3W30A

Structual basis for the recognition of ubc13 by the shigella flexneri effector ospi
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
192
structure length
192
Chain Sequence
NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNASGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title Structural Basis for the Recognition of Ubc13 by the Shigella flexneri Effector OspI.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Immune system
total genus 53
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3w30A00
4XZXA 3W30A 3B21A 3W31A 4IP3A
chains in the Genus database with same CATH superfamily
2UZJA 1PVJA 3DF0A 2JQFR 6PADA 2NQIA 1A6RA 4MM3B 3QJ3A 4OW0A 4PI3A 4YYWA 1ITOA 1PIPA 2H7JA 2PNSA 1GCBA 1Y08A 1CJLA 3RVWA 3QT4A 4QRXA 1YVBA 2E02A 1KHQA 1GLOA 2DZYA 3HHIA 1ME4A 4OEMA 1YT7A 3RNVA 1NPZA 1U9XA 2HXZA 1STFE 1F2BA 1QMYA 2JRIA 3I06A 3WXGA 3D6SA 4XUIA 4M0WA 3OQCA 3BOWA 1PBHA 4YYVA 2OP3A 1PXVA 2BDLA 1DKIA 1U5IA 4I04A 4YYRA 2P86A 3TNXA 2C0YA 3BB7A 5CVMA 1HUCB 1CB5A 4FIPA 2Z84A 4YVAA 3K9MA 2DC8A 2HHNA 1U9VA 2BU3A 4A5UA 2HH5A 7PCKA 2ARYA 2J7QA 2DCCA 3B21A 3N4CA 4GUAA 1XKGA 2ATOA 1PADA 3E9SA 3RVVA 4MZOA 4D8IA 1EWLA 2R6NA 1BQIA 2XU1A 3O65A 2DCAA 2G8EA 1S4VA 3C0RA 3PRMA 1ZCMA 4BQVA 4BOQA 1BY8A 3IV2A 1CPJA 4ZUXU 3LFYA 1IWDA 3H7DA 1NB3A 9PAPA 1U9WA 1QDQA 4BOPA 2VHSA 1AYVA 2AUXA 1QOLA 2YJBA 3WXEA 4IUMA 2AVWA 4BPVA 1CTEA 4YV8A 4PADA 3W30A 2R9MA 2E03A 1MEGA 3U8EA 2AS8A 2PBHA 3N3KA 2FTDA 1AU2A 3BPMA 2CB5A 2XU5A 2R9NA 4IP3A 1ME3A 1TL9A 4BS5A 2HD5A 3IHPA 2WBFX 2NQDB 4WA6A 4K7CA 2HWKA 3CH3X 4YYQA 3KWZA 2YJ9A 3NHEA 4DMYA 3H8BA 3LXSA 2FYEA 3MTVA 1M6DA 4D8EA 1KXRA 4FJCA 5EGWA 4DMXA 8PCHA 4W5CA 2DCDA 3OISA 2FE8A 3PNRA 1ATKA 3PW3A 2XU3A 3IUTA 1THEA 4RF0A 3OVXA 2BTWB 3TRKA 1GECE 2O6XA 3OVZA 2E01A 3ZUAA 5EF4A 3KWBX 2DC9A 4AXMA 1NLJA 4CDEB 4OVZB 1CVZA 1ICFA 3BWKA 4BOSA 1FH0A 4X6IA 1AU4A 1AYWA 2FO5A 2OULA 1Q6KA 3B79A 3PHXA 4CDDB 4CDCB 1EF7A 1MDWA 1DF0A 1YALA 5CVOB 1AECA 4BS6A 1K3BB 4W4UA 1QXPA 4QBBA 2PREA 2CIOA 1CV8A 3F75A 1VSNA 3KKUA 3CBJA 3MORA 4RNAA 1TU6A 3IFUA 3KW9A 4N79A 3MTNA 5J94A 1CQDA 4X6HA 4X6JA 2IPPB 1F2CA 3H8CA 4HXDB 3KX1A 1DEUA 3RVXA 1U9QX 3P5XA 3C9EA 3P5UA 1BGOA 3N3GA 3S3QA 3O0UA 5F02A 5EZSA 2AGAA 3TMPA 1GMYA 1AU3A 4MZSA 1MEMA 3F5VA 1AU0A 3MHHA 1F2AA 3PHUA 4KLBA 3PHWA 1MIRA 2JQGR 3HHAA 3AI8A 1NL6A 2FRQA 1KHPA 2AIMA 2DOSA 3K24A 1NQCA 2B1MA 1PPDA 2R9FA 4W5BA 4P16A 4QH6A 3BCNA 3O1GA 1X9YA 1CSBB 2G7YA 4XZXA 1PE6A 1EWPA 4P6EA 4BOUA 3BBAA 2YJCA 1F29A 3M99A 1O0EA 2E00A 2Y6EA 4N8WA 2BTWA 4D8BA 4PP2E 2BDZA 3PSEA 4REZA 1YK7A 2PADA 4QRGA 2FRAA 2G8JA 3KFQA 1SNKA 3MP2A 2Y5BA 4OVZA 1ZIVA 2AYNA 4Q8GA 2P0RA 3H89A 2DJFB 1AIMA 3ZNHA 3I3TA 1SP4B 2OZ2A 3BPFA 2DZZA 5CHTA 2NQGA 3KSEA 3BY4A 5CVNB 4QRVA 4PP1A 3IMAA 4N4ZA 5JZEA 1PPOA 2DJGB 3HD3A 1YK8A 4AXLA 2GFOA 1VJVA 5E6JA 2AUZA 4P6GA 3GCBA 5JA7A 4BOZA 1MHWA 1PPPA 3CH2X 3OF9A 1MS6A 5PADA 2AYOA 2R9OA 4I05A 2GHUA 2R9CA 1KFUL 3P5WA 3QSDA 3P5VA 5EZQA 2F1GA 2NQAA 3WXFA 4RKXA 5JH3A 1NB5A 1POPA 4RY2A 3MJ5A 3BC3A 2XU4A 2F7DA 3IOQA 1EWMA 3CBKA 2JTCA 4R3DA 4OELA 3IEJA 2FT2A 3ERVA 4HWYA 3V6CA 4Q8HA 4BSQA 1BP4A 4CDFB 4FK5A 3V6EA 4CZWA 3PT2A 2AU1A 3K8UA 4RF1A 5A24A 1UKFA 1Y4HA 3OF8A 4MI7A 2B1NA 4PT5A 3E1ZB 2IBIA 2VHFA 2YJ8A 4MSXA 5KO3A 2DCBA 1EWOA 2G6DA 3S3RA 3H6SA 3PBHA 2DC6A 3PDFA 5K16A 3USVA 1CS8A 2FUDA 4G54A 3MHSA 4I07A 2YJ2A 1JQPA 3W31A 4ZTBA 5FPWA 3PRPA 1PCIA 1YZBA 1PPNA 2FQ9A 1TLOA 4YYSA 2J7QC 1AYUA 4YYUA 2P7UA 2DC7A 2ACTA 5CHVA 4WURA 4XR7A 1KFXL 3HWNA
chains in the Genus database with same CATH topology
4IUMA 2UZJA 4BOZA 1PVJA 4HXDB 3W30A 4MM3B 4OW0A 5EZSA 2AGAA 3TMPA 4IP3A 5EZQA 4RKXA 3PHUA 3MJ5A 3PHWA 2JTCA 4R3DA 2HWKA 3RNVA 2DOSA 3MTVA 4D8EA 2FE8A 2JRIA 4P16A 4M0WA 4XZXA 3OQCA 3PT2A 1DKIA 4RF0A 4RF1A 4BOUA 3BBAA 1UKFA 2BTWB 3TRKA 3BB7A 4MI7A 2BTWA 2Z84A 4D8BA 3PSEA 4PT5A 4REZA 5KO3A 2BU3A 4A5UA 4OVZB 3MP2A 4OVZA 2J7QA 4BOSA 3B21A 4GUAA 3PHXA 3E9SA 4D8IA 3O65A 3C0RA 3PRMA 3ZNHA 4BOQA 3W31A 4ZTBA 3PRPA 1YZBA 3BY4A 2J7QC 5JZEA 4WURA 4RNAA 4BOPA 3IFUA 5E6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZX A;  3W30 A;  3B21 A;  3W31 A;  4IP3 A; 
#chains in the Genus database with same CATH topology
 2UZJ A;  1PVJ A;  3DF0 A;  2JQF R;  6PAD A;  2NQI A;  1A6R A;  4MM3 B;  3QJ3 A;  4OW0 A;  4PI3 A;  4YYW A;  1ITO A;  1PIP A;  2H7J A;  2PNS A;  1GCB A;  1Y08 A;  1CJL A;  3RVW A;  3QT4 A;  4QRX A;  1YVB A;  2E02 A;  1KHQ A;  1GLO A;  2DZY A;  3HHI A;  1ME4 A;  4OEM A;  1YT7 A;  3RNV A;  1NPZ A;  1U9X A;  2HXZ A;  1STF E;  1F2B A;  1QMY A;  2JRI A;  3I06 A;  3WXG A;  3D6S A;  4XUI A;  4M0W A;  3OQC A;  3BOW A;  1PBH A;  4YYV A;  2OP3 A;  1PXV A;  2BDL A;  1DKI A;  1U5I A;  4I04 A;  4YYR A;  2P86 A;  3TNX A;  2C0Y A;  3BB7 A;  5CVM A;  1HUC B;  1CB5 A;  4FIP A;  2Z84 A;  4YVA A;  3K9M A;  2DC8 A;  2HHN A;  1U9V A;  2BU3 A;  4A5U A;  2HH5 A;  7PCK A;  2ARY A;  2J7Q A;  2DCC A;  3B21 A;  3N4C A;  4GUA A;  1XKG A;  2ATO A;  1PAD A;  3E9S A;  3RVV A;  4MZO A;  4D8I A;  1EWL A;  2R6N A;  1BQI A;  2XU1 A;  3O65 A;  2DCA A;  2G8E A;  1S4V A;  3C0R A;  3PRM A;  1ZCM A;  4BQV A;  4BOQ A;  1BY8 A;  3IV2 A;  1CPJ A;  4ZUX U;  3LFY A;  1IWD A;  3H7D A;  1NB3 A;  9PAP A;  1U9W A;  1QDQ A;  4BOP A;  2VHS A;  1AYV A;  2AUX A;  1QOL A;  2YJB A;  3WXE A;  4IUM A;  2AVW A;  4BPV A;  1CTE A;  4YV8 A;  4PAD A;  3W30 A;  2R9M A;  2E03 A;  1MEG A;  3U8E A;  2AS8 A;  2PBH A;  3N3K A;  2FTD A;  1AU2 A;  3BPM A;  2CB5 A;  2XU5 A;  2R9N A;  4IP3 A;  1ME3 A;  1TL9 A;  4BS5 A;  2HD5 A;  3IHP A;  2WBF X;  2NQD B;  4WA6 A;  4K7C A;  2HWK A;  3CH3 X;  4YYQ A;  3KWZ A;  2YJ9 A;  3NHE A;  4DMY A;  3H8B A;  3LXS A;  2FYE A;  3MTV A;  1M6D A;  4D8E A;  1KXR A;  4FJC A;  5EGW A;  4DMX A;  8PCH A;  4W5C A;  2DCD A;  3OIS A;  2FE8 A;  3PNR A;  1ATK A;  3PW3 A;  2XU3 A;  3IUT A;  1THE A;  4RF0 A;  3OVX A;  2BTW B;  3TRK A;  1GEC E;  2O6X A;  3OVZ A;  2E01 A;  3ZUA A;  5EF4 A;  3KWB X;  2DC9 A;  4AXM A;  1NLJ A;  4CDE B;  4OVZ B;  1CVZ A;  1ICF A;  3BWK A;  4BOS A;  1FH0 A;  4X6I A;  1AU4 A;  1AYW A;  2FO5 A;  2OUL A;  1Q6K A;  3B79 A;  3PHX A;  4CDD B;  4CDC B;  1EF7 A;  1MDW A;  1DF0 A;  1YAL A;  5CVO B;  1AEC A;  4BS6 A;  1K3B B;  4W4U A;  1QXP A;  4QBB A;  2PRE A;  2CIO A;  1CV8 A;  3F75 A;  1VSN A;  3KKU A;  3CBJ A;  3MOR A;  4RNA A;  1TU6 A;  3IFU A;  3KW9 A;  4N79 A;  3MTN A;  5J94 A;  1CQD A;  4X6H A;  4X6J A;  2IPP B;  1F2C A;  3H8C A;  4HXD B;  3KX1 A;  1DEU A;  3RVX A;  1U9Q X;  3P5X A;  3C9E A;  3P5U A;  1BGO A;  3N3G A;  3S3Q A;  3O0U A;  5F02 A;  5EZS A;  2AGA A;  3TMP A;  1GMY A;  1AU3 A;  4MZS A;  1MEM A;  3F5V A;  1AU0 A;  3MHH A;  1F2A A;  3PHU A;  4KLB A;  3PHW A;  1MIR A;  2JQG R;  3HHA A;  3AI8 A;  1NL6 A;  2FRQ A;  1KHP A;  2AIM A;  2DOS A;  3K24 A;  1NQC A;  2B1M A;  1PPD A;  2R9F A;  4W5B A;  4P16 A;  4QH6 A;  3BCN A;  3O1G A;  1X9Y A;  1CSB B;  2G7Y A;  4XZX A;  1PE6 A;  1EWP A;  4P6E A;  4BOU A;  3BBA A;  2YJC A;  1F29 A;  3M99 A;  1O0E A;  2E00 A;  2Y6E A;  4N8W A;  2BTW A;  4D8B A;  4PP2 E;  2BDZ A;  3PSE A;  4REZ A;  1YK7 A;  2PAD A;  4QRG A;  2FRA A;  2G8J A;  3KFQ A;  1SNK A;  3MP2 A;  2Y5B A;  4OVZ A;  1ZIV A;  2AYN A;  4Q8G A;  2P0R A;  3H89 A;  2DJF B;  1AIM A;  3ZNH A;  3I3T A;  1SP4 B;  2OZ2 A;  3BPF A;  2DZZ A;  5CHT A;  2NQG A;  3KSE A;  3BY4 A;  5CVN B;  4QRV A;  4PP1 A;  3IMA A;  4N4Z A;  5JZE A;  1PPO A;  2DJG B;  3HD3 A;  1YK8 A;  4AXL A;  2GFO A;  1VJV A;  5E6J A;  2AUZ A;  4P6G A;  3GCB A;  5JA7 A;  4BOZ A;  1MHW A;  1PPP A;  3CH2 X;  3OF9 A;  1MS6 A;  5PAD A;  2AYO A;  2R9O A;  4I05 A;  2GHU A;  2R9C A;  1KFU L;  3P5W A;  3QSD A;  3P5V A;  5EZQ A;  2F1G A;  2NQA A;  3WXF A;  4RKX A;  5JH3 A;  1NB5 A;  1POP A;  4RY2 A;  3MJ5 A;  3BC3 A;  2XU4 A;  2F7D A;  3IOQ A;  1EWM A;  3CBK A;  2JTC A;  4R3D A;  4OEL A;  3IEJ A;  2FT2 A;  3ERV A;  4HWY A;  3V6C A;  4Q8H A;  4BSQ A;  1BP4 A;  4CDF B;  4FK5 A;  3V6E A;  4CZW A;  3PT2 A;  2AU1 A;  3K8U A;  4RF1 A;  5A24 A;  1UKF A;  1Y4H A;  3OF8 A;  4MI7 A;  2B1N A;  4PT5 A;  3E1Z B;  2IBI A;  2VHF A;  2YJ8 A;  4MSX A;  5KO3 A;  2DCB A;  1EWO A;  2G6D A;  3S3R A;  3H6S A;  3PBH A;  2DC6 A;  3PDF A;  5K16 A;  3USV A;  1CS8 A;  2FUD A;  4G54 A;  3MHS A;  4I07 A;  2YJ2 A;  1JQP A;  3W31 A;  4ZTB A;  5FPW A;  3PRP A;  1PCI A;  1YZB A;  1PPN A;  2FQ9 A;  1TLO A;  4YYS A;  2J7Q C;  1AYU A;  4YYU A;  2P7U A;  2DC7 A;  2ACT A;  5CHV A;  4WUR A;  4XR7 A;  1KFX L;  3HWN A; 
#chains in the Genus database with same CATH homology
 4IUM A;  2UZJ A;  4BOZ A;  1PVJ A;  4HXD B;  3W30 A;  4MM3 B;  4OW0 A;  5EZS A;  2AGA A;  3TMP A;  4IP3 A;  5EZQ A;  4RKX A;  3PHU A;  3MJ5 A;  3PHW A;  2JTC A;  4R3D A;  2HWK A;  3RNV A;  2DOS A;  3MTV A;  4D8E A;  2FE8 A;  2JRI A;  4P16 A;  4M0W A;  4XZX A;  3OQC A;  3PT2 A;  1DKI A;  4RF0 A;  4RF1 A;  4BOU A;  3BBA A;  1UKF A;  2BTW B;  3TRK A;  3BB7 A;  4MI7 A;  2BTW A;  2Z84 A;  4D8B A;  3PSE A;  4PT5 A;  4REZ A;  5KO3 A;  2BU3 A;  4A5U A;  4OVZ B;  3MP2 A;  4OVZ A;  2J7Q A;  4BOS A;  3B21 A;  4GUA A;  3PHX A;  3E9S A;  4D8I A;  3O65 A;  3C0R A;  3PRM A;  3ZNH A;  4BOQ A;  3W31 A;  4ZTB A;  3PRP A;  1YZB A;  3BY4 A;  2J7Q C;  5JZE A;  4WUR A;  4RNA A;  4BOP A;  3IFU A;  5E6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...