3W30A

Structual basis for the recognition of ubc13 by the shigella flexneri effector ospi
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
192
structure length
192
Chain Sequence
b'NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title Structural Basis for the Recognition of Ubc13 by the Shigella flexneri Effector OspI.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Immune system
total genus 53
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3w30A00
4XZXA 3B21A 3W30A 4IP3A 3W31A
chains in the Genus database with same CATH superfamily
4BOQA 4OEMA 3QSDA 2HD5A 2F7DA 1MEGA 3H8CA 2AIMA 1CQDA 5CHTA 2IPPB 2ARYA 1CPJA 4YYVA 2R9CA 1BGOA 3PRPA 3V6EA 3KWZA 3W31A 1QMYA 3KSEA 5CVNB 4I07A 3KFQA 1KFXL 1FH0A 1AECA 3DF0A 2FQ9A 1K3BB 2FTDA 2YJ9A 2DJGB 2P7UA 4HXDB 2DC7A 1AU2A 1DEUA 4D8EA 2CIOA 4K7CA 4KLBA 3LXSA 4HWYA 4QRGA 2BDLA 2BU3A 2B1MA 3P5UA 2PNSA 2FT2A 1YK7A 3F5VA 2J7QA 4QBBA 3BB7A 4YYSA 1NLJA 4RNAA 1MHWA 1STFE 2JTCA 3WXEA 1MS6A 1YALA 1ZIVA 4YV8A 1NB5A 4I05A 1GMYA 3K24A 2DC8A 3HHIA 2NQIA 9PAPA 1YT7A 4ZUXU 3CH2X 2YJCA 1ICFA 3NHEA 1Q6KA 3IEJA 2ATOA 3IOQA 3PDFA 4OVZA 5EGWA 2P0RA 3IHPA 3KWBX 1CTEA 4BS5A 2HWKA 1AU4A 1KHQA 3ZNHA 3ERVA 3MP2A 1TLOA 1PPPA 4DMYA 1GLOA 2J7QC 2OP3A 3S3QA 1CSBB 4WURA 1QOLA 1AYUA 5JZEA 4W5CA 1YVBA 2XU4A 2PREA 4RF1A 1PADA 2XU1A 3CBKA 3W30A 4GUAA 1CB5A 1NL6A 2DC9A 2C0YA 2DCCA 2F1GA 4BOPA 3MJ5A 3P5VA 2IBIA 2H7JA 1EWPA 3B21A 3PRMA 4PP2E 2E00A 1QDQA 2WBFX 4P16A 3CH3X 4FJCA 3I06A 3B79A 2AUZA 2E01A 1KFUL 1M6DA 1A6RA 3BCNA 5EZQA 4CDEB 4X6IA 5EF4A 5J94A 4AXMA 2GHUA 4PP1A 2OULA 1AYWA 2NQGA 3USVA 4XUIA 3H7DA 3KW9A 1F2BA 2UZJA 3OQCA 3MORA 2FYEA 3ZUAA 4Q8HA 5KO3A 4N4ZA 4N79A 1VSNA 3IUTA 1DF0A 4DMXA 1TL9A 4G54A 3H8BA 3RVXA 4OVZB 5CVOB 3AI8A 2FRQA 4RY2A 1F29A 1JQPA 2JRIA 1F2CA 5JA7A 2ACTA 1PPNA 3E1ZB 4BQVA 2AUXA 3N4CA 1ME3A 4ZTBA 4BS6A 4W4UA 4BOSA 4MSXA 3MHHA 1Y4HA 2R9NA 3BC3A 1O0EA 2PADA 3MHSA 2E02A 2HH5A 5FPWA 3BOWA 3K8UA 2AYNA 4CZWA 1PIPA 3HHAA 3PSEA 3HD3A 1PPOA 1MEMA 2HXZA 5EZSA 2G8EA 4BSQA 4CDFB 3LFYA 1ATKA 1KXRA 1SP4B 4YYWA 4MZSA 2AS8A 1S4VA 1Y08A 4BOUA 1XKGA 2P86A 1AYVA 2JQGR 3BBAA 4IUMA 3K9MA 5K16A 1MDWA 1BQIA 1EWMA 2FRAA 1NB3A 1EWOA 4MZOA 3KKUA 4IP3A 2YJBA 4PT5A 4I04A 4QRXA 3OF8A 2G8JA 2Y6EA 2G7YA 3BWKA 4D8IA 1NQCA 3N3GA 2E03A 1CS8A 2YJ8A 3E9SA 3M99A 4XR7A 2R9OA 5JH3A 2FE8A 3BPMA 3C0RA 3I3TA 1AU0A 2AGAA 2GFOA 2DCAA 3TMPA 2AYOA 3GCBA 4AXLA 2AU1A 4CDDB 4MI7A 1BY8A 3PNRA 1CVZA 4BPVA 2FO5A 2OZ2A 3IFUA 3D6SA 2DOSA 3PW3A 3KX1A 1QXPA 2VHFA 3PT2A 3C9EA 4CDCB 2BTWB 2XU5A 3OF9A 2R9FA 2R6NA 1YK8A 1GECE 2CB5A 3PBHA 3RNVA 1ME4A 5E6JA 1X9YA 3RVVA 4WA6A 7PCKA 3PHXA 1F2AA 1U9VA 3RVWA 1AIMA 2DZYA 1U5IA 1PXVA 1GCBA 1U9XA 3CBJA 4M0WA 5PADA 2DCBA 2BDZA 1U9WA 4P6EA 4N8WA 1PCIA 1YZBA 4W5BA 2HHNA 1POPA 3QT4A 2BTWA 1VJVA 3WXGA 3OVXA 3MTVA 2B1NA 1CV8A 3IMAA 1U9QX 1UKFA 2FUDA 2Z84A 4P6GA 4FIPA 5F02A 1KHPA 3S3RA 3O1GA 1ZCMA 3U8EA 3IV2A 1SNKA 4PADA 4OELA 4X6JA 1PE6A 4YVAA 4FK5A 2XU3A 4X6HA 5A24A 3TNXA 1DKIA 2DJFB 2PBHA 2VHSA 1TU6A 4Q8GA 3TRKA 5CVMA 4YYRA 2NQAA 2JQFR 1HUCB 3F75A 4PI3A 1BP4A 1CJLA 1PBHA 4YYQA 4BOZA 1ITOA 4QRVA 2DZZA 1EWLA 3MTNA 4OW0A 4RF0A 3QJ3A 3H6SA 4YYUA 2Y5BA 2AVWA 1EF7A 3V6CA 4R3DA 3P5WA 4XZXA 2O6XA 3O0UA 4D8BA 3HWNA 3OVZA 2YJ2A 3BPFA 3H89A 4A5UA 3PHWA 4REZA 3P5XA 3BY4A 4QH6A 4MM3B 5CHVA 1AU3A 2DC6A 2DCDA 3OISA 4RKXA 6PADA 8PCHA 1IWDA 3WXFA 3PHUA 1MIRA 2R9MA 2G6DA 1PVJA 3O65A 1THEA 3N3KA 2NQDB 1NPZA 1PPDA
chains in the Genus database with same CATH topology
4RF1A 4BOQA 2BTWA 3W30A 4BOUA 3MTVA 4GUAA 3BBAA 4IUMA 1UKFA 2Z84A 4BOPA 3MJ5A 3B21A 3PRMA 3PRPA 4P16A 3W31A 4IP3A 4PT5A 4D8IA 5EZQA 1DKIA 3E9SA 4HXDB 2FE8A 4D8EA 3TRKA 3C0RA 2AGAA 3TMPA 2BU3A 4MI7A 2UZJA 3OQCA 2J7QA 4BOZA 3BB7A 5KO3A 3IFUA 2DOSA 4RNAA 4OW0A 4RF0A 3PT2A 2JTCA 2BTWB 4OVZB 4R3DA 4XZXA 4D8BA 4A5UA 3RNVA 2JRIA 3PHWA 5E6JA 4REZA 3BY4A 3PHXA 4OVZA 4MM3B 4ZTBA 4BOSA 2HWKA 4RKXA 3ZNHA 3PHUA 3MP2A 4M0WA 3PSEA 2J7QC 1PVJA 3O65A 4WURA 5JZEA 5EZSA 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZX A;  3B21 A;  3W30 A;  4IP3 A;  3W31 A; 
#chains in the Genus database with same CATH topology
 4BOQ A;  4OEM A;  3QSD A;  2HD5 A;  2F7D A;  1MEG A;  3H8C A;  2AIM A;  1CQD A;  5CHT A;  2IPP B;  2ARY A;  1CPJ A;  4YYV A;  2R9C A;  1BGO A;  3PRP A;  3V6E A;  3KWZ A;  3W31 A;  1QMY A;  3KSE A;  5CVN B;  4I07 A;  3KFQ A;  1KFX L;  1FH0 A;  1AEC A;  3DF0 A;  2FQ9 A;  1K3B B;  2FTD A;  2YJ9 A;  2DJG B;  2P7U A;  4HXD B;  2DC7 A;  1AU2 A;  1DEU A;  4D8E A;  2CIO A;  4K7C A;  4KLB A;  3LXS A;  4HWY A;  4QRG A;  2BDL A;  2BU3 A;  2B1M A;  3P5U A;  2PNS A;  2FT2 A;  1YK7 A;  3F5V A;  2J7Q A;  4QBB A;  3BB7 A;  4YYS A;  1NLJ A;  4RNA A;  1MHW A;  1STF E;  2JTC A;  3WXE A;  1MS6 A;  1YAL A;  1ZIV A;  4YV8 A;  1NB5 A;  4I05 A;  1GMY A;  3K24 A;  2DC8 A;  3HHI A;  2NQI A;  9PAP A;  1YT7 A;  4ZUX U;  3CH2 X;  2YJC A;  1ICF A;  3NHE A;  1Q6K A;  3IEJ A;  2ATO A;  3IOQ A;  3PDF A;  4OVZ A;  5EGW A;  2P0R A;  3IHP A;  3KWB X;  1CTE A;  4BS5 A;  2HWK A;  1AU4 A;  1KHQ A;  3ZNH A;  3ERV A;  3MP2 A;  1TLO A;  1PPP A;  4DMY A;  1GLO A;  2J7Q C;  2OP3 A;  3S3Q A;  1CSB B;  4WUR A;  1QOL A;  1AYU A;  5JZE A;  4W5C A;  1YVB A;  2XU4 A;  2PRE A;  4RF1 A;  1PAD A;  2XU1 A;  3CBK A;  3W30 A;  4GUA A;  1CB5 A;  1NL6 A;  2DC9 A;  2C0Y A;  2DCC A;  2F1G A;  4BOP A;  3MJ5 A;  3P5V A;  2IBI A;  2H7J A;  1EWP A;  3B21 A;  3PRM A;  4PP2 E;  2E00 A;  1QDQ A;  2WBF X;  4P16 A;  3CH3 X;  4FJC A;  3I06 A;  3B79 A;  2AUZ A;  2E01 A;  1KFU L;  1M6D A;  1A6R A;  3BCN A;  5EZQ A;  4CDE B;  4X6I A;  5EF4 A;  5J94 A;  4AXM A;  2GHU A;  4PP1 A;  2OUL A;  1AYW A;  2NQG A;  3USV A;  4XUI A;  3H7D A;  3KW9 A;  1F2B A;  2UZJ A;  3OQC A;  3MOR A;  2FYE A;  3ZUA A;  4Q8H A;  5KO3 A;  4N4Z A;  4N79 A;  1VSN A;  3IUT A;  1DF0 A;  4DMX A;  1TL9 A;  4G54 A;  3H8B A;  3RVX A;  4OVZ B;  5CVO B;  3AI8 A;  2FRQ A;  4RY2 A;  1F29 A;  1JQP A;  2JRI A;  1F2C A;  5JA7 A;  2ACT A;  1PPN A;  3E1Z B;  4BQV A;  2AUX A;  3N4C A;  1ME3 A;  4ZTB A;  4BS6 A;  4W4U A;  4BOS A;  4MSX A;  3MHH A;  1Y4H A;  2R9N A;  3BC3 A;  1O0E A;  2PAD A;  3MHS A;  2E02 A;  2HH5 A;  5FPW A;  3BOW A;  3K8U A;  2AYN A;  4CZW A;  1PIP A;  3HHA A;  3PSE A;  3HD3 A;  1PPO A;  1MEM A;  2HXZ A;  5EZS A;  2G8E A;  4BSQ A;  4CDF B;  3LFY A;  1ATK A;  1KXR A;  1SP4 B;  4YYW A;  4MZS A;  2AS8 A;  1S4V A;  1Y08 A;  4BOU A;  1XKG A;  2P86 A;  1AYV A;  2JQG R;  3BBA A;  4IUM A;  3K9M A;  5K16 A;  1MDW A;  1BQI A;  1EWM A;  2FRA A;  1NB3 A;  1EWO A;  4MZO A;  3KKU A;  4IP3 A;  2YJB A;  4PT5 A;  4I04 A;  4QRX A;  3OF8 A;  2G8J A;  2Y6E A;  2G7Y A;  3BWK A;  4D8I A;  1NQC A;  3N3G A;  2E03 A;  1CS8 A;  2YJ8 A;  3E9S A;  3M99 A;  4XR7 A;  2R9O A;  5JH3 A;  2FE8 A;  3BPM A;  3C0R A;  3I3T A;  1AU0 A;  2AGA A;  2GFO A;  2DCA A;  3TMP A;  2AYO A;  3GCB A;  4AXL A;  2AU1 A;  4CDD B;  4MI7 A;  1BY8 A;  3PNR A;  1CVZ A;  4BPV A;  2FO5 A;  2OZ2 A;  3IFU A;  3D6S A;  2DOS A;  3PW3 A;  3KX1 A;  1QXP A;  2VHF A;  3PT2 A;  3C9E A;  4CDC B;  2BTW B;  2XU5 A;  3OF9 A;  2R9F A;  2R6N A;  1YK8 A;  1GEC E;  2CB5 A;  3PBH A;  3RNV A;  1ME4 A;  5E6J A;  1X9Y A;  3RVV A;  4WA6 A;  7PCK A;  3PHX A;  1F2A A;  1U9V A;  3RVW A;  1AIM A;  2DZY A;  1U5I A;  1PXV A;  1GCB A;  1U9X A;  3CBJ A;  4M0W A;  5PAD A;  2DCB A;  2BDZ A;  1U9W A;  4P6E A;  4N8W A;  1PCI A;  1YZB A;  4W5B A;  2HHN A;  1POP A;  3QT4 A;  2BTW A;  1VJV A;  3WXG A;  3OVX A;  3MTV A;  2B1N A;  1CV8 A;  3IMA A;  1U9Q X;  1UKF A;  2FUD A;  2Z84 A;  4P6G A;  4FIP A;  5F02 A;  1KHP A;  3S3R A;  3O1G A;  1ZCM A;  3U8E A;  3IV2 A;  1SNK A;  4PAD A;  4OEL A;  4X6J A;  1PE6 A;  4YVA A;  4FK5 A;  2XU3 A;  4X6H A;  5A24 A;  3TNX A;  1DKI A;  2DJF B;  2PBH A;  2VHS A;  1TU6 A;  4Q8G A;  3TRK A;  5CVM A;  4YYR A;  2NQA A;  2JQF R;  1HUC B;  3F75 A;  4PI3 A;  1BP4 A;  1CJL A;  1PBH A;  4YYQ A;  4BOZ A;  1ITO A;  4QRV A;  2DZZ A;  1EWL A;  3MTN A;  4OW0 A;  4RF0 A;  3QJ3 A;  3H6S A;  4YYU A;  2Y5B A;  2AVW A;  1EF7 A;  3V6C A;  4R3D A;  3P5W A;  4XZX A;  2O6X A;  3O0U A;  4D8B A;  3HWN A;  3OVZ A;  2YJ2 A;  3BPF A;  3H89 A;  4A5U A;  3PHW A;  4REZ A;  3P5X A;  3BY4 A;  4QH6 A;  4MM3 B;  5CHV A;  1AU3 A;  2DC6 A;  2DCD A;  3OIS A;  4RKX A;  6PAD A;  8PCH A;  1IWD A;  3WXF A;  3PHU A;  1MIR A;  2R9M A;  2G6D A;  1PVJ A;  3O65 A;  1THE A;  3N3K A;  2NQD B;  1NPZ A;  1PPD A; 
#chains in the Genus database with same CATH homology
 4RF1 A;  4BOQ A;  2BTW A;  3W30 A;  4BOU A;  3MTV A;  4GUA A;  3BBA A;  4IUM A;  1UKF A;  2Z84 A;  4BOP A;  3MJ5 A;  3B21 A;  3PRM A;  3PRP A;  4P16 A;  3W31 A;  4IP3 A;  4PT5 A;  4D8I A;  5EZQ A;  1DKI A;  3E9S A;  4HXD B;  2FE8 A;  4D8E A;  3TRK A;  3C0R A;  2AGA A;  3TMP A;  2BU3 A;  4MI7 A;  2UZJ A;  3OQC A;  2J7Q A;  4BOZ A;  3BB7 A;  5KO3 A;  3IFU A;  2DOS A;  4RNA A;  4OW0 A;  4RF0 A;  3PT2 A;  2JTC A;  2BTW B;  4OVZ B;  4R3D A;  4XZX A;  4D8B A;  4A5U A;  3RNV A;  2JRI A;  3PHW A;  5E6J A;  4REZ A;  3BY4 A;  3PHX A;  4OVZ A;  4MM3 B;  4ZTB A;  4BOS A;  2HWK A;  4RKX A;  3ZNH A;  3PHU A;  3MP2 A;  4M0W A;  3PSE A;  2J7Q C;  1PVJ A;  3O65 A;  4WUR A;  5JZE A;  5EZS A;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...