3D6S A;  1S4V A;  4P6G A;  1O0E A;  4OVZ B;  1AIM A;  1Y4H A;  3K8U A;  1GMY A;  3IOQ A;  4XUI A;  3MTN A;  1CV8 A;  1ICF A;  2DZZ A;  4MI7 A;  1YVB A;  1EWP A;  2XU5 A;  1BGO A;  3IHP A;  2PAD A;  2FRA A;  1AU0 A;  4YYQ A;  3N4C A;  1TLO A;  1YK7 A;  4W5B A;  5JA7 A;  3PDF A;  3MP2 A;  1K3B B;  2AU1 A;  2B1N A;  4X6J A;  2DOS A;  1NLJ A;  2F1G A;  3ZNH A;  1MDW A;  4OVZ A;  4BSQ A;  8PCH A;  4X6I A;  2JQF R;  1AEC A;  1CPJ A;  4MSX A;  1CJL A;  4RF1 A;  5JZE A;  4RY2 A;  4ZTB A;  3PW3 A;  5CHV A;  3WXE A;  2YJ8 A;  3TMP A;  1CSB B;  4CDC B;  3PNR A;  1U9Q X;  2JRI A;  2G8E A;  4BOP A;  4BS5 A;  5J94 A;  4R3D A;  1BY8 A;  1TU6 A;  2GFO A;  2VHS A;  2R9C A;  4QRX A;  3PSE A;  1SP4 B;  4HXD B;  2DCA A;  3MHS A;  4XR7 A;  3KWZ A;  3PT2 A;  2FUD A;  4FJC A;  2DC6 A;  3B21 A;  3O0U A;  2J7Q A;  3C0R A;  3KW9 A;  5PAD A;  4N79 A;  1QOL A;  2R9M A;  2E01 A;  1DKI A;  1GLO A;  4IP3 A;  2G6D A;  2DJG B;  2AUX A;  3PHW A;  3ERV A;  2R6N A;  1MHW A;  2FTD A;  4PAD A;  2YJC A;  1PPO A;  2Y5B A;  1EWO A;  3WXG A;  4P16 A;  2O6X A;  3V6E A;  3PHX A;  3BBA A;  3P5X A;  1CB5 A;  1ITO A;  5CHT A;  3WXF A;  7PCK A;  4K7C A;  3USV A;  3P5U A;  3U8E A;  1F2C A;  3F75 A;  2IPP B;  1POP A;  2OZ2 A;  4RNA A;  1VSN A;  1QMY A;  1PE6 A;  3N3G A;  2PNS A;  2YJ2 A;  2DCB A;  3MJ5 A;  3HHA A;  2CIO A;  1ME4 A;  1KFU L;  3CH3 X;  2G7Y A;  1MS6 A;  2OUL A;  2AUZ A;  3BB7 A;  3H8B A;  2P86 A;  2G8J A;  4PP2 E;  3KWB X;  3KKU A;  4YYS A;  4OEL A;  4OW0 A;  5JH3 A;  1ZIV A;  2NQA A;  3RVW A;  3BC3 A;  2ATO A;  3OVX A;  3CBJ A;  1NQC A;  2Y6E A;  4RF0 A;  2GHU A;  1U5I A;  1PXV A;  3V6C A;  1EWL A;  4ZUX U;  4N4Z A;  4GUA A;  1X9Y A;  5CVM A;  4YYV A;  2H7J A;  3BCN A;  3B79 A;  3MOR A;  3O65 A;  4AXL A;  4IUM A;  1STF E;  2FRQ A;  3OIS A;  3HD3 A;  1YT7 A;  4PI3 A;  4CZW A;  2NQG A;  5FPW A;  1JQP A;  2P0R A;  2XU1 A;  3M99 A;  3OQC A;  1F29 A;  1KXR A;  5CVO B;  3OF9 A;  5EGW A;  3I06 A;  1NB5 A;  1GEC E;  2HD5 A;  2BTW B;  4MZS A;  5KO3 A;  2HH5 A;  3AI8 A;  2DJF B;  2DCC A;  3F5V A;  4P6E A;  3QT4 A;  1DEU A;  3BY4 A;  1VJV A;  4BQV A;  2YJ9 A;  4XZX A;  3S3Q A;  1KHQ A;  1PCI A;  3CBK A;  4YYR A;  1CTE A;  1IWD A;  1U9X A;  2AIM A;  1DF0 A;  3TNX A;  4I05 A;  1KHP A;  2DZY A;  4MM3 B;  2BTW A;  4Q8G A;  1PVJ A;  4WUR A;  3KFQ A;  2HHN A;  3O1G A;  2ACT A;  1TL9 A;  2FYE A;  3BWK A;  1HUC B;  1PPD A;  4DMX A;  5F02 A;  4BPV A;  1M6D A;  2AS8 A;  4PP1 A;  1QXP A;  3I3T A;  2DCD A;  4DMY A;  2FT2 A;  5K16 A;  1PBH A;  2AGA A;  2BDZ A;  1EWM A;  1AYW A;  2E02 A;  3LFY A;  1XKG A;  2AVW A;  1A6R A;  1YZB A;  4BOQ A;  2YJB A;  2FQ9 A;  2Z84 A;  3C9E A;  3W30 A;  4WA6 A;  4PT5 A;  2UZJ A;  3OVZ A;  1NL6 A;  2VHF A;  3BPF A;  4QBB A;  4QRV A;  1AU2 A;  1PAD A;  1AYU A;  2BU3 A;  4MZO A;  3HHI A;  1AYV A;  4REZ A;  2PRE A;  4D8B A;  2J7Q C;  2JQG R;  4BOS A;  2AYO A;  4A5U A;  1Q6K A;  3S3R A;  3PRP A;  3H8C A;  1CQD A; 
#chains in the Genus database with same CATH homology
 3RVX A;  4W4U A;  3E1Z B;  4Q8H A;  2HXZ A;  3K9M A;  4YYW A;  1W5R A;  3PBH A;  4N8W A;  3KSE A;  2DC8 A;  2R9F A;  5A24 A;  3DF0 A;  1MEG A;  4YYU A;  4CDE B;  4HWY A;  2WBF X;  2FO5 A;  3MHH A;  1EF7 A;  1U9V A;  1F2A A;  3BPM A;  2IBI A;  1BP4 A;  1AU3 A;  3H7D A;  1F2B A;  3ZUA A;  1KFX L;  2B1M A;  4AXM A;  6PAD A;  2P7U A;  3HWN A;  4X6H A;  1ZCM A;  3P5V A;  4QRG A;  3KX1 A;  4FIP A;  2DC9 A;  5CVN B;  1NPZ A;  2F7D A;  2E00 A;  2OP3 A;  4YVA A;  3LTW A;  1QDQ A;  1Y08 A;  2C0Y A;  9PAP A;  1CS8 A;  4W5C A;  3BOW A;  4I04 A;  3P5W A;  3NHE A;  1GCB A;  3IV2 A;  4I07 A;  4OEM A;  3IMA A;  3N3K A;  1NB3 A;  3H6S A;  1YAL A;  2XU3 A;  4CDF B;  2DC7 A;  1SNK A;  4YV8 A;  4FK5 A;  3OF8 A;  1PPN A;  2XU4 A;  2CB5 A;  2NQD B;  4GUZ A;  3GCB A;  3IUT A;  2E03 A;  2NQI A;  3RVV A;  4BS6 A;  3QSD A;  2AYN A;  1BQI A;  1FH0 A;  4CDD B;  3IEJ A;  4QH6 A;  3QJ3 A;  1PPP A;  3H89 A;  3LXS A;  3CH2 X;  1ATK A;  2R9N A;  2PBH A;  2R9O A;  1CVZ A;  2ARY A;  4KLB A;  1THE A;  5EF4 A;  1MEM A;  1ME3 A;  2BDL A;  1U9W A;  1YK8 A;  4G54 A;  3K24 A;  1PIP A;  1AU4 A;  1MIR A;  2VFC A;  3D6S A;  1S4V A;  4P6G A;  1O0E A;  1AIM A;  1Y4H A;  3K8U A;  4C5P A;  1GMY A;  3IOQ A;  4XUI A;  3MTN A;  1CV8 A;  1ICF A;  2DZZ A;  4BGF A;  1YVB A;  1EWP A;  2XU5 A;  1BGO A;  3IHP A;  2PAD A;  4NV7 A;  2FRA A;  1AU0 A;  4YYQ A;  3N4C A;  1TLO A;  1YK7 A;  4W5B A;  5JA7 A;  3PDF A;  1K3B B;  2AU1 A;  2B1N A;  4X6J A;  1NLJ A;  2F1G A;  1MDW A;  4BSQ A;  8PCH A;  4X6I A;  2JQF R;  1AEC A;  1CPJ A;  1E2T A;  1CJL A;  4MSX A;  4RY2 A;  3PW3 A;  5CHV A;  3WXE A;  2YJ8 A;  1CSB B;  4CDC B;  3PNR A;  1U9Q X;  2G8E A;  4BS5 A;  5J94 A;  1BY8 A;  1TU6 A;  2GFO A;  2VHS A;  2R9C A;  4QRX A;  1SP4 B;  2DCA A;  3MHS A;  4XR7 A;  3KWZ A;  2FUD A;  4FJC A;  2DC6 A;  3O0U A;  3D9W A;  3KW9 A;  5PAD A;  4N79 A;  1QOL A;  2R9M A;  2BSZ A;  2E01 A;  2VFB A;  1GLO A;  2G6D A;  2DJG B;  2AUX A;  3ERV A;  2R6N A;  1MHW A;  2FTD A;  4PAD A;  2YJC A;  1PPO A;  2Y5B A;  1EWO A;  3WXG A;  2O6X A;  3V6E A;  3P5X A;  1CB5 A;  1ITO A;  5CHT A;  3WXF A;  7PCK A;  4K7C A;  3USV A;  3P5U A;  3U8E A;  1F2C A;  3F75 A;  2IPP B;  1POP A;  2OZ2 A;  1VSN A;  1QMY A;  1PE6 A;  3N3G A;  2PNS A;  2YJ2 A;  2DCB A;  3HHA A;  2CIO A;  1ME4 A;  1KFU L;  3CH3 X;  2G7Y A;  1MS6 A;  2OUL A;  2AUZ A;  3H8B A;  2P86 A;  2G8J A;  4PP2 E;  3KWB X;  3KKU A;  4YYS A;  4OEL A;  5JH3 A;  1ZIV A;  2NQA A;  3RVW A;  3BC3 A;  2ATO A;  3OVX A;  3CBJ A;  1NQC A;  2Y6E A;  2GHU A;  1U5I A;  1PXV A;  3V6C A;  1EWL A;  4ZUX U;  4N4Z A;  1X9Y A;  5CVM A;  1W4T A;  4YYV A;  2H7J A;  3BCN A;  3B79 A;  3MOR A;  4AXL A;  4B55 A;  1STF E;  2FRQ A;  3OIS A;  3HD3 A;  1YT7 A;  4PI3 A;  4CZW A;  2NQG A;  5FPW A;  1JQP A;  2P0R A;  2XU1 A;  3M99 A;  1F29 A;  1KXR A;  5CVO B;  3OF9 A;  5EGW A;  3I06 A;  1NB5 A;  1GEC E;  2HD5 A;  4MZS A;  2HH5 A;  3AI8 A;  2DJF B;  2DCC A;  3F5V A;  4P6E A;  3QT4 A;  1DEU A;  1VJV A;  4BQV A;  2YJ9 A;  3S3Q A;  1KHQ A;  1PCI A;  3CBK A;  4YYR A;  1CTE A;  1IWD A;  1U9X A;  4NV8 A;  2AIM A;  1DF0 A;  3TNX A;  4I05 A;  1KHP A;  2DZY A;  4Q8G A;  3KFQ A;  2HHN A;  3O1G A;  2ACT A;  1GX3 A;  1TL9 A;  2FYE A;  3BWK A;  1HUC B;  1PPD A;  4DMX A;  5F02 A;  4BPV A;  1M6D A;  2AS8 A;  4PP1 A;  1QXP A;  3I3T A;  2DCD A;  4DMY A;  2FT2 A;  5K16 A;  1PBH A;  2BDZ A;  1EWM A;  1AYW A;  1W6F A;  2E02 A;  3LFY A;  1XKG A;  2AVW A;  1A6R A;  2YJB A;  2FQ9 A;  3C9E A;  4WA6 A;  3OVZ A;  1NL6 A;  2VHF A;  3BPF A;  4QBB A;  4QRV A;  1AU2 A;  1PAD A;  1AYU A;  4MZO A;  3HHI A;  1AYV A;  2PRE A;  2JQG R;  2AYO A;  1Q6K A;  3S3R A;  3H8C A;  1CQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...