3W30A

Structual basis for the recognition of ubc13 by the shigella flexneri effector ospi
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
192
structure length
192
Chain Sequence
NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ORF169b
publication title Structural Basis for the Recognition of Ubc13 by the Shigella flexneri Effector OspI.
pubmed doi rcsb
source organism Shigella flexneri
total genus 53
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3w30A00
3B21A 3W30A 4XZXA 3W31A 4IP3A
chains in the Genus database with same CATH superfamily
3V6EA 1F29A 2O6XA 3GCBA 2OULA 2DZZA 3BCNA 2DCDA 2G8JA 2B1NA 5A24A 1YK8A 1DF0A 4Q8HA 1PADA 4BS5A 3KSEA 2DC6A 2JRIA 5FPWA 1AYVA 3IEJA 3KX1A 1VSNA 4CDDB 3PBHA 2FE8A 1CTEA 3O1GA 1TLOA 2HWKA 3OVZA 3QSDA 4QRXA 4RF0A 3MP2A 2IBIA 4YV8A 4RNAA 3CBKA 3P5WA 3U8EA 4IUMA 3CH3X 1S4VA 1QDQA 1KFXL 3IV2A 1HUCB 2WBFX 3RNVA 3CH2X 3PDFA 1UKFA 9PAPA 2FQ9A 4BS6A 3S3RA 4BOQA 1KHPA 3LFYA 1GECE 3PHWA 2FT2A 4OW0A 2YJ2A 4OELA 1ZIVA 1U9WA 1YZBA 4N79A 3WXFA 2B1MA 3E1ZB 4GUAA 2E02A 2YJCA 1THEA 4BOSA 1Y08A 4YYRA 2G8EA 3MORA 2DC8A 3IMAA 5JH3A 2E01A 3MTVA 1F2AA 1POPA 2AYOA 4MI7A 2P7UA 2J7QA 3I3TA 3MHHA 4MSXA 1PVJA 4X6JA 2BTWB 4DMXA 1MEMA 1SP4B 2UZJA 3USVA 1TU6A 4BOPA 3KWBX 4PP1A 2XU4A 4BSQA 1NLJA 1VJVA 1CV8A 4D8IA 3PT2A 3WXEA 3ZUAA 2DJGB 3BOWA 5EF4A 4XZXA 3W31A 3BY4A 4MZOA 1PPNA 3O0UA 1NL6A 4OVZB 5CVMA 2VHFA 2XU5A 4X6IA 4N4ZA 3OISA 4PADA 4D8BA 4WA6A 4A5UA 4P6GA 1A6RA 5EZQA 3PNRA 1AU2A 4YYVA 3P5UA 3KWZA 1Y4HA 5PADA 1U5IA 2DJFB 1YK7A 4YYUA 4Q8GA 4ZTBA 3V6CA 2DCBA 2CB5A 2AUXA 3OVXA 2ACTA 4R3DA 4I04A 4QRGA 5K16A 4PP2E 1CVZA 1CS8A 2JQFR 2DZYA 3KKUA 4N8WA 3H89A 1EWMA 3BBAA 3QT4A 4ZUXU 2FO5A 1NB5A 3N4CA 3PW3A 2CIOA 4YYWA 2PBHA 2J7QC 6PADA 3RVXA 2IPPB 1ITOA 3IHPA 5JA7A 2BDLA 2DC9A 1ME3A 4W4UA 2FRQA 1XKGA 3HHIA 4BQVA 1AYUA 1KFUL 3WXGA 2NQGA 4BPVA 1YVBA 1CJLA 1M6DA 4FJCA 4WURA 4AXMA 1CB5A 2C0YA 2P0RA 1PPPA 1YT7A 4CZWA 1AECA 1AU4A 2DCAA 2HH5A 4P16A 3K8UA 3QJ3A 1NB3A 5CHVA 4HWYA 3HWNA 2Y5BA 3IOQA 1PBHA 3ERVA 4AXLA 2P86A 3DF0A 4X6HA 1AYWA 3TNXA 1GLOA 4MM3B 2YJ9A 3N3KA 2R9MA 5KO3A 4IP3A 1STFE 3MHSA 1ATKA 2GFOA 2HHNA 2BDZA 4I07A 1K3BB 1PIPA 2AVWA 4XUIA 1SNKA 1AIMA 3D6SA 1U9QX 3F75A 2NQAA 1QXPA 5CVOB 1NQCA 5J94A 3HD3A 2NQIA 1EWOA 3C9EA 2DOSA 3NHEA 1EWLA 1AU0A 1X9YA 1QMYA 3KFQA 3S3QA 1MEGA 5F02A 4CDCB 3PSEA 2PREA 3BB7A 1Q6KA 5E6JA 3H8BA 4RY2A 4I05A 3C0RA 1EF7A 3PRPA 1CQDA 2AYNA 4W5BA 3AI8A 1PE6A 3MJ5A 3H8CA 1F2BA 4KLBA 4YYSA 3BWKA 1ZCMA 3OF9A 2HXZA 2R6NA 3K24A 3IUTA 1U9VA 2AGAA 1CSBB 2BTWA 5CHTA 1PXVA 3MTNA 2OP3A 4RF1A 1O0EA 4FK5A 1GCBA 5EZSA 2FUDA 2F7DA 2GHUA 3B21A 2YJBA 3OF8A 3TMPA 4BOZA 2PADA 8PCHA 2FTDA 3KW9A 3P5VA 1JQPA 3HHAA 2R9OA 4PI3A 2DC7A 3H7DA 1BQIA 3IFUA 1PPDA 1TL9A 2AUZA 4CDFB 2G7YA 1KXRA 4QH6A 2AS8A 4YYQA 1FH0A 2AIMA 3PHXA 4OVZA 4DMYA 3ZNHA 3BPMA 1ME4A 4G54A 1ICFA 1QOLA 2NQDB 1CPJA 1DKIA 4YVAA 3N3GA 4QRVA 4XR7A 1KHQA 3CBJA 4K7CA 1PCIA 5EGWA 1EWPA 1MIRA 4CDEB 1BGOA 2VHSA 3OQCA 4RKXA 3M99A 3RVVA 2Y6EA 3I06A 1PPOA 2ATOA 2E03A 3TRKA 1F2CA 2BU3A 2H7JA 7PCKA 2JTCA 2XU3A 2E00A 3PRMA 2HD5A 3P5XA 1U9XA 1MHWA 1BP4A 1NPZA 1DEUA 2ARYA 4M0WA 4W5CA 2FYEA 2R9CA 4P6EA 1BY8A 3E9SA 3O65A 2OZ2A 4PT5A 3H6SA 5CVNB 4HXDB 5JZEA 2AU1A 3BC3A 1MDWA 2R9FA 2FRAA 1MS6A 3K9MA 3LXSA 3BPFA 3RVWA 2F1GA 1GMYA 2PNSA 2Z84A 3PHUA 2R9NA 1YALA 1AU3A 2G6DA 4QBBA 1IWDA 3W30A 4OEMA 3B79A 4BOUA 4MZSA 2JQGR 3F5VA 4FIPA 4D8EA 2DCCA 2XU1A 4REZA 2YJ8A
chains in the Genus database with same CATH topology
3PHXA 4D8IA 4OVZA 3ZNHA 4P16A 3PT2A 4XZXA 1DKIA 3W31A 3BY4A 4OVZB 4MM3B 5KO3A 4IP3A 4D8BA 4A5UA 2FE8A 5EZQA 2HWKA 3OQCA 4RKXA 4RF0A 3MP2A 4RNAA 4IUMA 3TRKA 2DOSA 4ZTBA 2BU3A 3RNVA 1UKFA 4BOQA 2JTCA 3PRMA 3PSEA 4R3DA 3PHWA 3BB7A 5E6JA 4M0WA 3C0RA 4OW0A 3PRPA 3E9SA 3MJ5A 3O65A 1YZBA 4PT5A 4HXDB 4GUAA 3BBAA 4BOSA 5JZEA 2AGAA 2BTWA 3MTVA 2J7QC 4RF1A 4MI7A 2J7QA 5EZSA 1PVJA 2Z84A 3B21A 3PHUA 3TMPA 4BOZA 2BTWB 2UZJA 3IFUA 4BOPA 3W30A 4WURA 4BOUA 4D8EA 4REZA 2JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B21 A;  3W30 A;  4XZX A;  3W31 A;  4IP3 A; 
#chains in the Genus database with same CATH topology
 3V6E A;  1F29 A;  2O6X A;  3GCB A;  2OUL A;  2DZZ A;  3BCN A;  2DCD A;  2G8J A;  2B1N A;  5A24 A;  1YK8 A;  1DF0 A;  4Q8H A;  1PAD A;  4BS5 A;  3KSE A;  2DC6 A;  2JRI A;  5FPW A;  1AYV A;  3IEJ A;  3KX1 A;  1VSN A;  4CDD B;  3PBH A;  2FE8 A;  1CTE A;  3O1G A;  1TLO A;  2HWK A;  3OVZ A;  3QSD A;  4QRX A;  4RF0 A;  3MP2 A;  2IBI A;  4YV8 A;  4RNA A;  3CBK A;  3P5W A;  3U8E A;  4IUM A;  3CH3 X;  1S4V A;  1QDQ A;  1KFX L;  3IV2 A;  1HUC B;  2WBF X;  3RNV A;  3CH2 X;  3PDF A;  1UKF A;  9PAP A;  2FQ9 A;  4BS6 A;  3S3R A;  4BOQ A;  1KHP A;  3LFY A;  1GEC E;  3PHW A;  2FT2 A;  4OW0 A;  2YJ2 A;  4OEL A;  1ZIV A;  1U9W A;  1YZB A;  4N79 A;  3WXF A;  2B1M A;  3E1Z B;  4GUA A;  2E02 A;  2YJC A;  1THE A;  4BOS A;  1Y08 A;  4YYR A;  2G8E A;  3MOR A;  2DC8 A;  3IMA A;  5JH3 A;  2E01 A;  3MTV A;  1F2A A;  1POP A;  2AYO A;  4MI7 A;  2P7U A;  2J7Q A;  3I3T A;  3MHH A;  4MSX A;  1PVJ A;  4X6J A;  2BTW B;  4DMX A;  1MEM A;  1SP4 B;  2UZJ A;  3USV A;  1TU6 A;  4BOP A;  3KWB X;  4PP1 A;  2XU4 A;  4BSQ A;  1NLJ A;  1VJV A;  1CV8 A;  4D8I A;  3PT2 A;  3WXE A;  3ZUA A;  2DJG B;  3BOW A;  5EF4 A;  4XZX A;  3W31 A;  3BY4 A;  4MZO A;  1PPN A;  3O0U A;  1NL6 A;  4OVZ B;  5CVM A;  2VHF A;  2XU5 A;  4X6I A;  4N4Z A;  3OIS A;  4PAD A;  4D8B A;  4WA6 A;  4A5U A;  4P6G A;  1A6R A;  5EZQ A;  3PNR A;  1AU2 A;  4YYV A;  3P5U A;  3KWZ A;  1Y4H A;  5PAD A;  1U5I A;  2DJF B;  1YK7 A;  4YYU A;  4Q8G A;  4ZTB A;  3V6C A;  2DCB A;  2CB5 A;  2AUX A;  3OVX A;  2ACT A;  4R3D A;  4I04 A;  4QRG A;  5K16 A;  4PP2 E;  1CVZ A;  1CS8 A;  2JQF R;  2DZY A;  3KKU A;  4N8W A;  3H89 A;  1EWM A;  3BBA A;  3QT4 A;  4ZUX U;  2FO5 A;  1NB5 A;  3N4C A;  3PW3 A;  2CIO A;  4YYW A;  2PBH A;  2J7Q C;  6PAD A;  3RVX A;  2IPP B;  1ITO A;  3IHP A;  5JA7 A;  2BDL A;  2DC9 A;  1ME3 A;  4W4U A;  2FRQ A;  1XKG A;  3HHI A;  4BQV A;  1AYU A;  1KFU L;  3WXG A;  2NQG A;  4BPV A;  1YVB A;  1CJL A;  1M6D A;  4FJC A;  4WUR A;  4AXM A;  1CB5 A;  2C0Y A;  2P0R A;  1PPP A;  1YT7 A;  4CZW A;  1AEC A;  1AU4 A;  2DCA A;  2HH5 A;  4P16 A;  3K8U A;  3QJ3 A;  1NB3 A;  5CHV A;  4HWY A;  3HWN A;  2Y5B A;  3IOQ A;  1PBH A;  3ERV A;  4AXL A;  2P86 A;  3DF0 A;  4X6H A;  1AYW A;  3TNX A;  1GLO A;  4MM3 B;  2YJ9 A;  3N3K A;  2R9M A;  5KO3 A;  4IP3 A;  1STF E;  3MHS A;  1ATK A;  2GFO A;  2HHN A;  2BDZ A;  4I07 A;  1K3B B;  1PIP A;  2AVW A;  4XUI A;  1SNK A;  1AIM A;  3D6S A;  1U9Q X;  3F75 A;  2NQA A;  1QXP A;  5CVO B;  1NQC A;  5J94 A;  3HD3 A;  2NQI A;  1EWO A;  3C9E A;  2DOS A;  3NHE A;  1EWL A;  1AU0 A;  1X9Y A;  1QMY A;  3KFQ A;  3S3Q A;  1MEG A;  5F02 A;  4CDC B;  3PSE A;  2PRE A;  3BB7 A;  1Q6K A;  5E6J A;  3H8B A;  4RY2 A;  4I05 A;  3C0R A;  1EF7 A;  3PRP A;  1CQD A;  2AYN A;  4W5B A;  3AI8 A;  1PE6 A;  3MJ5 A;  3H8C A;  1F2B A;  4KLB A;  4YYS A;  3BWK A;  1ZCM A;  3OF9 A;  2HXZ A;  2R6N A;  3K24 A;  3IUT A;  1U9V A;  2AGA A;  1CSB B;  2BTW A;  5CHT A;  1PXV A;  3MTN A;  2OP3 A;  4RF1 A;  1O0E A;  4FK5 A;  1GCB A;  5EZS A;  2FUD A;  2F7D A;  2GHU A;  3B21 A;  2YJB A;  3OF8 A;  3TMP A;  4BOZ A;  2PAD A;  8PCH A;  2FTD A;  3KW9 A;  3P5V A;  1JQP A;  3HHA A;  2R9O A;  4PI3 A;  2DC7 A;  3H7D A;  1BQI A;  3IFU A;  1PPD A;  1TL9 A;  2AUZ A;  4CDF B;  2G7Y A;  1KXR A;  4QH6 A;  2AS8 A;  4YYQ A;  1FH0 A;  2AIM A;  3PHX A;  4OVZ A;  4DMY A;  3ZNH A;  3BPM A;  1ME4 A;  4G54 A;  1ICF A;  1QOL A;  2NQD B;  1CPJ A;  1DKI A;  4YVA A;  3N3G A;  4QRV A;  4XR7 A;  1KHQ A;  3CBJ A;  4K7C A;  1PCI A;  5EGW A;  1EWP A;  1MIR A;  4CDE B;  1BGO A;  2VHS A;  3OQC A;  4RKX A;  3M99 A;  3RVV A;  2Y6E A;  3I06 A;  1PPO A;  2ATO A;  2E03 A;  3TRK A;  1F2C A;  2BU3 A;  2H7J A;  7PCK A;  2JTC A;  2XU3 A;  2E00 A;  3PRM A;  2HD5 A;  3P5X A;  1U9X A;  1MHW A;  1BP4 A;  1NPZ A;  1DEU A;  2ARY A;  4M0W A;  4W5C A;  2FYE A;  2R9C A;  4P6E A;  1BY8 A;  3E9S A;  3O65 A;  2OZ2 A;  4PT5 A;  3H6S A;  5CVN B;  4HXD B;  5JZE A;  2AU1 A;  3BC3 A;  1MDW A;  2R9F A;  2FRA A;  1MS6 A;  3K9M A;  3LXS A;  3BPF A;  3RVW A;  2F1G A;  1GMY A;  2PNS A;  2Z84 A;  3PHU A;  2R9N A;  1YAL A;  1AU3 A;  2G6D A;  4QBB A;  1IWD A;  3W30 A;  4OEM A;  3B79 A;  4BOU A;  4MZS A;  2JQG R;  3F5V A;  4FIP A;  4D8E A;  2DCC A;  2XU1 A;  4REZ A;  2YJ8 A; 
#chains in the Genus database with same CATH homology
 3PHX A;  4D8I A;  4OVZ A;  3ZNH A;  4P16 A;  3PT2 A;  4XZX A;  1DKI A;  3W31 A;  3BY4 A;  4OVZ B;  4MM3 B;  5KO3 A;  4IP3 A;  4D8B A;  4A5U A;  2FE8 A;  5EZQ A;  2HWK A;  3OQC A;  4RKX A;  4RF0 A;  3MP2 A;  4RNA A;  4IUM A;  3TRK A;  2DOS A;  4ZTB A;  2BU3 A;  3RNV A;  1UKF A;  4BOQ A;  2JTC A;  3PRM A;  3PSE A;  4R3D A;  3PHW A;  3BB7 A;  5E6J A;  4M0W A;  3C0R A;  4OW0 A;  3PRP A;  3E9S A;  3MJ5 A;  3O65 A;  1YZB A;  4PT5 A;  4HXD B;  4GUA A;  3BBA A;  4BOS A;  5JZE A;  2AGA A;  2BTW A;  3MTV A;  2J7Q C;  4RF1 A;  4MI7 A;  2J7Q A;  5EZS A;  1PVJ A;  2Z84 A;  3B21 A;  3PHU A;  3TMP A;  4BOZ A;  2BTW B;  2UZJ A;  3IFU A;  4BOP A;  3W30 A;  4WUR A;  4BOU A;  4D8E A;  4REZ A;  2JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...