4W5CA

Crystal structure analysis of cruzain with three fragments: 1 (n-(1h-benzimidazol-2-yl)-1,3-dimethyl-pyrazole-4-carboxamide), 6 (2-amino-4,6-difluorobenzothiazole) and 9 (n-(1h-benzimidazol-2-yl)-3-(4-fluorophenyl)-1h-pyrazole-4-carboxamide).
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSSWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Applying Fragments Based- Drug Design to identify multiple binding modes on cysteine protease.
rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4w5cA00
1PADA 2CIOA 3S3QA 2R9MA 3KWBX 4QH6A 1AECA 1GMYA 2G8EA 2R6NA 3CBKA 1U9XA 2HXZA 4FIPA 3HHIA 1MEMA 1SNKA 3OF9A 3WXGA 1VSNA 2PREA 3OVZA 4W4UA 3F5VA 4P6EA 2AU1A 3D6SA 3BCNA 1VJVA 1O0EA 3MHHA 1IWDA 1STFE 4I07A 3CH3X 1CSBB 3PDFA 3V6EA 3PNRA 1GECE 4BSQA 2R9NA 2NQIA 1PPNA 3AI8A 3BPFA 1KFXL 4YYSA 2GFOA 1QXPA 4Q8GA 2G8JA 1CTEA 2AIMA 3IUTA 1MHWA 4W5CA 3OF8A 3USVA 1BY8A 1YT7A 3B79A 4OELA 1QOLA 2YJCA 4X6IA 3QJ3A 2DCCA 1AU4A 4CDDB 2XU4A 4G54A 2CB5A 2VHSA 2NQAA 1F2CA 4YYRA 4YV8A 1GLOA 3IOQA 2P86A 1YK8A 1POPA 1DEUA 2XU5A 4P6GA 1ZIVA 2NQGA 1EF7A 2C0YA 1ME3A 5CVNB 1M6DA 1EWMA 3IMAA 1PE6A 4QRXA 1MS6A 3MHSA 1NB3A 3KFQA 3PW3A 1EWOA 1U5IA 1CPJA 3KSEA 1PCIA 2PADA 3N4CA 4YVAA 1TL9A 4YYQA 1F2AA 3KKUA 3M99A 2FRAA 3KW9A 2HD5A 4CDFB 2FO5A 1MDWA 1AU2A 2OULA 3ERVA 1CQDA 4PP1A 1TU6A 3IHPA 5EGWA 5K16A 2FT2A 4PI3A 4RY2A 5CVOB 2H7JA 1MIRA 2B1MA 5JA7A 2PNSA 4X6JA 4N79A 4BPVA 1YVBA 2AYOA 4FK5A 2IBIA 1THEA 1CB5A 2G6DA 3CBJA 3P5XA 3WXFA 4BS6A 3H8BA 3HHAA 1K3BB 1AIMA 2DCBA 3BWKA 2YJ8A 3O1GA 3H7DA 3QT4A 4YYUA 4OEMA 1QDQA 4N4ZA 2FQ9A 2DC6A 2DJGB 1MEGA 2ATOA 2G7YA 3H8CA 1PIPA 3BOWA 1PPPA 1QMYA 4Q8HA 1ZCMA 4W5BA 2DCDA 5F02A 1YALA 4K7CA 3V6CA 1CS8A 5FPWA 4CDCB 1NQCA 1PPOA 1BQIA 5CHVA 3IV2A 4MZOA 1Y4HA 2P0RA 5CVMA 4BS5A 8PCHA 2AYNA 3PBHA 1F2BA 1KHPA 3IEJA 2WBFX 3ZUAA 4BQVA 1CVZA 2DZZA 2R9CA 4YYVA 3N3GA 1NPZA 3MORA 1AYUA 2E02A 3TNXA 1KFUL 1NB5A 1AU0A 2YJ2A 3E1ZB 3RVWA 1CJLA 3RVXA 1EWPA 3MTNA 1U9WA 1PPDA 2DC9A 4MZSA 4MSXA 7PCKA 1XKGA 2R9FA 2NQDB 1A6RA 4AXMA 1ME4A 3OVXA 1TLOA 1SP4B 1BGOA 3K9MA 2F7DA 1DF0A 3BC3A 1AYVA 2DC8A 2XU1A 2AS8A 2DZYA 3CH2X 3QSDA 3C9EA 3P5VA 2O6XA 3H89A 2FYEA 2XU3A 1PBHA 4PP2E 3LFYA 2F1GA 2Y6EA 3P5UA 1U9QX 2JQGR 4CDEB 2BDLA 4I04A 2HHNA 2AVWA 4DMYA 1S4VA 2BDZA 4QBBA 3I3TA 3KWZA 5PADA 1Y08A 1F29A 2FUDA 3H6SA 3F75A 2E03A 1KHQA 1ICFA 2JQFR 4HWYA 2E00A 5JH3A 1FH0A 3K8UA 4FJCA 3HD3A 4KLBA 1CV8A 2FTDA 1NLJA 2E01A 4XR7A 2R9OA 4ZUXU 6PADA 2YJ9A 1Q6KA 2ARYA 4I05A 1NL6A 4AXLA 2GHUA 4X6HA 2AUZA 2DCAA 3OISA 1AYWA 2YJBA 3RVVA 3K24A 3P5WA 4QRGA 3WXEA 4YYWA 2DJFB 2OZ2A 2HH5A 4N8WA 2B1NA 3NHEA 1EWLA 1KXRA 3GCBA 2VHFA 2ACTA 4PADA 1PXVA 5EF4A 2PBHA 1X9YA 2FRQA 1JQPA 3BPMA 1U9VA 1GCBA 1ATKA 5CHTA 1ITOA 4QRVA 4DMXA 3U8EA 2DC7A 3O0UA 5A24A 2OP3A 2IPPB 4XUIA 3LXSA 1AU3A 5J94A 2AUXA 3I06A 4CZWA 2Y5BA 1YK7A 2P7UA 3N3KA 3HWNA 1BP4A 3S3RA 9PAPA 3KX1A 3DF0A 4WA6A 1HUCB
chains in the Genus database with same CATH superfamily
1PADA 2CIOA 3S3QA 2R9MA 3KWBX 4QH6A 1AECA 1GMYA 3W31A 2G8EA 2UZJA 2R6NA 3E9SA 4MM3B 3CBKA 1U9XA 2HXZA 4FIPA 3HHIA 1MEMA 1SNKA 3OF9A 3WXGA 1VSNA 2PREA 3OVZA 4REZA 4W4UA 3F5VA 4P6EA 2AU1A 3D6SA 3BCNA 4IP3A 3PHUA 1VJVA 1O0EA 3MHHA 1IWDA 1STFE 4I07A 3CH3X 1CSBB 3PDFA 3V6EA 3PNRA 4BOPA 1GECE 4BSQA 2R9NA 2NQIA 1PPNA 3AI8A 4OVZB 3BPFA 1KFXL 2JRIA 4YYSA 2GFOA 1QXPA 4Q8GA 2G8JA 1CTEA 2AIMA 3IUTA 1MHWA 4W5CA 3OF8A 3USVA 1BY8A 1YT7A 3B79A 4OELA 3PHWA 3C0RA 1QOLA 2YJCA 4X6IA 3QJ3A 2DCCA 1AU4A 4CDDB 2XU4A 4OVZA 4G54A 2Z84A 2CB5A 2VHSA 2NQAA 1F2CA 4YYRA 4YV8A 1GLOA 3PRPA 3IOQA 4M0WA 2P86A 4GUAA 1YK8A 1POPA 3MP2A 3B21A 1DEUA 2XU5A 4P6GA 1ZIVA 2NQGA 1EF7A 2C0YA 1ME3A 5CVNB 1M6DA 1EWMA 3IMAA 1PE6A 4QRXA 3TRKA 1MS6A 3MHSA 1NB3A 3KFQA 3PW3A 1EWOA 1U5IA 1CPJA 3KSEA 1PCIA 2PADA 3N4CA 4YVAA 1TL9A 4YYQA 1F2AA 3KKUA 3M99A 2FRAA 3KW9A 2HD5A 4CDFB 3BY4A 2JTCA 2FO5A 1MDWA 1AU2A 2OULA 3ERVA 1CQDA 4PP1A 4PT5A 1TU6A 3PRMA 3IHPA 4MI7A 5EGWA 5K16A 2FT2A 3BBAA 2FE8A 4PI3A 4RY2A 4D8BA 5CVOB 2H7JA 1MIRA 2B1MA 3BB7A 5JA7A 2PNSA 4X6JA 4A5UA 4N79A 1YZBA 4BPVA 1YVBA 2AYOA 4FK5A 2IBIA 5EZQA 1THEA 1CB5A 2G6DA 3CBJA 3P5XA 3WXFA 4BS6A 3H8BA 3HHAA 1K3BB 3PSEA 1AIMA 2DCBA 3BWKA 2YJ8A 3O1GA 3H7DA 3QT4A 4ZTBA 4XZXA 4YYUA 4OEMA 1QDQA 4N4ZA 2FQ9A 2BTWB 2DC6A 2DJGB 1MEGA 2ATOA 2G7YA 3H8CA 1PIPA 3BOWA 1PPPA 1QMYA 4Q8HA 5JZEA 1ZCMA 4W5BA 2DCDA 5F02A 1YALA 4K7CA 3V6CA 1CS8A 5FPWA 4CDCB 1NQCA 4HXDB 2J7QA 2BTWA 1PPOA 1BQIA 5CHVA 3PHXA 3IV2A 4MZOA 1Y4HA 2P0RA 3IFUA 5CVMA 4BS5A 8PCHA 2AYNA 4RKXA 3PBHA 1F2BA 1KHPA 3MTVA 3IEJA 2WBFX 5EZSA 4P16A 3ZUAA 4BQVA 1CVZA 2DZZA 2R9CA 3RNVA 4YYVA 3N3GA 1NPZA 3MORA 1AYUA 2E02A 3PT2A 3TNXA 1KFUL 1NB5A 1AU0A 3OQCA 2YJ2A 3E1ZB 3RVWA 1CJLA 3RVXA 4RF1A 1EWPA 3MTNA 1U9WA 1PPDA 2DC9A 4MZSA 4MSXA 7PCKA 1XKGA 2R9FA 2NQDB 1A6RA 4RF0A 4AXMA 1ME4A 4R3DA 3OVXA 1TLOA 1UKFA 1SP4B 4BOQA 1BGOA 3K9MA 3ZNHA 2BU3A 2F7DA 2AGAA 1DF0A 3BC3A 1AYVA 2DC8A 2XU1A 2AS8A 2DZYA 3CH2X 3QSDA 3C9EA 3O65A 3P5VA 2O6XA 3H89A 2FYEA 2XU3A 1DKIA 1PBHA 4PP2E 4WURA 3LFYA 2F1GA 2Y6EA 3P5UA 1U9QX 2JQGR 4CDEB 2BDLA 4I04A 2HHNA 2AVWA 4DMYA 1S4VA 4BOSA 2BDZA 4QBBA 3I3TA 3KWZA 5PADA 1Y08A 1F29A 2FUDA 3H6SA 3F75A 2E03A 4D8EA 1KHQA 1ICFA 2JQFR 4HWYA 2E00A 5JH3A 4BOZA 1FH0A 3K8UA 4FJCA 3HD3A 4KLBA 1CV8A 2FTDA 1NLJA 2E01A 4XR7A 2R9OA 1PVJA 4ZUXU 6PADA 2YJ9A 1Q6KA 2ARYA 4I05A 1NL6A 4AXLA 2GHUA 4OW0A 4X6HA 2AUZA 2DCAA 3OISA 1AYWA 2YJBA 4D8IA 3RVVA 3K24A 3P5WA 4QRGA 3WXEA 4YYWA 2DJFB 2OZ2A 2HH5A 4N8WA 4BOUA 2B1NA 3NHEA 1EWLA 1KXRA 3GCBA 2VHFA 4RNAA 2ACTA 4PADA 1PXVA 5EF4A 3TMPA 2PBHA 3W30A 1X9YA 2FRQA 1JQPA 3BPMA 1U9VA 1GCBA 2J7QC 1ATKA 5CHTA 1ITOA 4QRVA 4DMXA 3U8EA 2DC7A 5E6JA 3O0UA 5A24A 3MJ5A 2OP3A 2DOSA 2IPPB 4XUIA 3LXSA 1AU3A 5J94A 4IUMA 2AUXA 3I06A 2HWKA 2Y5BA 4CZWA 1YK7A 2P7UA 3N3KA 3HWNA 1BP4A 3S3RA 9PAPA 3KX1A 5KO3A 3DF0A 4WA6A 1HUCB
chains in the Genus database with same CATH topology
1PADA 2CIOA 4GUZA 3S3QA 2R9MA 3KWBX 4QH6A 1AECA 1GMYA 2G8EA 2R6NA 3CBKA 1U9XA 2HXZA 4FIPA 3HHIA 1MEMA 1SNKA 3OF9A 3WXGA 1VSNA 2PREA 3OVZA 4W4UA 3F5VA 4P6EA 2AU1A 1GX3A 3D6SA 3BCNA 1VJVA 1O0EA 3MHHA 1E2TA 1IWDA 1STFE 4I07A 3CH3X 1CSBB 3PDFA 3V6EA 3PNRA 1GECE 4BSQA 2R9NA 2NQIA 1PPNA 3AI8A 3BPFA 1KFXL 4YYSA 2GFOA 1QXPA 4Q8GA 2G8JA 1CTEA 2AIMA 3IUTA 1MHWA 4W5CA 3OF8A 3USVA 1BY8A 1YT7A 3B79A 4OELA 1QOLA 2YJCA 4X6IA 3QJ3A 4NV8A 2DCCA 1AU4A 4CDDB 2XU4A 4G54A 2CB5A 2VHSA 2NQAA 1F2CA 4YYRA 4YV8A 1GLOA 2VFCA 3IOQA 2P86A 1YK8A 1POPA 1DEUA 2XU5A 4P6GA 1ZIVA 2NQGA 1EF7A 2C0YA 1ME3A 5CVNB 1M6DA 1EWMA 3IMAA 1PE6A 4QRXA 1MS6A 3MHSA 1NB3A 3KFQA 3PW3A 1EWOA 1U5IA 1CPJA 3KSEA 1PCIA 2PADA 3N4CA 4YVAA 1TL9A 4YYQA 1F2AA 3KKUA 3M99A 2FRAA 3KW9A 2HD5A 4CDFB 2FO5A 1MDWA 1AU2A 2OULA 3ERVA 1CQDA 4PP1A 1TU6A 3IHPA 4NV7A 5EGWA 5K16A 2FT2A 4PI3A 4RY2A 5CVOB 2H7JA 1MIRA 2B1MA 5JA7A 2PNSA 4X6JA 4N79A 1W5RA 4BPVA 1YVBA 2AYOA 3LTWA 4FK5A 2IBIA 1THEA 1CB5A 2G6DA 3CBJA 3P5XA 3WXFA 4BS6A 3H8BA 3HHAA 1K3BB 1AIMA 2DCBA 3BWKA 2YJ8A 3O1GA 3H7DA 3QT4A 4YYUA 4OEMA 1QDQA 4N4ZA 2FQ9A 2DC6A 2DJGB 1MEGA 2ATOA 2G7YA 3H8CA 1PIPA 3BOWA 1PPPA 1QMYA 4Q8HA 1ZCMA 4W5BA 2DCDA 5F02A 1YALA 4K7CA 3V6CA 1CS8A 5FPWA 4CDCB 1NQCA 1PPOA 1BQIA 5CHVA 3IV2A 4MZOA 1Y4HA 2P0RA 5CVMA 4BS5A 8PCHA 2AYNA 3PBHA 1F2BA 1KHPA 3IEJA 2WBFX 3ZUAA 4BQVA 1CVZA 2DZZA 2R9CA 4YYVA 3N3GA 1NPZA 3MORA 1AYUA 2E02A 3TNXA 1KFUL 1NB5A 1AU0A 2YJ2A 3E1ZB 3RVWA 1CJLA 3RVXA 3D9WA 1EWPA 3MTNA 1U9WA 4C5PA 1PPDA 2DC9A 4MZSA 4MSXA 7PCKA 1XKGA 2R9FA 2NQDB 1A6RA 4AXMA 1ME4A 3OVXA 1TLOA 1SP4B 1BGOA 3K9MA 2F7DA 1DF0A 3BC3A 1AYVA 2DC8A 2XU1A 2AS8A 2DZYA 3CH2X 3QSDA 3C9EA 3P5VA 2O6XA 3H89A 2FYEA 2XU3A 1PBHA 4PP2E 3LFYA 2F1GA 2Y6EA 3P5UA 1U9QX 2JQGR 4CDEB 2BDLA 4I04A 4BGFA 2HHNA 2AVWA 4DMYA 2BSZA 1W6FA 2VFBA 1S4VA 2BDZA 4QBBA 3I3TA 3KWZA 5PADA 1Y08A 1F29A 2FUDA 3H6SA 3F75A 2E03A 1KHQA 1ICFA 2JQFR 4HWYA 2E00A 5JH3A 1FH0A 3K8UA 4FJCA 3HD3A 4KLBA 1CV8A 2FTDA 1NLJA 2E01A 4XR7A 2R9OA 4ZUXU 6PADA 2YJ9A 1Q6KA 2ARYA 4I05A 1NL6A 4AXLA 2GHUA 4X6HA 2AUZA 2DCAA 3OISA 1AYWA 2YJBA 3RVVA 3K24A 3P5WA 4QRGA 3WXEA 4YYWA 2DJFB 2OZ2A 2HH5A 4N8WA 2B1NA 3NHEA 1EWLA 1KXRA 3GCBA 2VHFA 2ACTA 4PADA 1PXVA 5EF4A 2PBHA 1X9YA 2FRQA 1JQPA 3BPMA 1U9VA 4B55A 1W4TA 1GCBA 1ATKA 5CHTA 1ITOA 4QRVA 4DMXA 3U8EA 2DC7A 3O0UA 5A24A 2OP3A 2IPPB 4XUIA 3LXSA 1AU3A 5J94A 2AUXA 3I06A 4CZWA 2Y5BA 1YK7A 2P7UA 3N3KA 3HWNA 1BP4A 3S3RA 9PAPA 3KX1A 3DF0A 4WA6A 1HUCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAD A;  2CIO A;  3S3Q A;  2R9M A;  3KWB X;  4QH6 A;  1AEC A;  1GMY A;  2G8E A;  2R6N A;  3CBK A;  1U9X A;  2HXZ A;  4FIP A;  3HHI A;  1MEM A;  1SNK A;  3OF9 A;  3WXG A;  1VSN A;  2PRE A;  3OVZ A;  4W4U A;  3F5V A;  4P6E A;  2AU1 A;  3D6S A;  3BCN A;  1VJV A;  1O0E A;  3MHH A;  1IWD A;  1STF E;  4I07 A;  3CH3 X;  1CSB B;  3PDF A;  3V6E A;  3PNR A;  1GEC E;  4BSQ A;  2R9N A;  2NQI A;  1PPN A;  3AI8 A;  3BPF A;  1KFX L;  4YYS A;  2GFO A;  1QXP A;  4Q8G A;  2G8J A;  1CTE A;  2AIM A;  3IUT A;  1MHW A;  4W5C A;  3OF8 A;  3USV A;  1BY8 A;  1YT7 A;  3B79 A;  4OEL A;  1QOL A;  2YJC A;  4X6I A;  3QJ3 A;  2DCC A;  1AU4 A;  4CDD B;  2XU4 A;  4G54 A;  2CB5 A;  2VHS A;  2NQA A;  1F2C A;  4YYR A;  4YV8 A;  1GLO A;  3IOQ A;  2P86 A;  1YK8 A;  1POP A;  1DEU A;  2XU5 A;  4P6G A;  1ZIV A;  2NQG A;  1EF7 A;  2C0Y A;  1ME3 A;  5CVN B;  1M6D A;  1EWM A;  3IMA A;  1PE6 A;  4QRX A;  1MS6 A;  3MHS A;  1NB3 A;  3KFQ A;  3PW3 A;  1EWO A;  1U5I A;  1CPJ A;  3KSE A;  1PCI A;  2PAD A;  3N4C A;  4YVA A;  1TL9 A;  4YYQ A;  1F2A A;  3KKU A;  3M99 A;  2FRA A;  3KW9 A;  2HD5 A;  4CDF B;  2FO5 A;  1MDW A;  1AU2 A;  2OUL A;  3ERV A;  1CQD A;  4PP1 A;  1TU6 A;  3IHP A;  5EGW A;  5K16 A;  2FT2 A;  4PI3 A;  4RY2 A;  5CVO B;  2H7J A;  1MIR A;  2B1M A;  5JA7 A;  2PNS A;  4X6J A;  4N79 A;  4BPV A;  1YVB A;  2AYO A;  4FK5 A;  2IBI A;  1THE A;  1CB5 A;  2G6D A;  3CBJ A;  3P5X A;  3WXF A;  4BS6 A;  3H8B A;  3HHA A;  1K3B B;  1AIM A;  2DCB A;  3BWK A;  2YJ8 A;  3O1G A;  3H7D A;  3QT4 A;  4YYU A;  4OEM A;  1QDQ A;  4N4Z A;  2FQ9 A;  2DC6 A;  2DJG B;  1MEG A;  2ATO A;  2G7Y A;  3H8C A;  1PIP A;  3BOW A;  1PPP A;  1QMY A;  4Q8H A;  1ZCM A;  4W5B A;  2DCD A;  5F02 A;  1YAL A;  4K7C A;  3V6C A;  1CS8 A;  5FPW A;  4CDC B;  1NQC A;  1PPO A;  1BQI A;  5CHV A;  3IV2 A;  4MZO A;  1Y4H A;  2P0R A;  5CVM A;  4BS5 A;  8PCH A;  2AYN A;  3PBH A;  1F2B A;  1KHP A;  3IEJ A;  2WBF X;  3ZUA A;  4BQV A;  1CVZ A;  2DZZ A;  2R9C A;  4YYV A;  3N3G A;  1NPZ A;  3MOR A;  1AYU A;  2E02 A;  3TNX A;  1KFU L;  1NB5 A;  1AU0 A;  2YJ2 A;  3E1Z B;  3RVW A;  1CJL A;  3RVX A;  1EWP A;  3MTN A;  1U9W A;  1PPD A;  2DC9 A;  4MZS A;  4MSX A;  7PCK A;  1XKG A;  2R9F A;  2NQD B;  1A6R A;  4AXM A;  1ME4 A;  3OVX A;  1TLO A;  1SP4 B;  1BGO A;  3K9M A;  2F7D A;  1DF0 A;  3BC3 A;  1AYV A;  2DC8 A;  2XU1 A;  2AS8 A;  2DZY A;  3CH2 X;  3QSD A;  3C9E A;  3P5V A;  2O6X A;  3H89 A;  2FYE A;  2XU3 A;  1PBH A;  4PP2 E;  3LFY A;  2F1G A;  2Y6E A;  3P5U A;  1U9Q X;  2JQG R;  4CDE B;  2BDL A;  4I04 A;  2HHN A;  2AVW A;  4DMY A;  1S4V A;  2BDZ A;  4QBB A;  3I3T A;  3KWZ A;  5PAD A;  1Y08 A;  1F29 A;  2FUD A;  3H6S A;  3F75 A;  2E03 A;  1KHQ A;  1ICF A;  2JQF R;  4HWY A;  2E00 A;  5JH3 A;  1FH0 A;  3K8U A;  4FJC A;  3HD3 A;  4KLB A;  1CV8 A;  2FTD A;  1NLJ A;  2E01 A;  4XR7 A;  2R9O A;  4ZUX U;  6PAD A;  2YJ9 A;  1Q6K A;  2ARY A;  4I05 A;  1NL6 A;  4AXL A;  2GHU A;  4X6H A;  2AUZ A;  2DCA A;  3OIS A;  1AYW A;  2YJB A;  3RVV A;  3K24 A;  3P5W A;  4QRG A;  3WXE A;  4YYW A;  2DJF B;  2OZ2 A;  2HH5 A;  4N8W A;  2B1N A;  3NHE A;  1EWL A;  1KXR A;  3GCB A;  2VHF A;  2ACT A;  4PAD A;  1PXV A;  5EF4 A;  2PBH A;  1X9Y A;  2FRQ A;  1JQP A;  3BPM A;  1U9V A;  1GCB A;  1ATK A;  5CHT A;  1ITO A;  4QRV A;  4DMX A;  3U8E A;  2DC7 A;  3O0U A;  5A24 A;  2OP3 A;  2IPP B;  4XUI A;  3LXS A;  1AU3 A;  5J94 A;  2AUX A;  3I06 A;  4CZW A;  2Y5B A;  1YK7 A;  2P7U A;  3N3K A;  3HWN A;  1BP4 A;  3S3R A;  9PAP A;  3KX1 A;  3DF0 A;  4WA6 A;  1HUC B; 
#chains in the Genus database with same CATH topology
 1PAD A;  2CIO A;  3S3Q A;  2R9M A;  3KWB X;  4QH6 A;  1AEC A;  1GMY A;  3W31 A;  2G8E A;  2UZJ A;  2R6N A;  3E9S A;  4MM3 B;  3CBK A;  1U9X A;  2HXZ A;  4FIP A;  3HHI A;  1MEM A;  1SNK A;  3OF9 A;  3WXG A;  1VSN A;  2PRE A;  3OVZ A;  4REZ A;  4W4U A;  3F5V A;  4P6E A;  2AU1 A;  3D6S A;  3BCN A;  4IP3 A;  3PHU A;  1VJV A;  1O0E A;  3MHH A;  1IWD A;  1STF E;  4I07 A;  3CH3 X;  1CSB B;  3PDF A;  3V6E A;  3PNR A;  4BOP A;  1GEC E;  4BSQ A;  2R9N A;  2NQI A;  1PPN A;  3AI8 A;  4OVZ B;  3BPF A;  1KFX L;  2JRI A;  4YYS A;  2GFO A;  1QXP A;  4Q8G A;  2G8J A;  1CTE A;  2AIM A;  3IUT A;  1MHW A;  4W5C A;  3OF8 A;  3USV A;  1BY8 A;  1YT7 A;  3B79 A;  4OEL A;  3PHW A;  3C0R A;  1QOL A;  2YJC A;  4X6I A;  3QJ3 A;  2DCC A;  1AU4 A;  4CDD B;  2XU4 A;  4OVZ A;  4G54 A;  2Z84 A;  2CB5 A;  2VHS A;  2NQA A;  1F2C A;  4YYR A;  4YV8 A;  1GLO A;  3PRP A;  3IOQ A;  4M0W A;  2P86 A;  4GUA A;  1YK8 A;  1POP A;  3MP2 A;  3B21 A;  1DEU A;  2XU5 A;  4P6G A;  1ZIV A;  2NQG A;  1EF7 A;  2C0Y A;  1ME3 A;  5CVN B;  1M6D A;  1EWM A;  3IMA A;  1PE6 A;  4QRX A;  3TRK A;  1MS6 A;  3MHS A;  1NB3 A;  3KFQ A;  3PW3 A;  1EWO A;  1U5I A;  1CPJ A;  3KSE A;  1PCI A;  2PAD A;  3N4C A;  4YVA A;  1TL9 A;  4YYQ A;  1F2A A;  3KKU A;  3M99 A;  2FRA A;  3KW9 A;  2HD5 A;  4CDF B;  3BY4 A;  2JTC A;  2FO5 A;  1MDW A;  1AU2 A;  2OUL A;  3ERV A;  1CQD A;  4PP1 A;  4PT5 A;  1TU6 A;  3PRM A;  3IHP A;  4MI7 A;  5EGW A;  5K16 A;  2FT2 A;  3BBA A;  2FE8 A;  4PI3 A;  4RY2 A;  4D8B A;  5CVO B;  2H7J A;  1MIR A;  2B1M A;  3BB7 A;  5JA7 A;  2PNS A;  4X6J A;  4A5U A;  4N79 A;  1YZB A;  4BPV A;  1YVB A;  2AYO A;  4FK5 A;  2IBI A;  5EZQ A;  1THE A;  1CB5 A;  2G6D A;  3CBJ A;  3P5X A;  3WXF A;  4BS6 A;  3H8B A;  3HHA A;  1K3B B;  3PSE A;  1AIM A;  2DCB A;  3BWK A;  2YJ8 A;  3O1G A;  3H7D A;  3QT4 A;  4ZTB A;  4XZX A;  4YYU A;  4OEM A;  1QDQ A;  4N4Z A;  2FQ9 A;  2BTW B;  2DC6 A;  2DJG B;  1MEG A;  2ATO A;  2G7Y A;  3H8C A;  1PIP A;  3BOW A;  1PPP A;  1QMY A;  4Q8H A;  5JZE A;  1ZCM A;  4W5B A;  2DCD A;  5F02 A;  1YAL A;  4K7C A;  3V6C A;  1CS8 A;  5FPW A;  4CDC B;  1NQC A;  4HXD B;  2J7Q A;  2BTW A;  1PPO A;  1BQI A;  5CHV A;  3PHX A;  3IV2 A;  4MZO A;  1Y4H A;  2P0R A;  3IFU A;  5CVM A;  4BS5 A;  8PCH A;  2AYN A;  4RKX A;  3PBH A;  1F2B A;  1KHP A;  3MTV A;  3IEJ A;  2WBF X;  5EZS A;  4P16 A;  3ZUA A;  4BQV A;  1CVZ A;  2DZZ A;  2R9C A;  3RNV A;  4YYV A;  3N3G A;  1NPZ A;  3MOR A;  1AYU A;  2E02 A;  3PT2 A;  3TNX A;  1KFU L;  1NB5 A;  1AU0 A;  3OQC A;  2YJ2 A;  3E1Z B;  3RVW A;  1CJL A;  3RVX A;  4RF1 A;  1EWP A;  3MTN A;  1U9W A;  1PPD A;  2DC9 A;  4MZS A;  4MSX A;  7PCK A;  1XKG A;  2R9F A;  2NQD B;  1A6R A;  4RF0 A;  4AXM A;  1ME4 A;  4R3D A;  3OVX A;  1TLO A;  1UKF A;  1SP4 B;  4BOQ A;  1BGO A;  3K9M A;  3ZNH A;  2BU3 A;  2F7D A;  2AGA A;  1DF0 A;  3BC3 A;  1AYV A;  2DC8 A;  2XU1 A;  2AS8 A;  2DZY A;  3CH2 X;  3QSD A;  3C9E A;  3O65 A;  3P5V A;  2O6X A;  3H89 A;  2FYE A;  2XU3 A;  1DKI A;  1PBH A;  4PP2 E;  4WUR A;  3LFY A;  2F1G A;  2Y6E A;  3P5U A;  1U9Q X;  2JQG R;  4CDE B;  2BDL A;  4I04 A;  2HHN A;  2AVW A;  4DMY A;  1S4V A;  4BOS A;  2BDZ A;  4QBB A;  3I3T A;  3KWZ A;  5PAD A;  1Y08 A;  1F29 A;  2FUD A;  3H6S A;  3F75 A;  2E03 A;  4D8E A;  1KHQ A;  1ICF A;  2JQF R;  4HWY A;  2E00 A;  5JH3 A;  4BOZ A;  1FH0 A;  3K8U A;  4FJC A;  3HD3 A;  4KLB A;  1CV8 A;  2FTD A;  1NLJ A;  2E01 A;  4XR7 A;  2R9O A;  1PVJ A;  4ZUX U;  6PAD A;  2YJ9 A;  1Q6K A;  2ARY A;  4I05 A;  1NL6 A;  4AXL A;  2GHU A;  4OW0 A;  4X6H A;  2AUZ A;  2DCA A;  3OIS A;  1AYW A;  2YJB A;  4D8I A;  3RVV A;  3K24 A;  3P5W A;  4QRG A;  3WXE A;  4YYW A;  2DJF B;  2OZ2 A;  2HH5 A;  4N8W A;  4BOU A;  2B1N A;  3NHE A;  1EWL A;  1KXR A;  3GCB A;  2VHF A;  4RNA A;  2ACT A;  4PAD A;  1PXV A;  5EF4 A;  3TMP A;  2PBH A;  3W30 A;  1X9Y A;  2FRQ A;  1JQP A;  3BPM A;  1U9V A;  1GCB A;  2J7Q C;  1ATK A;  5CHT A;  1ITO A;  4QRV A;  4DMX A;  3U8E A;  2DC7 A;  5E6J A;  3O0U A;  5A24 A;  3MJ5 A;  2OP3 A;  2DOS A;  2IPP B;  4XUI A;  3LXS A;  1AU3 A;  5J94 A;  4IUM A;  2AUX A;  3I06 A;  2HWK A;  2Y5B A;  4CZW A;  1YK7 A;  2P7U A;  3N3K A;  3HWN A;  1BP4 A;  3S3R A;  9PAP A;  3KX1 A;  5KO3 A;  3DF0 A;  4WA6 A;  1HUC B; 
#chains in the Genus database with same CATH homology
 1PAD A;  2CIO A;  4GUZ A;  3S3Q A;  2R9M A;  3KWB X;  4QH6 A;  1AEC A;  1GMY A;  2G8E A;  2R6N A;  3CBK A;  1U9X A;  2HXZ A;  4FIP A;  3HHI A;  1MEM A;  1SNK A;  3OF9 A;  3WXG A;  1VSN A;  2PRE A;  3OVZ A;  4W4U A;  3F5V A;  4P6E A;  2AU1 A;  1GX3 A;  3D6S A;  3BCN A;  1VJV A;  1O0E A;  3MHH A;  1E2T A;  1IWD A;  1STF E;  4I07 A;  3CH3 X;  1CSB B;  3PDF A;  3V6E A;  3PNR A;  1GEC E;  4BSQ A;  2R9N A;  2NQI A;  1PPN A;  3AI8 A;  3BPF A;  1KFX L;  4YYS A;  2GFO A;  1QXP A;  4Q8G A;  2G8J A;  1CTE A;  2AIM A;  3IUT A;  1MHW A;  4W5C A;  3OF8 A;  3USV A;  1BY8 A;  1YT7 A;  3B79 A;  4OEL A;  1QOL A;  2YJC A;  4X6I A;  3QJ3 A;  4NV8 A;  2DCC A;  1AU4 A;  4CDD B;  2XU4 A;  4G54 A;  2CB5 A;  2VHS A;  2NQA A;  1F2C A;  4YYR A;  4YV8 A;  1GLO A;  2VFC A;  3IOQ A;  2P86 A;  1YK8 A;  1POP A;  1DEU A;  2XU5 A;  4P6G A;  1ZIV A;  2NQG A;  1EF7 A;  2C0Y A;  1ME3 A;  5CVN B;  1M6D A;  1EWM A;  3IMA A;  1PE6 A;  4QRX A;  1MS6 A;  3MHS A;  1NB3 A;  3KFQ A;  3PW3 A;  1EWO A;  1U5I A;  1CPJ A;  3KSE A;  1PCI A;  2PAD A;  3N4C A;  4YVA A;  1TL9 A;  4YYQ A;  1F2A A;  3KKU A;  3M99 A;  2FRA A;  3KW9 A;  2HD5 A;  4CDF B;  2FO5 A;  1MDW A;  1AU2 A;  2OUL A;  3ERV A;  1CQD A;  4PP1 A;  1TU6 A;  3IHP A;  4NV7 A;  5EGW A;  5K16 A;  2FT2 A;  4PI3 A;  4RY2 A;  5CVO B;  2H7J A;  1MIR A;  2B1M A;  5JA7 A;  2PNS A;  4X6J A;  4N79 A;  1W5R A;  4BPV A;  1YVB A;  2AYO A;  3LTW A;  4FK5 A;  2IBI A;  1THE A;  1CB5 A;  2G6D A;  3CBJ A;  3P5X A;  3WXF A;  4BS6 A;  3H8B A;  3HHA A;  1K3B B;  1AIM A;  2DCB A;  3BWK A;  2YJ8 A;  3O1G A;  3H7D A;  3QT4 A;  4YYU A;  4OEM A;  1QDQ A;  4N4Z A;  2FQ9 A;  2DC6 A;  2DJG B;  1MEG A;  2ATO A;  2G7Y A;  3H8C A;  1PIP A;  3BOW A;  1PPP A;  1QMY A;  4Q8H A;  1ZCM A;  4W5B A;  2DCD A;  5F02 A;  1YAL A;  4K7C A;  3V6C A;  1CS8 A;  5FPW A;  4CDC B;  1NQC A;  1PPO A;  1BQI A;  5CHV A;  3IV2 A;  4MZO A;  1Y4H A;  2P0R A;  5CVM A;  4BS5 A;  8PCH A;  2AYN A;  3PBH A;  1F2B A;  1KHP A;  3IEJ A;  2WBF X;  3ZUA A;  4BQV A;  1CVZ A;  2DZZ A;  2R9C A;  4YYV A;  3N3G A;  1NPZ A;  3MOR A;  1AYU A;  2E02 A;  3TNX A;  1KFU L;  1NB5 A;  1AU0 A;  2YJ2 A;  3E1Z B;  3RVW A;  1CJL A;  3RVX A;  3D9W A;  1EWP A;  3MTN A;  1U9W A;  4C5P A;  1PPD A;  2DC9 A;  4MZS A;  4MSX A;  7PCK A;  1XKG A;  2R9F A;  2NQD B;  1A6R A;  4AXM A;  1ME4 A;  3OVX A;  1TLO A;  1SP4 B;  1BGO A;  3K9M A;  2F7D A;  1DF0 A;  3BC3 A;  1AYV A;  2DC8 A;  2XU1 A;  2AS8 A;  2DZY A;  3CH2 X;  3QSD A;  3C9E A;  3P5V A;  2O6X A;  3H89 A;  2FYE A;  2XU3 A;  1PBH A;  4PP2 E;  3LFY A;  2F1G A;  2Y6E A;  3P5U A;  1U9Q X;  2JQG R;  4CDE B;  2BDL A;  4I04 A;  4BGF A;  2HHN A;  2AVW A;  4DMY A;  2BSZ A;  1W6F A;  2VFB A;  1S4V A;  2BDZ A;  4QBB A;  3I3T A;  3KWZ A;  5PAD A;  1Y08 A;  1F29 A;  2FUD A;  3H6S A;  3F75 A;  2E03 A;  1KHQ A;  1ICF A;  2JQF R;  4HWY A;  2E00 A;  5JH3 A;  1FH0 A;  3K8U A;  4FJC A;  3HD3 A;  4KLB A;  1CV8 A;  2FTD A;  1NLJ A;  2E01 A;  4XR7 A;  2R9O A;  4ZUX U;  6PAD A;  2YJ9 A;  1Q6K A;  2ARY A;  4I05 A;  1NL6 A;  4AXL A;  2GHU A;  4X6H A;  2AUZ A;  2DCA A;  3OIS A;  1AYW A;  2YJB A;  3RVV A;  3K24 A;  3P5W A;  4QRG A;  3WXE A;  4YYW A;  2DJF B;  2OZ2 A;  2HH5 A;  4N8W A;  2B1N A;  3NHE A;  1EWL A;  1KXR A;  3GCB A;  2VHF A;  2ACT A;  4PAD A;  1PXV A;  5EF4 A;  2PBH A;  1X9Y A;  2FRQ A;  1JQP A;  3BPM A;  1U9V A;  4B55 A;  1W4T A;  1GCB A;  1ATK A;  5CHT A;  1ITO A;  4QRV A;  4DMX A;  3U8E A;  2DC7 A;  3O0U A;  5A24 A;  2OP3 A;  2IPP B;  4XUI A;  3LXS A;  1AU3 A;  5J94 A;  2AUX A;  3I06 A;  4CZW A;  2Y5B A;  1YK7 A;  2P7U A;  3N3K A;  3HWN A;  1BP4 A;  3S3R A;  9PAP A;  3KX1 A;  3DF0 A;  4WA6 A;  1HUC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...