4W5CA

Crystal structure analysis of cruzain with three fragments: 1 (n-(1h-benzimidazol-2-yl)-1,3-dimethyl-pyrazole-4-carboxamide), 6 (2-amino-4,6-difluorobenzothiazole) and 9 (n-(1h-benzimidazol-2-yl)-3-(4-fluorophenyl)-1h-pyrazole-4-carboxamide).
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSSWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Applying Fragments Based- Drug Design to identify multiple binding modes on cysteine protease.
rcsb
molecule keywords Cruzipain
molecule tags Hydrolase/hydrolase inhibitor
source organism Trypanosoma cruzi
total genus 67
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4w5cA00
2GFOA 2CB5A 2E01A 7PCKA 5F02A 2IPPB 3DF0A 3M99A 2JQFR 1XKGA 5JH3A 2AYNA 3OVXA 2AVWA 2OP3A 3O0UA 2HXZA 4XUIA 3P5WA 3BC3A 1QXPA 4Q8GA 4CDCB 3S3RA 3HHAA 3KFQA 3PNRA 4CDDB 1AU3A 3H6SA 4MZSA 3GCBA 1PCIA 1NLJA 5FPWA 1SP4B 1ZIVA 1AYVA 1EWMA 2NQAA 3C9EA 1NL6A 1U9XA 1YK8A 3O1GA 2YJ9A 1CV8A 1AYUA 1F2BA 1PE6A 1QDQA 4HWYA 1S4VA 5EF4A 1YK7A 2FTDA 3OF9A 2O6XA 1X9YA 4YYVA 2G6DA 2AU1A 3PBHA 1PADA 2DZZA 4AXLA 1NPZA 3I06A 3P5VA 1MEGA 2FRAA 1F2CA 3S3QA 5JA7A 2R9OA 1DF0A 3KSEA 3H8BA 1AU2A 2F1GA 4PP2E 2OZ2A 1Y4HA 1KHQA 2DCCA 2HH5A 4QRVA 3LFYA 2HD5A 4N4ZA 3IMAA 3LXSA 5J94A 3CH3X 6PADA 2E03A 4XR7A 3KWZA 1AU4A 1SNKA 2PREA 3V6CA 1EWPA 2R9CA 2Y6EA 1PXVA 1YT7A 2Y5BA 1NB5A 4W5CA 4I07A 2GHUA 3WXEA 2R9NA 4I04A 1K3BB 2P86A 3USVA 2FO5A 1THEA 2NQIA 5K16A 5EGWA 1PPOA 3ERVA 2FT2A 1TL9A 1TU6A 3PW3A 2DJFB 1BP4A 2DC6A 2B1MA 4ZUXU 1EWLA 4BS5A 1KXRA 3OVZA 4DMYA 1FH0A 1KFXL 1BY8A 2P7UA 1CTEA 1F2AA 2AUZA 2XU4A 1O0EA 2G8EA 1MIRA 3AI8A 1Y08A 4QRXA 3V6EA 4QRGA 1PPPA 5CHVA 1AU0A 2DCAA 4X6JA 4YYQA 3BPFA 4P6GA 4FJCA 3RVWA 1CVZA 4KLBA 4PP1A 4PADA 3U8EA 4Q8HA 1CB5A 2YJBA 4MZOA 2BDZA 1MS6A 1PIPA 3HHIA 1U5IA 3E1ZB 3K8UA 3IV2A 4WA6A 1DEUA 2XU5A 3H89A 2P0RA 1ZCMA 8PCHA 3CBKA 1YVBA 3OF8A 4DMXA 2FQ9A 3HWNA 3QJ3A 3IUTA 1CQDA 4FIPA 4BSQA 3RVXA 2ARYA 1GCBA 4BQVA 1QMYA 2ATOA 4I05A 4AXMA 2YJ8A 1IWDA 3WXGA 3N3GA 4YV8A 2VHFA 2DC9A 2AS8A 2AUXA 5A24A 1Q6KA 3IHPA 5CVNB 2DJGB 2FYEA 1M6DA 3NHEA 1ICFA 4FK5A 1U9VA 2DC7A 1GLOA 3BWKA 1AECA 1U9WA 3MHSA 1CS8A 2PBHA 3RVVA 4YYSA 2OULA 1VSNA 4W5BA 1EF7A 4X6IA 2JQGR 3K24A 2B1NA 2WBFX 1PPNA 4YVAA 2ACTA 4CZWA 1TLOA 1BGOA 3N3KA 2XU1A 2NQDB 3D6SA 1STFE 3IOQA 2DZYA 3QT4A 2DCBA 1KFUL 4N8WA 1VJVA 1A6RA 2C0YA 4BS6A 3B79A 2E02A 4YYWA 3MORA 4P6EA 3P5UA 4OELA 3CH2X 4X6HA 4W4UA 4N79A 1HUCB 2R9MA 5CHTA 2G8JA 1POPA 1PPDA 1YALA 1AYWA 2CIOA 2DCDA 2IBIA 1MEMA 2E00A 2HHNA 3H7DA 5PADA 4OEMA 1CSBB 2R6NA 2F7DA 2AIMA 4K7CA 4YYUA 3BPMA 2YJCA 4QH6A 1ME4A 2AYOA 3BOWA 2FUDA 4G54A 5CVOB 3K9MA 3KX1A 4RY2A 1F29A 9PAPA 2PNSA 2H7JA 1ATKA 4PI3A 1JQPA 3CBJA 3KKUA 3F5VA 2DC8A 3F75A 4YYRA 2YJ2A 4CDEB 2VHSA 2FRQA 1BQIA 3H8CA 1GECE 1NQCA 3QSDA 2R9FA 1MDWA 4BPVA 3PDFA 1NB3A 2PADA 2G7YA 2NQGA 3IEJA 3ZUAA 1PBHA 1ME3A 3MTNA 3N4CA 1AIMA 1ITOA 3MHHA 3P5XA 1QOLA 3KW9A 1GMYA 1CJLA 3KWBX 1EWOA 3BCNA 3TNXA 1U9QX 1MHWA 5CVMA 3OISA 1KHPA 4CDFB 4QBBA 1CPJA 2XU3A 3HD3A 3WXFA 4MSXA 2BDLA 3I3TA
chains in the Genus database with same CATH superfamily
3B21A 2GFOA 2CB5A 2E01A 4ZTBA 5F02A 7PCKA 2IPPB 3DF0A 3M99A 2JQFR 2JTCA 1XKGA 5JH3A 2AYNA 3OVXA 3W31A 2AVWA 2OP3A 3O0UA 5KO3A 2HXZA 4XUIA 3P5WA 3BC3A 1QXPA 4Q8GA 4CDCB 3S3RA 3HHAA 3KFQA 4A5UA 3PNRA 4CDDB 1AU3A 3H6SA 4MZSA 3GCBA 1PCIA 1NLJA 5FPWA 1SP4B 1ZIVA 1AYVA 1EWMA 2NQAA 3C9EA 1NL6A 1U9XA 1YK8A 3O1GA 2YJ9A 1CV8A 1AYUA 1F2BA 1PE6A 1QDQA 4HWYA 1S4VA 5EF4A 1YK7A 2FTDA 3PT2A 3OF9A 2O6XA 1X9YA 4YYVA 2G6DA 2AU1A 3PBHA 1PADA 2DZZA 4GUAA 3BY4A 4AXLA 1NPZA 3I06A 5E6JA 3P5VA 4RKXA 2AGAA 1MEGA 2FRAA 1F2CA 3MTVA 3S3QA 5JA7A 2R9OA 1DF0A 3KSEA 3H8BA 1AU2A 2F1GA 4PP2E 2OZ2A 2J7QA 1Y4HA 1KHQA 2DCCA 2HH5A 4QRVA 3LFYA 2HD5A 4N4ZA 4P16A 2HWKA 3IMAA 3LXSA 5J94A 3ZNHA 4IUMA 3CH3X 6PADA 2E03A 4XR7A 3KWZA 1AU4A 1SNKA 2PREA 3V6CA 1EWPA 2R9CA 2Y6EA 1PXVA 1YT7A 2Y5BA 1NB5A 4W5CA 4I07A 2GHUA 3WXEA 3PSEA 2R9NA 5JZEA 4I04A 1K3BB 2P86A 2FE8A 3USVA 2FO5A 1THEA 2NQIA 4BOZA 5K16A 2UZJA 5EGWA 1PPOA 3E9SA 3ERVA 2FT2A 1TL9A 1TU6A 3PW3A 2DJFB 1BP4A 2DC6A 2B1MA 4ZUXU 1EWLA 4BS5A 1KXRA 3OVZA 4DMYA 3PHUA 1FH0A 3TMPA 1KFXL 1BY8A 2P7UA 1CTEA 3O65A 1F2AA 2AUZA 2XU4A 1UKFA 1O0EA 2G8EA 1MIRA 3AI8A 1Y08A 4QRXA 3V6EA 4QRGA 1PPPA 5CHVA 5EZQA 4IP3A 2DOSA 1AU0A 2DCAA 1YZBA 4X6JA 4YYQA 3BPFA 4P6GA 4FJCA 3RVWA 1CVZA 4KLBA 4PP1A 4PADA 3U8EA 4Q8HA 1CB5A 2YJBA 4MZOA 2BDZA 1MS6A 4M0WA 2J7QC 1PIPA 3HHIA 1U5IA 3E1ZB 3K8UA 3IV2A 4WA6A 1DEUA 2XU5A 3H89A 2P0RA 1ZCMA 8PCHA 3CBKA 1YVBA 3OF8A 4DMXA 2BU3A 2FQ9A 3HWNA 3QJ3A 3IUTA 1CQDA 4FIPA 4RF0A 4D8BA 4BSQA 3RVXA 2ARYA 1GCBA 4BQVA 1QMYA 2ATOA 4I05A 4AXMA 4HXDB 2YJ8A 1IWDA 3WXGA 3N3GA 4YV8A 2VHFA 2DC9A 2AS8A 3PHWA 2AUXA 5A24A 1Q6KA 3IHPA 5CVNB 2DJGB 2FYEA 2Z84A 1M6DA 3NHEA 1ICFA 4FK5A 4REZA 1U9VA 2DC7A 1GLOA 3BWKA 1AECA 1U9WA 3MHSA 5EZSA 1CS8A 2PBHA 3RVVA 3PHXA 4PT5A 4YYSA 2OULA 1VSNA 4W5BA 4RF1A 1EF7A 4X6IA 2JQGR 3K24A 2B1NA 1PPNA 2WBFX 4YVAA 2ACTA 3W30A 4OVZA 2BTWA 3IFUA 4R3DA 4CZWA 1TLOA 1BGOA 1PVJA 3N3KA 2XU1A 2NQDB 3D6SA 1STFE 3IOQA 4RNAA 3C0RA 2DZYA 3QT4A 2DCBA 1KFUL 4N8WA 1VJVA 1A6RA 2C0YA 4BS6A 3PRPA 3B79A 4D8IA 4MI7A 2E02A 4YYWA 3MORA 4P6EA 4D8EA 3P5UA 4OELA 3CH2X 4X6HA 4BOUA 4W4UA 4OW0A 4N79A 1HUCB 2R9MA 5CHTA 2G8JA 1POPA 1PPDA 1YALA 1AYWA 2CIOA 2DCDA 2IBIA 1MEMA 2E00A 2HHNA 3H7DA 5PADA 3PRMA 4OEMA 1CSBB 2R6NA 2F7DA 2AIMA 4K7CA 4YYUA 4OVZB 2BTWB 3BPMA 2YJCA 3TRKA 4QH6A 1ME4A 2AYOA 3BOWA 3OQCA 2FUDA 4G54A 5CVOB 3K9MA 3KX1A 4RY2A 1F29A 9PAPA 2PNSA 2H7JA 1ATKA 4PI3A 4WURA 1JQPA 3CBJA 3KKUA 3F5VA 1DKIA 4BOPA 2DC8A 3MJ5A 3F75A 4YYRA 3BBAA 2YJ2A 3RNVA 4CDEB 2VHSA 2FRQA 1BQIA 3H8CA 1GECE 1NQCA 3QSDA 2R9FA 4MM3B 2JRIA 1MDWA 4BPVA 3PDFA 1NB3A 2PADA 2G7YA 2NQGA 3IEJA 3ZUAA 1PBHA 3MP2A 1ME3A 3MTNA 3N4CA 1AIMA 3MHHA 3P5XA 1ITOA 1QOLA 3KW9A 1GMYA 4BOQA 1CJLA 3KWBX 1EWOA 3BCNA 4XZXA 3TNXA 3BB7A 1U9QX 1MHWA 5CVMA 3OISA 1KHPA 4BOSA 4CDFB 4QBBA 1CPJA 2XU3A 3HD3A 3WXFA 4MSXA 2BDLA 3I3TA
chains in the Genus database with same CATH topology
2GFOA 2CB5A 2E01A 7PCKA 5F02A 2IPPB 3DF0A 3M99A 2JQFR 1XKGA 5JH3A 2AYNA 3OVXA 2AVWA 2OP3A 3O0UA 2HXZA 4XUIA 3P5WA 3BC3A 1QXPA 4Q8GA 1W4TA 4CDCB 3S3RA 3HHAA 3KFQA 3PNRA 4CDDB 1AU3A 3H6SA 4MZSA 3GCBA 1PCIA 1NLJA 5FPWA 1SP4B 1ZIVA 1AYVA 2BSZA 1EWMA 2NQAA 3C9EA 1NL6A 1U9XA 1GX3A 1YK8A 3O1GA 2YJ9A 1CV8A 1AYUA 1F2BA 1PE6A 1QDQA 4HWYA 1S4VA 5EF4A 1YK7A 2FTDA 3OF9A 2O6XA 1X9YA 4YYVA 2G6DA 2AU1A 3PBHA 1PADA 2DZZA 4AXLA 1NPZA 3I06A 3P5VA 1MEGA 2FRAA 1F2CA 3S3QA 5JA7A 2R9OA 1DF0A 3KSEA 3H8BA 1AU2A 2F1GA 4PP2E 2OZ2A 1Y4HA 1KHQA 2DCCA 2HH5A 4QRVA 3LFYA 2HD5A 4N4ZA 3IMAA 3LXSA 5J94A 3CH3X 6PADA 2E03A 4XR7A 3KWZA 1AU4A 1SNKA 2PREA 3V6CA 2VFBA 1EWPA 2R9CA 2Y6EA 1PXVA 1YT7A 2Y5BA 1NB5A 4W5CA 4I07A 2GHUA 3WXEA 2R9NA 4I04A 1K3BB 2P86A 1W6FA 3USVA 2FO5A 1THEA 2NQIA 5K16A 5EGWA 1PPOA 3ERVA 2FT2A 1TL9A 1TU6A 1E2TA 3PW3A 2DJFB 1BP4A 2DC6A 2B1MA 4ZUXU 1EWLA 4BS5A 1KXRA 3OVZA 4DMYA 3LTWA 1FH0A 1KFXL 1BY8A 2P7UA 1CTEA 1F2AA 2AUZA 2XU4A 1O0EA 2G8EA 1MIRA 3AI8A 1Y08A 4QRXA 3V6EA 4QRGA 1PPPA 5CHVA 1AU0A 2DCAA 4C5PA 4X6JA 4YYQA 3BPFA 4P6GA 4FJCA 3RVWA 1CVZA 4KLBA 4PP1A 4PADA 3U8EA 4Q8HA 1CB5A 2YJBA 4MZOA 2BDZA 1MS6A 1PIPA 3HHIA 1U5IA 3E1ZB 3K8UA 3IV2A 4WA6A 1DEUA 2XU5A 3H89A 2P0RA 1ZCMA 8PCHA 3CBKA 1YVBA 3OF8A 4DMXA 2FQ9A 3HWNA 3QJ3A 3IUTA 1CQDA 4FIPA 4BSQA 3RVXA 2ARYA 1GCBA 4BQVA 1QMYA 2ATOA 4I05A 4AXMA 2YJ8A 1IWDA 3WXGA 3N3GA 4YV8A 2VHFA 2DC9A 2AS8A 2AUXA 5A24A 1Q6KA 3IHPA 5CVNB 2DJGB 2FYEA 1M6DA 3NHEA 1ICFA 4FK5A 1U9VA 2DC7A 1GLOA 3BWKA 1AECA 1U9WA 3MHSA 1CS8A 2PBHA 3RVVA 4BGFA 4YYSA 2OULA 1VSNA 4W5BA 1EF7A 4X6IA 2JQGR 3K24A 2B1NA 2WBFX 1PPNA 4NV8A 4YVAA 2ACTA 4NV7A 4CZWA 1TLOA 1BGOA 3N3KA 4GUZA 2XU1A 2NQDB 3D6SA 1STFE 3IOQA 2DZYA 3QT4A 2DCBA 1KFUL 4N8WA 1VJVA 1A6RA 2C0YA 4BS6A 3B79A 2E02A 4YYWA 3MORA 4P6EA 3P5UA 4OELA 3CH2X 4X6HA 4W4UA 4N79A 1HUCB 2R9MA 5CHTA 2G8JA 1POPA 1PPDA 1YALA 1AYWA 2CIOA 2DCDA 2IBIA 1MEMA 2E00A 2HHNA 3H7DA 5PADA 4OEMA 1CSBB 2R6NA 2F7DA 2AIMA 4K7CA 1W5RA 4YYUA 4B55A 3BPMA 2YJCA 4QH6A 1ME4A 2AYOA 3BOWA 2FUDA 4G54A 5CVOB 3K9MA 3KX1A 4RY2A 1F29A 9PAPA 2PNSA 2H7JA 1ATKA 4PI3A 1JQPA 3CBJA 3KKUA 3F5VA 2DC8A 3F75A 4YYRA 2YJ2A 4CDEB 2VHSA 2FRQA 1BQIA 3H8CA 1GECE 1NQCA 3QSDA 2R9FA 1MDWA 4BPVA 3PDFA 1NB3A 2PADA 2G7YA 2NQGA 3IEJA 3ZUAA 1PBHA 1ME3A 3MTNA 3N4CA 3D9WA 1AIMA 1ITOA 3MHHA 3P5XA 1QOLA 3KW9A 1GMYA 1CJLA 2VFCA 3KWBX 1EWOA 3BCNA 3TNXA 1U9QX 1MHWA 5CVMA 3OISA 1KHPA 4CDFB 4QBBA 1CPJA 2XU3A 3HD3A 3WXFA 4MSXA 2BDLA 3I3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFO A;  2CB5 A;  2E01 A;  7PCK A;  5F02 A;  2IPP B;  3DF0 A;  3M99 A;  2JQF R;  1XKG A;  5JH3 A;  2AYN A;  3OVX A;  2AVW A;  2OP3 A;  3O0U A;  2HXZ A;  4XUI A;  3P5W A;  3BC3 A;  1QXP A;  4Q8G A;  4CDC B;  3S3R A;  3HHA A;  3KFQ A;  3PNR A;  4CDD B;  1AU3 A;  3H6S A;  4MZS A;  3GCB A;  1PCI A;  1NLJ A;  5FPW A;  1SP4 B;  1ZIV A;  1AYV A;  1EWM A;  2NQA A;  3C9E A;  1NL6 A;  1U9X A;  1YK8 A;  3O1G A;  2YJ9 A;  1CV8 A;  1AYU A;  1F2B A;  1PE6 A;  1QDQ A;  4HWY A;  1S4V A;  5EF4 A;  1YK7 A;  2FTD A;  3OF9 A;  2O6X A;  1X9Y A;  4YYV A;  2G6D A;  2AU1 A;  3PBH A;  1PAD A;  2DZZ A;  4AXL A;  1NPZ A;  3I06 A;  3P5V A;  1MEG A;  2FRA A;  1F2C A;  3S3Q A;  5JA7 A;  2R9O A;  1DF0 A;  3KSE A;  3H8B A;  1AU2 A;  2F1G A;  4PP2 E;  2OZ2 A;  1Y4H A;  1KHQ A;  2DCC A;  2HH5 A;  4QRV A;  3LFY A;  2HD5 A;  4N4Z A;  3IMA A;  3LXS A;  5J94 A;  3CH3 X;  6PAD A;  2E03 A;  4XR7 A;  3KWZ A;  1AU4 A;  1SNK A;  2PRE A;  3V6C A;  1EWP A;  2R9C A;  2Y6E A;  1PXV A;  1YT7 A;  2Y5B A;  1NB5 A;  4W5C A;  4I07 A;  2GHU A;  3WXE A;  2R9N A;  4I04 A;  1K3B B;  2P86 A;  3USV A;  2FO5 A;  1THE A;  2NQI A;  5K16 A;  5EGW A;  1PPO A;  3ERV A;  2FT2 A;  1TL9 A;  1TU6 A;  3PW3 A;  2DJF B;  1BP4 A;  2DC6 A;  2B1M A;  4ZUX U;  1EWL A;  4BS5 A;  1KXR A;  3OVZ A;  4DMY A;  1FH0 A;  1KFX L;  1BY8 A;  2P7U A;  1CTE A;  1F2A A;  2AUZ A;  2XU4 A;  1O0E A;  2G8E A;  1MIR A;  3AI8 A;  1Y08 A;  4QRX A;  3V6E A;  4QRG A;  1PPP A;  5CHV A;  1AU0 A;  2DCA A;  4X6J A;  4YYQ A;  3BPF A;  4P6G A;  4FJC A;  3RVW A;  1CVZ A;  4KLB A;  4PP1 A;  4PAD A;  3U8E A;  4Q8H A;  1CB5 A;  2YJB A;  4MZO A;  2BDZ A;  1MS6 A;  1PIP A;  3HHI A;  1U5I A;  3E1Z B;  3K8U A;  3IV2 A;  4WA6 A;  1DEU A;  2XU5 A;  3H89 A;  2P0R A;  1ZCM A;  8PCH A;  3CBK A;  1YVB A;  3OF8 A;  4DMX A;  2FQ9 A;  3HWN A;  3QJ3 A;  3IUT A;  1CQD A;  4FIP A;  4BSQ A;  3RVX A;  2ARY A;  1GCB A;  4BQV A;  1QMY A;  2ATO A;  4I05 A;  4AXM A;  2YJ8 A;  1IWD A;  3WXG A;  3N3G A;  4YV8 A;  2VHF A;  2DC9 A;  2AS8 A;  2AUX A;  5A24 A;  1Q6K A;  3IHP A;  5CVN B;  2DJG B;  2FYE A;  1M6D A;  3NHE A;  1ICF A;  4FK5 A;  1U9V A;  2DC7 A;  1GLO A;  3BWK A;  1AEC A;  1U9W A;  3MHS A;  1CS8 A;  2PBH A;  3RVV A;  4YYS A;  2OUL A;  1VSN A;  4W5B A;  1EF7 A;  4X6I A;  2JQG R;  3K24 A;  2B1N A;  2WBF X;  1PPN A;  4YVA A;  2ACT A;  4CZW A;  1TLO A;  1BGO A;  3N3K A;  2XU1 A;  2NQD B;  3D6S A;  1STF E;  3IOQ A;  2DZY A;  3QT4 A;  2DCB A;  1KFU L;  4N8W A;  1VJV A;  1A6R A;  2C0Y A;  4BS6 A;  3B79 A;  2E02 A;  4YYW A;  3MOR A;  4P6E A;  3P5U A;  4OEL A;  3CH2 X;  4X6H A;  4W4U A;  4N79 A;  1HUC B;  2R9M A;  5CHT A;  2G8J A;  1POP A;  1PPD A;  1YAL A;  1AYW A;  2CIO A;  2DCD A;  2IBI A;  1MEM A;  2E00 A;  2HHN A;  3H7D A;  5PAD A;  4OEM A;  1CSB B;  2R6N A;  2F7D A;  2AIM A;  4K7C A;  4YYU A;  3BPM A;  2YJC A;  4QH6 A;  1ME4 A;  2AYO A;  3BOW A;  2FUD A;  4G54 A;  5CVO B;  3K9M A;  3KX1 A;  4RY2 A;  1F29 A;  9PAP A;  2PNS A;  2H7J A;  1ATK A;  4PI3 A;  1JQP A;  3CBJ A;  3KKU A;  3F5V A;  2DC8 A;  3F75 A;  4YYR A;  2YJ2 A;  4CDE B;  2VHS A;  2FRQ A;  1BQI A;  3H8C A;  1GEC E;  1NQC A;  3QSD A;  2R9F A;  1MDW A;  4BPV A;  3PDF A;  1NB3 A;  2PAD A;  2G7Y A;  2NQG A;  3IEJ A;  3ZUA A;  1PBH A;  1ME3 A;  3MTN A;  3N4C A;  1AIM A;  1ITO A;  3MHH A;  3P5X A;  1QOL A;  3KW9 A;  1GMY A;  1CJL A;  3KWB X;  1EWO A;  3BCN A;  3TNX A;  1U9Q X;  1MHW A;  5CVM A;  3OIS A;  1KHP A;  4CDF B;  4QBB A;  1CPJ A;  2XU3 A;  3HD3 A;  3WXF A;  4MSX A;  2BDL A;  3I3T A; 
#chains in the Genus database with same CATH topology
 3B21 A;  2GFO A;  2CB5 A;  2E01 A;  4ZTB A;  5F02 A;  7PCK A;  2IPP B;  3DF0 A;  3M99 A;  2JQF R;  2JTC A;  1XKG A;  5JH3 A;  2AYN A;  3OVX A;  3W31 A;  2AVW A;  2OP3 A;  3O0U A;  5KO3 A;  2HXZ A;  4XUI A;  3P5W A;  3BC3 A;  1QXP A;  4Q8G A;  4CDC B;  3S3R A;  3HHA A;  3KFQ A;  4A5U A;  3PNR A;  4CDD B;  1AU3 A;  3H6S A;  4MZS A;  3GCB A;  1PCI A;  1NLJ A;  5FPW A;  1SP4 B;  1ZIV A;  1AYV A;  1EWM A;  2NQA A;  3C9E A;  1NL6 A;  1U9X A;  1YK8 A;  3O1G A;  2YJ9 A;  1CV8 A;  1AYU A;  1F2B A;  1PE6 A;  1QDQ A;  4HWY A;  1S4V A;  5EF4 A;  1YK7 A;  2FTD A;  3PT2 A;  3OF9 A;  2O6X A;  1X9Y A;  4YYV A;  2G6D A;  2AU1 A;  3PBH A;  1PAD A;  2DZZ A;  4GUA A;  3BY4 A;  4AXL A;  1NPZ A;  3I06 A;  5E6J A;  3P5V A;  4RKX A;  2AGA A;  1MEG A;  2FRA A;  1F2C A;  3MTV A;  3S3Q A;  5JA7 A;  2R9O A;  1DF0 A;  3KSE A;  3H8B A;  1AU2 A;  2F1G A;  4PP2 E;  2OZ2 A;  2J7Q A;  1Y4H A;  1KHQ A;  2DCC A;  2HH5 A;  4QRV A;  3LFY A;  2HD5 A;  4N4Z A;  4P16 A;  2HWK A;  3IMA A;  3LXS A;  5J94 A;  3ZNH A;  4IUM A;  3CH3 X;  6PAD A;  2E03 A;  4XR7 A;  3KWZ A;  1AU4 A;  1SNK A;  2PRE A;  3V6C A;  1EWP A;  2R9C A;  2Y6E A;  1PXV A;  1YT7 A;  2Y5B A;  1NB5 A;  4W5C A;  4I07 A;  2GHU A;  3WXE A;  3PSE A;  2R9N A;  5JZE A;  4I04 A;  1K3B B;  2P86 A;  2FE8 A;  3USV A;  2FO5 A;  1THE A;  2NQI A;  4BOZ A;  5K16 A;  2UZJ A;  5EGW A;  1PPO A;  3E9S A;  3ERV A;  2FT2 A;  1TL9 A;  1TU6 A;  3PW3 A;  2DJF B;  1BP4 A;  2DC6 A;  2B1M A;  4ZUX U;  1EWL A;  4BS5 A;  1KXR A;  3OVZ A;  4DMY A;  3PHU A;  1FH0 A;  3TMP A;  1KFX L;  1BY8 A;  2P7U A;  1CTE A;  3O65 A;  1F2A A;  2AUZ A;  2XU4 A;  1UKF A;  1O0E A;  2G8E A;  1MIR A;  3AI8 A;  1Y08 A;  4QRX A;  3V6E A;  4QRG A;  1PPP A;  5CHV A;  5EZQ A;  4IP3 A;  2DOS A;  1AU0 A;  2DCA A;  1YZB A;  4X6J A;  4YYQ A;  3BPF A;  4P6G A;  4FJC A;  3RVW A;  1CVZ A;  4KLB A;  4PP1 A;  4PAD A;  3U8E A;  4Q8H A;  1CB5 A;  2YJB A;  4MZO A;  2BDZ A;  1MS6 A;  4M0W A;  2J7Q C;  1PIP A;  3HHI A;  1U5I A;  3E1Z B;  3K8U A;  3IV2 A;  4WA6 A;  1DEU A;  2XU5 A;  3H89 A;  2P0R A;  1ZCM A;  8PCH A;  3CBK A;  1YVB A;  3OF8 A;  4DMX A;  2BU3 A;  2FQ9 A;  3HWN A;  3QJ3 A;  3IUT A;  1CQD A;  4FIP A;  4RF0 A;  4D8B A;  4BSQ A;  3RVX A;  2ARY A;  1GCB A;  4BQV A;  1QMY A;  2ATO A;  4I05 A;  4AXM A;  4HXD B;  2YJ8 A;  1IWD A;  3WXG A;  3N3G A;  4YV8 A;  2VHF A;  2DC9 A;  2AS8 A;  3PHW A;  2AUX A;  5A24 A;  1Q6K A;  3IHP A;  5CVN B;  2DJG B;  2FYE A;  2Z84 A;  1M6D A;  3NHE A;  1ICF A;  4FK5 A;  4REZ A;  1U9V A;  2DC7 A;  1GLO A;  3BWK A;  1AEC A;  1U9W A;  3MHS A;  5EZS A;  1CS8 A;  2PBH A;  3RVV A;  3PHX A;  4PT5 A;  4YYS A;  2OUL A;  1VSN A;  4W5B A;  4RF1 A;  1EF7 A;  4X6I A;  2JQG R;  3K24 A;  2B1N A;  1PPN A;  2WBF X;  4YVA A;  2ACT A;  3W30 A;  4OVZ A;  2BTW A;  3IFU A;  4R3D A;  4CZW A;  1TLO A;  1BGO A;  1PVJ A;  3N3K A;  2XU1 A;  2NQD B;  3D6S A;  1STF E;  3IOQ A;  4RNA A;  3C0R A;  2DZY A;  3QT4 A;  2DCB A;  1KFU L;  4N8W A;  1VJV A;  1A6R A;  2C0Y A;  4BS6 A;  3PRP A;  3B79 A;  4D8I A;  4MI7 A;  2E02 A;  4YYW A;  3MOR A;  4P6E A;  4D8E A;  3P5U A;  4OEL A;  3CH2 X;  4X6H A;  4BOU A;  4W4U A;  4OW0 A;  4N79 A;  1HUC B;  2R9M A;  5CHT A;  2G8J A;  1POP A;  1PPD A;  1YAL A;  1AYW A;  2CIO A;  2DCD A;  2IBI A;  1MEM A;  2E00 A;  2HHN A;  3H7D A;  5PAD A;  3PRM A;  4OEM A;  1CSB B;  2R6N A;  2F7D A;  2AIM A;  4K7C A;  4YYU A;  4OVZ B;  2BTW B;  3BPM A;  2YJC A;  3TRK A;  4QH6 A;  1ME4 A;  2AYO A;  3BOW A;  3OQC A;  2FUD A;  4G54 A;  5CVO B;  3K9M A;  3KX1 A;  4RY2 A;  1F29 A;  9PAP A;  2PNS A;  2H7J A;  1ATK A;  4PI3 A;  4WUR A;  1JQP A;  3CBJ A;  3KKU A;  3F5V A;  1DKI A;  4BOP A;  2DC8 A;  3MJ5 A;  3F75 A;  4YYR A;  3BBA A;  2YJ2 A;  3RNV A;  4CDE B;  2VHS A;  2FRQ A;  1BQI A;  3H8C A;  1GEC E;  1NQC A;  3QSD A;  2R9F A;  4MM3 B;  2JRI A;  1MDW A;  4BPV A;  3PDF A;  1NB3 A;  2PAD A;  2G7Y A;  2NQG A;  3IEJ A;  3ZUA A;  1PBH A;  3MP2 A;  1ME3 A;  3MTN A;  3N4C A;  1AIM A;  3MHH A;  3P5X A;  1ITO A;  1QOL A;  3KW9 A;  1GMY A;  4BOQ A;  1CJL A;  3KWB X;  1EWO A;  3BCN A;  4XZX A;  3TNX A;  3BB7 A;  1U9Q X;  1MHW A;  5CVM A;  3OIS A;  1KHP A;  4BOS A;  4CDF B;  4QBB A;  1CPJ A;  2XU3 A;  3HD3 A;  3WXF A;  4MSX A;  2BDL A;  3I3T A; 
#chains in the Genus database with same CATH homology
 2GFO A;  2CB5 A;  2E01 A;  7PCK A;  5F02 A;  2IPP B;  3DF0 A;  3M99 A;  2JQF R;  1XKG A;  5JH3 A;  2AYN A;  3OVX A;  2AVW A;  2OP3 A;  3O0U A;  2HXZ A;  4XUI A;  3P5W A;  3BC3 A;  1QXP A;  4Q8G A;  1W4T A;  4CDC B;  3S3R A;  3HHA A;  3KFQ A;  3PNR A;  4CDD B;  1AU3 A;  3H6S A;  4MZS A;  3GCB A;  1PCI A;  1NLJ A;  5FPW A;  1SP4 B;  1ZIV A;  1AYV A;  2BSZ A;  1EWM A;  2NQA A;  3C9E A;  1NL6 A;  1U9X A;  1GX3 A;  1YK8 A;  3O1G A;  2YJ9 A;  1CV8 A;  1AYU A;  1F2B A;  1PE6 A;  1QDQ A;  4HWY A;  1S4V A;  5EF4 A;  1YK7 A;  2FTD A;  3OF9 A;  2O6X A;  1X9Y A;  4YYV A;  2G6D A;  2AU1 A;  3PBH A;  1PAD A;  2DZZ A;  4AXL A;  1NPZ A;  3I06 A;  3P5V A;  1MEG A;  2FRA A;  1F2C A;  3S3Q A;  5JA7 A;  2R9O A;  1DF0 A;  3KSE A;  3H8B A;  1AU2 A;  2F1G A;  4PP2 E;  2OZ2 A;  1Y4H A;  1KHQ A;  2DCC A;  2HH5 A;  4QRV A;  3LFY A;  2HD5 A;  4N4Z A;  3IMA A;  3LXS A;  5J94 A;  3CH3 X;  6PAD A;  2E03 A;  4XR7 A;  3KWZ A;  1AU4 A;  1SNK A;  2PRE A;  3V6C A;  2VFB A;  1EWP A;  2R9C A;  2Y6E A;  1PXV A;  1YT7 A;  2Y5B A;  1NB5 A;  4W5C A;  4I07 A;  2GHU A;  3WXE A;  2R9N A;  4I04 A;  1K3B B;  2P86 A;  1W6F A;  3USV A;  2FO5 A;  1THE A;  2NQI A;  5K16 A;  5EGW A;  1PPO A;  3ERV A;  2FT2 A;  1TL9 A;  1TU6 A;  1E2T A;  3PW3 A;  2DJF B;  1BP4 A;  2DC6 A;  2B1M A;  4ZUX U;  1EWL A;  4BS5 A;  1KXR A;  3OVZ A;  4DMY A;  3LTW A;  1FH0 A;  1KFX L;  1BY8 A;  2P7U A;  1CTE A;  1F2A A;  2AUZ A;  2XU4 A;  1O0E A;  2G8E A;  1MIR A;  3AI8 A;  1Y08 A;  4QRX A;  3V6E A;  4QRG A;  1PPP A;  5CHV A;  1AU0 A;  2DCA A;  4C5P A;  4X6J A;  4YYQ A;  3BPF A;  4P6G A;  4FJC A;  3RVW A;  1CVZ A;  4KLB A;  4PP1 A;  4PAD A;  3U8E A;  4Q8H A;  1CB5 A;  2YJB A;  4MZO A;  2BDZ A;  1MS6 A;  1PIP A;  3HHI A;  1U5I A;  3E1Z B;  3K8U A;  3IV2 A;  4WA6 A;  1DEU A;  2XU5 A;  3H89 A;  2P0R A;  1ZCM A;  8PCH A;  3CBK A;  1YVB A;  3OF8 A;  4DMX A;  2FQ9 A;  3HWN A;  3QJ3 A;  3IUT A;  1CQD A;  4FIP A;  4BSQ A;  3RVX A;  2ARY A;  1GCB A;  4BQV A;  1QMY A;  2ATO A;  4I05 A;  4AXM A;  2YJ8 A;  1IWD A;  3WXG A;  3N3G A;  4YV8 A;  2VHF A;  2DC9 A;  2AS8 A;  2AUX A;  5A24 A;  1Q6K A;  3IHP A;  5CVN B;  2DJG B;  2FYE A;  1M6D A;  3NHE A;  1ICF A;  4FK5 A;  1U9V A;  2DC7 A;  1GLO A;  3BWK A;  1AEC A;  1U9W A;  3MHS A;  1CS8 A;  2PBH A;  3RVV A;  4BGF A;  4YYS A;  2OUL A;  1VSN A;  4W5B A;  1EF7 A;  4X6I A;  2JQG R;  3K24 A;  2B1N A;  2WBF X;  1PPN A;  4NV8 A;  4YVA A;  2ACT A;  4NV7 A;  4CZW A;  1TLO A;  1BGO A;  3N3K A;  4GUZ A;  2XU1 A;  2NQD B;  3D6S A;  1STF E;  3IOQ A;  2DZY A;  3QT4 A;  2DCB A;  1KFU L;  4N8W A;  1VJV A;  1A6R A;  2C0Y A;  4BS6 A;  3B79 A;  2E02 A;  4YYW A;  3MOR A;  4P6E A;  3P5U A;  4OEL A;  3CH2 X;  4X6H A;  4W4U A;  4N79 A;  1HUC B;  2R9M A;  5CHT A;  2G8J A;  1POP A;  1PPD A;  1YAL A;  1AYW A;  2CIO A;  2DCD A;  2IBI A;  1MEM A;  2E00 A;  2HHN A;  3H7D A;  5PAD A;  4OEM A;  1CSB B;  2R6N A;  2F7D A;  2AIM A;  4K7C A;  1W5R A;  4YYU A;  4B55 A;  3BPM A;  2YJC A;  4QH6 A;  1ME4 A;  2AYO A;  3BOW A;  2FUD A;  4G54 A;  5CVO B;  3K9M A;  3KX1 A;  4RY2 A;  1F29 A;  9PAP A;  2PNS A;  2H7J A;  1ATK A;  4PI3 A;  1JQP A;  3CBJ A;  3KKU A;  3F5V A;  2DC8 A;  3F75 A;  4YYR A;  2YJ2 A;  4CDE B;  2VHS A;  2FRQ A;  1BQI A;  3H8C A;  1GEC E;  1NQC A;  3QSD A;  2R9F A;  1MDW A;  4BPV A;  3PDF A;  1NB3 A;  2PAD A;  2G7Y A;  2NQG A;  3IEJ A;  3ZUA A;  1PBH A;  1ME3 A;  3MTN A;  3N4C A;  3D9W A;  1AIM A;  1ITO A;  3MHH A;  3P5X A;  1QOL A;  3KW9 A;  1GMY A;  1CJL A;  2VFC A;  3KWB X;  1EWO A;  3BCN A;  3TNX A;  1U9Q X;  1MHW A;  5CVM A;  3OIS A;  1KHP A;  4CDF B;  4QBB A;  1CPJ A;  2XU3 A;  3HD3 A;  3WXF A;  4MSX A;  2BDL A;  3I3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...