3CBJA

Chagasin-cathepsin b complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
258
structure length
258
Chain Sequence
DLKLPASFDAREQWPQCPTIKEIRDQGSCGSAWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEAHVNGARPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Displacement of the occluding loop by the parasite protein, chagasin, results in efficient inhibition of human cathepsin B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 73
structure length 258
sequence length 258
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3cbjA00
4Q8HA 1AIMA 4CZWA 5CVNB 1YVBA 3N3GA 3WXEA 3MHHA 1QMYA 4CDDB 4W5BA 1X9YA 2ARYA 4QRVA 4YYVA 1EF7A 1VJVA 2AUXA 2P7UA 2DCCA 3BOWA 3S3QA 4MZSA 4K7CA 1EWLA 2DJFB 3KWBX 1BQIA 2P0RA 4P6EA 1KHPA 2IPPB 1AU0A 1TL9A 3RVWA 1GLOA 1CSBB 1F29A 1YK8A 2XU3A 4FK5A 2XU4A 4PP2E 1BP4A 3BPFA 1BGOA 1QXPA 2DZZA 1PPDA 3MTNA 4WA6A 1NL6A 3BPMA 2YJ9A 3CBKA 2F7DA 1CVZA 1M6DA 2R9OA 2YJCA 4XR7A 4I04A 3ERVA 3QT4A 3IHPA 5JA7A 3H89A 1SP4B 1U5IA 3HHIA 4PADA 2E01A 1NB3A 3IEJA 4AXLA 1CV8A 4G54A 2ATOA 3PNRA 4W4UA 5EF4A 3NHEA 2PREA 1CS8A 3MHSA 5CHTA 2AU1A 3KWZA 5J94A 1S4VA 4W5CA 2OP3A 3KKUA 5F02A 2HHNA 2IBIA 3WXFA 2E00A 4XUIA 1AYWA 2AVWA 3K8UA 2VHSA 3K24A 3OISA 2ACTA 4PI3A 2B1NA 1PPOA 1YT7A 3P5UA 3OF8A 3N3KA 4YYRA 1ICFA 5CVMA 3H8CA 2FYEA 4FIPA 1K3BB 3M99A 1NB5A 4KLBA 3I06A 1STFE 1KFXL 3PBHA 2CIOA 1CQDA 2Y6EA 3MORA 4X6HA 2DC6A 2E02A 3AI8A 1O0EA 2GFOA 1QOLA 1NLJA 3P5VA 3CH2X 3WXGA 2G7YA 2YJBA 4X6IA 2VHFA 2B1MA 3S3RA 3HD3A 1ITOA 3F5VA 2YJ2A 3USVA 1JQPA 1QDQA 2R9MA 5PADA 1PXVA 2WBFX 2FRQA 1NQCA 3U8EA 1CPJA 4Q8GA 4BSQA 1YALA 2R9CA 1PPPA 1PE6A 1A6RA 3P5WA 4I05A 2AYOA 3IOQA 3KFQA 3B79A 2F1GA 1KHQA 1ME3A 1U9WA 4YYQA 4QH6A 3E1ZB 2AIMA 4QBBA 3KX1A 1EWPA 1GMYA 5K16A 3H7DA 2DCDA 2NQIA 3OF9A 1ATKA 4FJCA 1MIRA 3PDFA 2PADA 2P86A 1PBHA 1MDWA 4N8WA 4BS5A 1AU2A 1XKGA 3ZUAA 1FH0A 2OULA 1POPA 4YYWA 1Q6KA 4DMXA 1PIPA 4DMYA 1AU4A 3LFYA 2CB5A 1DF0A 7PCKA 2DCAA 2DC7A 1MEMA 9PAPA 4N4ZA 1ZIVA 2G8EA 2JQFR 2FQ9A 3IMAA 3LXSA 1ZCMA 3H6SA 3IUTA 1KXRA 3CH3X 3TNXA 2NQGA 3RVVA 2YJ8A 1YK7A 2AS8A 2H7JA 2FUDA 3PW3A 2NQAA 2PBHA 1BY8A 3QJ3A 1U9QX 4QRXA 3D6SA 4CDFB 1THEA 1U9XA 2Y5BA 5CVOB 4YVAA 2FRAA 5A24A 4I07A 1NPZA 2R9NA 2BDLA 1CJLA 2HH5A 4PP1A 1DEUA 1EWMA 2O6XA 1F2CA 1F2AA 2E03A 2AUZA 2JQGR 1TU6A 1F2BA 3C9EA 2DC8A 2DCBA 4AXMA 5EGWA 4OEMA 2G6DA 2DJGB 1PCIA 2DC9A 1AU3A 1MEGA 3QSDA 1AECA 1SNKA 1GECE 1Y4HA 3KW9A 3IV2A 4BPVA 1VSNA 1PPNA 4CDCB 3P5XA 3K9MA 2XU1A 1MHWA 1Y08A 3I3TA 3GCBA 2G8JA 2DZYA 3HHAA 5CHVA 3RVXA 4X6JA 1HUCB 3OVZA 1AYUA 2NQDB 3CBJA 4QRGA 4CDEB 6PADA 3BCNA 4YV8A 2GHUA 5FPWA 1IWDA 2PNSA 1KFUL 1CB5A 2FO5A 1GCBA 1TLOA 1U9VA 2R6NA 3N4CA 3V6EA 8PCHA 1PADA 5JH3A 3HWNA 2C0YA 3F75A 4P6GA 3BWKA 4YYUA 4MSXA 2BDZA 2R9FA 1AYVA 2FTDA 2OZ2A 3O1GA 4BQVA 1MS6A 4N79A 3OVXA 4HWYA 4BS6A 3DF0A 2AYNA 4ZUXU 1ME4A 2HD5A 2FT2A 2HXZA 3V6CA 1EWOA 3KSEA 4YYSA 3O0UA 4OELA 1CTEA 3H8BA 2XU5A 4RY2A 3BC3A 4MZOA
chains in the Genus database with same CATH superfamily
4Q8HA 1AIMA 4CZWA 5CVNB 1YVBA 3N3GA 3WXEA 3MHHA 3BB7A 3MTVA 4D8BA 1QMYA 3BBAA 4CDDB 4W5BA 1X9YA 2ARYA 4QRVA 4WURA 4YYVA 1EF7A 1VJVA 2AUXA 4RKXA 2P7UA 2DCCA 3BOWA 3S3QA 4MZSA 2JRIA 4RF0A 4K7CA 4BOUA 1EWLA 2DJFB 3KWBX 1BQIA 2P0RA 4P6EA 1KHPA 2IPPB 1AU0A 1TL9A 3RVWA 1GLOA 1CSBB 1F29A 1YK8A 2XU3A 4FK5A 2XU4A 4PP2E 1BP4A 3BPFA 1BGOA 1QXPA 2DZZA 1PPDA 3MTNA 4P16A 4WA6A 1NL6A 3BPMA 2YJ9A 3CBKA 2F7DA 1CVZA 1M6DA 2R9OA 2YJCA 4XR7A 4I04A 3ERVA 3QT4A 3IHPA 5JA7A 3H89A 1SP4B 1U5IA 3HHIA 4PADA 2E01A 1NB3A 3IEJA 4XZXA 3BY4A 4AXLA 1CV8A 4G54A 2ATOA 3PRMA 3PNRA 4W4UA 5EF4A 3NHEA 3TMPA 2PREA 1CS8A 3MHSA 5CHTA 2AU1A 3KWZA 5J94A 1S4VA 4W5CA 5E6JA 2OP3A 3KKUA 5F02A 2HHNA 2IBIA 3ZNHA 3WXFA 2E00A 4XUIA 1AYWA 2AGAA 2BTWA 2AVWA 1YZBA 2VHSA 3K8UA 3K24A 3OISA 2ACTA 4PI3A 3E9SA 2B1NA 1PPOA 1YT7A 3P5UA 3OF8A 3N3KA 4MM3B 4YYRA 4RF1A 1ICFA 5CVMA 3H8CA 2FYEA 4FIPA 1K3BB 3M99A 3PSEA 1NB5A 2BTWB 4KLBA 3I06A 3PT2A 1STFE 1KFXL 3PBHA 2CIOA 1CQDA 2Y6EA 3MORA 4X6HA 2DC6A 2E02A 3AI8A 1O0EA 2GFOA 1QOLA 1NLJA 3P5VA 3CH2X 3WXGA 4ZTBA 2G7YA 2YJBA 3PHUA 4X6IA 4BOQA 2VHFA 2B1MA 4A5UA 3S3RA 3HD3A 1ITOA 3F5VA 2YJ2A 3USVA 1JQPA 1QDQA 2R9MA 5PADA 1PXVA 2WBFX 5EZSA 3PHWA 2FRQA 1NQCA 3U8EA 1CPJA 4Q8GA 2FE8A 4BSQA 1YALA 2R9CA 1PPPA 1PE6A 1A6RA 3P5WA 3PHXA 4I05A 5JZEA 2AYOA 3IOQA 3KFQA 3B79A 2F1GA 1KHQA 1ME3A 1U9WA 4YYQA 4QH6A 3E1ZB 2AIMA 4QBBA 3KX1A 1EWPA 1GMYA 5K16A 4BOPA 3H7DA 2DCDA 2NQIA 3OF9A 1ATKA 4FJCA 2BU3A 1MIRA 3MJ5A 3PDFA 2PADA 2P86A 5KO3A 1DKIA 1PBHA 1MDWA 4N8WA 4BS5A 1AU2A 1XKGA 3ZUAA 1FH0A 2OULA 4OW0A 1POPA 4YYWA 2Z84A 1Q6KA 4DMXA 1PIPA 4DMYA 1AU4A 3LFYA 4D8IA 2CB5A 1DF0A 7PCKA 2DCAA 2DC7A 4MI7A 1MEMA 3RNVA 9PAPA 4N4ZA 1ZIVA 2G8EA 2JQFR 2FQ9A 3IMAA 3LXSA 4PT5A 1ZCMA 3H6SA 3IUTA 1KXRA 3CH3X 3MP2A 2NQGA 3RVVA 2YJ8A 3TNXA 2UZJA 1YK7A 2AS8A 2H7JA 2FUDA 3PW3A 2NQAA 2PBHA 1BY8A 3QJ3A 1U9QX 4QRXA 3D6SA 4CDFB 1THEA 1U9XA 2Y5BA 4GUAA 5CVOB 4YVAA 2FRAA 5A24A 4I07A 1NPZA 2R9NA 2BDLA 1CJLA 2HH5A 4PP1A 1DEUA 1UKFA 1EWMA 2HWKA 2O6XA 4HXDB 1F2CA 1F2AA 2E03A 2AUZA 2JQGR 1TU6A 2J7QA 1F2BA 3C9EA 2DC8A 3W30A 4BOZA 2DCBA 3PRPA 4AXMA 5EGWA 4OEMA 2G6DA 2JTCA 2DJGB 1PCIA 2DC9A 1AU3A 1MEGA 3QSDA 1AECA 1SNKA 1GECE 1Y4HA 3KW9A 3IV2A 4BPVA 1VSNA 1PPNA 4CDCB 3P5XA 3K9MA 2XU1A 3IFUA 1MHWA 1Y08A 3I3TA 3GCBA 2G8JA 4R3DA 2DZYA 3HHAA 4BOSA 5CHVA 3RVXA 4X6JA 1HUCB 3OVZA 3B21A 1AYUA 2NQDB 3CBJA 4QRGA 3W31A 4CDEB 4REZA 2J7QC 6PADA 3BCNA 4YV8A 2GHUA 5FPWA 1IWDA 2PNSA 1KFUL 1CB5A 2FO5A 5EZQA 1GCBA 1TLOA 1U9VA 4OVZA 2R6NA 1PVJA 3N4CA 3V6EA 8PCHA 1PADA 5JH3A 3HWNA 3TRKA 3C0RA 2C0YA 3F75A 4P6GA 3BWKA 4YYUA 4MSXA 4RNAA 2BDZA 4IUMA 2R9FA 1AYVA 2DOSA 2FTDA 2OZ2A 3O1GA 4D8EA 4BQVA 1MS6A 4N79A 4OVZB 3OVXA 4HWYA 4BS6A 3DF0A 2AYNA 4ZUXU 3O65A 1ME4A 4IP3A 2HD5A 2FT2A 2HXZA 3V6CA 1EWOA 3KSEA 4YYSA 3O0UA 4OELA 1CTEA 3H8BA 2XU5A 4RY2A 3BC3A 3OQCA 4MZOA 4M0WA
chains in the Genus database with same CATH topology
4Q8HA 1AIMA 4CZWA 5CVNB 1YVBA 3N3GA 3WXEA 3MHHA 2BSZA 1QMYA 4CDDB 4W5BA 1X9YA 2ARYA 4QRVA 4YYVA 1EF7A 1VJVA 2AUXA 2P7UA 2DCCA 3BOWA 3S3QA 4MZSA 4K7CA 2VFBA 1EWLA 2DJFB 3KWBX 1BQIA 2P0RA 4P6EA 1KHPA 2IPPB 1AU0A 1TL9A 3RVWA 1GLOA 1CSBB 1F29A 1YK8A 2XU3A 4FK5A 2XU4A 4C5PA 4PP2E 1BP4A 3BPFA 1BGOA 1QXPA 2DZZA 1PPDA 3MTNA 4WA6A 1NL6A 3BPMA 2YJ9A 3CBKA 2F7DA 1CVZA 1M6DA 2R9OA 2YJCA 4XR7A 4I04A 3ERVA 3QT4A 3IHPA 5JA7A 3H89A 1SP4B 1U5IA 3HHIA 4PADA 2E01A 1NB3A 3IEJA 4AXLA 1CV8A 4G54A 2ATOA 3PNRA 4W4UA 5EF4A 3NHEA 2PREA 1CS8A 3MHSA 5CHTA 2AU1A 3KWZA 5J94A 1S4VA 4W5CA 2OP3A 3KKUA 5F02A 2HHNA 2IBIA 3D9WA 3WXFA 2E00A 4XUIA 1AYWA 2AVWA 3K8UA 2VHSA 1GX3A 3K24A 3OISA 2ACTA 4PI3A 2B1NA 1PPOA 1YT7A 3P5UA 3OF8A 3N3KA 4YYRA 1ICFA 5CVMA 3H8CA 2FYEA 4FIPA 1K3BB 3M99A 3LTWA 1NB5A 4KLBA 3I06A 1STFE 1KFXL 3PBHA 2CIOA 1CQDA 2Y6EA 3MORA 4X6HA 2DC6A 2E02A 3AI8A 1O0EA 2GFOA 1QOLA 1NLJA 3P5VA 3CH2X 3WXGA 2G7YA 4B55A 2YJBA 2VFCA 4X6IA 2VHFA 2B1MA 3S3RA 3HD3A 1ITOA 3F5VA 2YJ2A 3USVA 1JQPA 1QDQA 2R9MA 5PADA 1PXVA 2WBFX 2FRQA 1NQCA 3U8EA 1CPJA 4Q8GA 4BSQA 1YALA 1W4TA 2R9CA 1PPPA 1PE6A 1A6RA 3P5WA 4I05A 2AYOA 3IOQA 3KFQA 3B79A 2F1GA 1KHQA 1ME3A 4NV7A 1U9WA 4YYQA 4QH6A 3E1ZB 2AIMA 4QBBA 3KX1A 1EWPA 1GMYA 5K16A 3H7DA 2DCDA 2NQIA 3OF9A 1ATKA 4FJCA 1MIRA 3PDFA 2PADA 2P86A 1PBHA 1MDWA 4N8WA 4BS5A 1AU2A 1XKGA 3ZUAA 1FH0A 2OULA 1POPA 4YYWA 4NV8A 1Q6KA 4DMXA 1PIPA 4DMYA 1AU4A 3LFYA 2CB5A 1DF0A 7PCKA 2DCAA 2DC7A 1MEMA 9PAPA 4N4ZA 1ZIVA 2G8EA 2JQFR 2FQ9A 3IMAA 3LXSA 1ZCMA 3H6SA 3IUTA 1KXRA 3CH3X 3TNXA 2NQGA 3RVVA 2YJ8A 4BGFA 1YK7A 2AS8A 2H7JA 2FUDA 3PW3A 2NQAA 2PBHA 1BY8A 3QJ3A 1U9QX 4QRXA 3D6SA 4CDFB 1THEA 1U9XA 2Y5BA 5CVOB 4YVAA 1W5RA 2FRAA 5A24A 4I07A 1NPZA 2R9NA 2BDLA 1CJLA 2HH5A 4PP1A 1DEUA 1EWMA 2O6XA 1F2CA 1F2AA 2E03A 2AUZA 2JQGR 1TU6A 1F2BA 3C9EA 1E2TA 2DC8A 2DCBA 4AXMA 5EGWA 4OEMA 2G6DA 2DJGB 1PCIA 2DC9A 1AU3A 1MEGA 3QSDA 1AECA 1SNKA 1W6FA 1GECE 1Y4HA 3KW9A 3IV2A 4BPVA 1VSNA 1PPNA 4CDCB 3P5XA 3K9MA 4GUZA 2XU1A 1MHWA 1Y08A 3I3TA 3GCBA 2G8JA 2DZYA 3HHAA 5CHVA 3RVXA 4X6JA 1HUCB 3OVZA 1AYUA 2NQDB 3CBJA 4QRGA 4CDEB 6PADA 3BCNA 4YV8A 2GHUA 5FPWA 1IWDA 2PNSA 1KFUL 1CB5A 2FO5A 1GCBA 1TLOA 1U9VA 2R6NA 3N4CA 3V6EA 8PCHA 1PADA 5JH3A 3HWNA 2C0YA 3F75A 4P6GA 3BWKA 4YYUA 4MSXA 2BDZA 2R9FA 1AYVA 2FTDA 2OZ2A 3O1GA 4BQVA 1MS6A 4N79A 3OVXA 4HWYA 4BS6A 3DF0A 2AYNA 4ZUXU 1ME4A 2HD5A 2FT2A 2HXZA 3V6CA 1EWOA 3KSEA 4YYSA 3O0UA 4OELA 1CTEA 3H8BA 2XU5A 4RY2A 3BC3A 4MZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q8H A;  1AIM A;  4CZW A;  5CVN B;  1YVB A;  3N3G A;  3WXE A;  3MHH A;  1QMY A;  4CDD B;  4W5B A;  1X9Y A;  2ARY A;  4QRV A;  4YYV A;  1EF7 A;  1VJV A;  2AUX A;  2P7U A;  2DCC A;  3BOW A;  3S3Q A;  4MZS A;  4K7C A;  1EWL A;  2DJF B;  3KWB X;  1BQI A;  2P0R A;  4P6E A;  1KHP A;  2IPP B;  1AU0 A;  1TL9 A;  3RVW A;  1GLO A;  1CSB B;  1F29 A;  1YK8 A;  2XU3 A;  4FK5 A;  2XU4 A;  4PP2 E;  1BP4 A;  3BPF A;  1BGO A;  1QXP A;  2DZZ A;  1PPD A;  3MTN A;  4WA6 A;  1NL6 A;  3BPM A;  2YJ9 A;  3CBK A;  2F7D A;  1CVZ A;  1M6D A;  2R9O A;  2YJC A;  4XR7 A;  4I04 A;  3ERV A;  3QT4 A;  3IHP A;  5JA7 A;  3H89 A;  1SP4 B;  1U5I A;  3HHI A;  4PAD A;  2E01 A;  1NB3 A;  3IEJ A;  4AXL A;  1CV8 A;  4G54 A;  2ATO A;  3PNR A;  4W4U A;  5EF4 A;  3NHE A;  2PRE A;  1CS8 A;  3MHS A;  5CHT A;  2AU1 A;  3KWZ A;  5J94 A;  1S4V A;  4W5C A;  2OP3 A;  3KKU A;  5F02 A;  2HHN A;  2IBI A;  3WXF A;  2E00 A;  4XUI A;  1AYW A;  2AVW A;  3K8U A;  2VHS A;  3K24 A;  3OIS A;  2ACT A;  4PI3 A;  2B1N A;  1PPO A;  1YT7 A;  3P5U A;  3OF8 A;  3N3K A;  4YYR A;  1ICF A;  5CVM A;  3H8C A;  2FYE A;  4FIP A;  1K3B B;  3M99 A;  1NB5 A;  4KLB A;  3I06 A;  1STF E;  1KFX L;  3PBH A;  2CIO A;  1CQD A;  2Y6E A;  3MOR A;  4X6H A;  2DC6 A;  2E02 A;  3AI8 A;  1O0E A;  2GFO A;  1QOL A;  1NLJ A;  3P5V A;  3CH2 X;  3WXG A;  2G7Y A;  2YJB A;  4X6I A;  2VHF A;  2B1M A;  3S3R A;  3HD3 A;  1ITO A;  3F5V A;  2YJ2 A;  3USV A;  1JQP A;  1QDQ A;  2R9M A;  5PAD A;  1PXV A;  2WBF X;  2FRQ A;  1NQC A;  3U8E A;  1CPJ A;  4Q8G A;  4BSQ A;  1YAL A;  2R9C A;  1PPP A;  1PE6 A;  1A6R A;  3P5W A;  4I05 A;  2AYO A;  3IOQ A;  3KFQ A;  3B79 A;  2F1G A;  1KHQ A;  1ME3 A;  1U9W A;  4YYQ A;  4QH6 A;  3E1Z B;  2AIM A;  4QBB A;  3KX1 A;  1EWP A;  1GMY A;  5K16 A;  3H7D A;  2DCD A;  2NQI A;  3OF9 A;  1ATK A;  4FJC A;  1MIR A;  3PDF A;  2PAD A;  2P86 A;  1PBH A;  1MDW A;  4N8W A;  4BS5 A;  1AU2 A;  1XKG A;  3ZUA A;  1FH0 A;  2OUL A;  1POP A;  4YYW A;  1Q6K A;  4DMX A;  1PIP A;  4DMY A;  1AU4 A;  3LFY A;  2CB5 A;  1DF0 A;  7PCK A;  2DCA A;  2DC7 A;  1MEM A;  9PAP A;  4N4Z A;  1ZIV A;  2G8E A;  2JQF R;  2FQ9 A;  3IMA A;  3LXS A;  1ZCM A;  3H6S A;  3IUT A;  1KXR A;  3CH3 X;  3TNX A;  2NQG A;  3RVV A;  2YJ8 A;  1YK7 A;  2AS8 A;  2H7J A;  2FUD A;  3PW3 A;  2NQA A;  2PBH A;  1BY8 A;  3QJ3 A;  1U9Q X;  4QRX A;  3D6S A;  4CDF B;  1THE A;  1U9X A;  2Y5B A;  5CVO B;  4YVA A;  2FRA A;  5A24 A;  4I07 A;  1NPZ A;  2R9N A;  2BDL A;  1CJL A;  2HH5 A;  4PP1 A;  1DEU A;  1EWM A;  2O6X A;  1F2C A;  1F2A A;  2E03 A;  2AUZ A;  2JQG R;  1TU6 A;  1F2B A;  3C9E A;  2DC8 A;  2DCB A;  4AXM A;  5EGW A;  4OEM A;  2G6D A;  2DJG B;  1PCI A;  2DC9 A;  1AU3 A;  1MEG A;  3QSD A;  1AEC A;  1SNK A;  1GEC E;  1Y4H A;  3KW9 A;  3IV2 A;  4BPV A;  1VSN A;  1PPN A;  4CDC B;  3P5X A;  3K9M A;  2XU1 A;  1MHW A;  1Y08 A;  3I3T A;  3GCB A;  2G8J A;  2DZY A;  3HHA A;  5CHV A;  3RVX A;  4X6J A;  1HUC B;  3OVZ A;  1AYU A;  2NQD B;  3CBJ A;  4QRG A;  4CDE B;  6PAD A;  3BCN A;  4YV8 A;  2GHU A;  5FPW A;  1IWD A;  2PNS A;  1KFU L;  1CB5 A;  2FO5 A;  1GCB A;  1TLO A;  1U9V A;  2R6N A;  3N4C A;  3V6E A;  8PCH A;  1PAD A;  5JH3 A;  3HWN A;  2C0Y A;  3F75 A;  4P6G A;  3BWK A;  4YYU A;  4MSX A;  2BDZ A;  2R9F A;  1AYV A;  2FTD A;  2OZ2 A;  3O1G A;  4BQV A;  1MS6 A;  4N79 A;  3OVX A;  4HWY A;  4BS6 A;  3DF0 A;  2AYN A;  4ZUX U;  1ME4 A;  2HD5 A;  2FT2 A;  2HXZ A;  3V6C A;  1EWO A;  3KSE A;  4YYS A;  3O0U A;  4OEL A;  1CTE A;  3H8B A;  2XU5 A;  4RY2 A;  3BC3 A;  4MZO A; 
#chains in the Genus database with same CATH topology
 4Q8H A;  1AIM A;  4CZW A;  5CVN B;  1YVB A;  3N3G A;  3WXE A;  3MHH A;  3BB7 A;  3MTV A;  4D8B A;  1QMY A;  3BBA A;  4CDD B;  4W5B A;  1X9Y A;  2ARY A;  4QRV A;  4WUR A;  4YYV A;  1EF7 A;  1VJV A;  2AUX A;  4RKX A;  2P7U A;  2DCC A;  3BOW A;  3S3Q A;  4MZS A;  2JRI A;  4RF0 A;  4K7C A;  4BOU A;  1EWL A;  2DJF B;  3KWB X;  1BQI A;  2P0R A;  4P6E A;  1KHP A;  2IPP B;  1AU0 A;  1TL9 A;  3RVW A;  1GLO A;  1CSB B;  1F29 A;  1YK8 A;  2XU3 A;  4FK5 A;  2XU4 A;  4PP2 E;  1BP4 A;  3BPF A;  1BGO A;  1QXP A;  2DZZ A;  1PPD A;  3MTN A;  4P16 A;  4WA6 A;  1NL6 A;  3BPM A;  2YJ9 A;  3CBK A;  2F7D A;  1CVZ A;  1M6D A;  2R9O A;  2YJC A;  4XR7 A;  4I04 A;  3ERV A;  3QT4 A;  3IHP A;  5JA7 A;  3H89 A;  1SP4 B;  1U5I A;  3HHI A;  4PAD A;  2E01 A;  1NB3 A;  3IEJ A;  4XZX A;  3BY4 A;  4AXL A;  1CV8 A;  4G54 A;  2ATO A;  3PRM A;  3PNR A;  4W4U A;  5EF4 A;  3NHE A;  3TMP A;  2PRE A;  1CS8 A;  3MHS A;  5CHT A;  2AU1 A;  3KWZ A;  5J94 A;  1S4V A;  4W5C A;  5E6J A;  2OP3 A;  3KKU A;  5F02 A;  2HHN A;  2IBI A;  3ZNH A;  3WXF A;  2E00 A;  4XUI A;  1AYW A;  2AGA A;  2BTW A;  2AVW A;  1YZB A;  2VHS A;  3K8U A;  3K24 A;  3OIS A;  2ACT A;  4PI3 A;  3E9S A;  2B1N A;  1PPO A;  1YT7 A;  3P5U A;  3OF8 A;  3N3K A;  4MM3 B;  4YYR A;  4RF1 A;  1ICF A;  5CVM A;  3H8C A;  2FYE A;  4FIP A;  1K3B B;  3M99 A;  3PSE A;  1NB5 A;  2BTW B;  4KLB A;  3I06 A;  3PT2 A;  1STF E;  1KFX L;  3PBH A;  2CIO A;  1CQD A;  2Y6E A;  3MOR A;  4X6H A;  2DC6 A;  2E02 A;  3AI8 A;  1O0E A;  2GFO A;  1QOL A;  1NLJ A;  3P5V A;  3CH2 X;  3WXG A;  4ZTB A;  2G7Y A;  2YJB A;  3PHU A;  4X6I A;  4BOQ A;  2VHF A;  2B1M A;  4A5U A;  3S3R A;  3HD3 A;  1ITO A;  3F5V A;  2YJ2 A;  3USV A;  1JQP A;  1QDQ A;  2R9M A;  5PAD A;  1PXV A;  2WBF X;  5EZS A;  3PHW A;  2FRQ A;  1NQC A;  3U8E A;  1CPJ A;  4Q8G A;  2FE8 A;  4BSQ A;  1YAL A;  2R9C A;  1PPP A;  1PE6 A;  1A6R A;  3P5W A;  3PHX A;  4I05 A;  5JZE A;  2AYO A;  3IOQ A;  3KFQ A;  3B79 A;  2F1G A;  1KHQ A;  1ME3 A;  1U9W A;  4YYQ A;  4QH6 A;  3E1Z B;  2AIM A;  4QBB A;  3KX1 A;  1EWP A;  1GMY A;  5K16 A;  4BOP A;  3H7D A;  2DCD A;  2NQI A;  3OF9 A;  1ATK A;  4FJC A;  2BU3 A;  1MIR A;  3MJ5 A;  3PDF A;  2PAD A;  2P86 A;  5KO3 A;  1DKI A;  1PBH A;  1MDW A;  4N8W A;  4BS5 A;  1AU2 A;  1XKG A;  3ZUA A;  1FH0 A;  2OUL A;  4OW0 A;  1POP A;  4YYW A;  2Z84 A;  1Q6K A;  4DMX A;  1PIP A;  4DMY A;  1AU4 A;  3LFY A;  4D8I A;  2CB5 A;  1DF0 A;  7PCK A;  2DCA A;  2DC7 A;  4MI7 A;  1MEM A;  3RNV A;  9PAP A;  4N4Z A;  1ZIV A;  2G8E A;  2JQF R;  2FQ9 A;  3IMA A;  3LXS A;  4PT5 A;  1ZCM A;  3H6S A;  3IUT A;  1KXR A;  3CH3 X;  3MP2 A;  2NQG A;  3RVV A;  2YJ8 A;  3TNX A;  2UZJ A;  1YK7 A;  2AS8 A;  2H7J A;  2FUD A;  3PW3 A;  2NQA A;  2PBH A;  1BY8 A;  3QJ3 A;  1U9Q X;  4QRX A;  3D6S A;  4CDF B;  1THE A;  1U9X A;  2Y5B A;  4GUA A;  5CVO B;  4YVA A;  2FRA A;  5A24 A;  4I07 A;  1NPZ A;  2R9N A;  2BDL A;  1CJL A;  2HH5 A;  4PP1 A;  1DEU A;  1UKF A;  1EWM A;  2HWK A;  2O6X A;  4HXD B;  1F2C A;  1F2A A;  2E03 A;  2AUZ A;  2JQG R;  1TU6 A;  2J7Q A;  1F2B A;  3C9E A;  2DC8 A;  3W30 A;  4BOZ A;  2DCB A;  3PRP A;  4AXM A;  5EGW A;  4OEM A;  2G6D A;  2JTC A;  2DJG B;  1PCI A;  2DC9 A;  1AU3 A;  1MEG A;  3QSD A;  1AEC A;  1SNK A;  1GEC E;  1Y4H A;  3KW9 A;  3IV2 A;  4BPV A;  1VSN A;  1PPN A;  4CDC B;  3P5X A;  3K9M A;  2XU1 A;  3IFU A;  1MHW A;  1Y08 A;  3I3T A;  3GCB A;  2G8J A;  4R3D A;  2DZY A;  3HHA A;  4BOS A;  5CHV A;  3RVX A;  4X6J A;  1HUC B;  3OVZ A;  3B21 A;  1AYU A;  2NQD B;  3CBJ A;  4QRG A;  3W31 A;  4CDE B;  4REZ A;  2J7Q C;  6PAD A;  3BCN A;  4YV8 A;  2GHU A;  5FPW A;  1IWD A;  2PNS A;  1KFU L;  1CB5 A;  2FO5 A;  5EZQ A;  1GCB A;  1TLO A;  1U9V A;  4OVZ A;  2R6N A;  1PVJ A;  3N4C A;  3V6E A;  8PCH A;  1PAD A;  5JH3 A;  3HWN A;  3TRK A;  3C0R A;  2C0Y A;  3F75 A;  4P6G A;  3BWK A;  4YYU A;  4MSX A;  4RNA A;  2BDZ A;  4IUM A;  2R9F A;  1AYV A;  2DOS A;  2FTD A;  2OZ2 A;  3O1G A;  4D8E A;  4BQV A;  1MS6 A;  4N79 A;  4OVZ B;  3OVX A;  4HWY A;  4BS6 A;  3DF0 A;  2AYN A;  4ZUX U;  3O65 A;  1ME4 A;  4IP3 A;  2HD5 A;  2FT2 A;  2HXZ A;  3V6C A;  1EWO A;  3KSE A;  4YYS A;  3O0U A;  4OEL A;  1CTE A;  3H8B A;  2XU5 A;  4RY2 A;  3BC3 A;  3OQC A;  4MZO A;  4M0W A; 
#chains in the Genus database with same CATH homology
 4Q8H A;  1AIM A;  4CZW A;  5CVN B;  1YVB A;  3N3G A;  3WXE A;  3MHH A;  2BSZ A;  1QMY A;  4CDD B;  4W5B A;  1X9Y A;  2ARY A;  4QRV A;  4YYV A;  1EF7 A;  1VJV A;  2AUX A;  2P7U A;  2DCC A;  3BOW A;  3S3Q A;  4MZS A;  4K7C A;  2VFB A;  1EWL A;  2DJF B;  3KWB X;  1BQI A;  2P0R A;  4P6E A;  1KHP A;  2IPP B;  1AU0 A;  1TL9 A;  3RVW A;  1GLO A;  1CSB B;  1F29 A;  1YK8 A;  2XU3 A;  4FK5 A;  2XU4 A;  4C5P A;  4PP2 E;  1BP4 A;  3BPF A;  1BGO A;  1QXP A;  2DZZ A;  1PPD A;  3MTN A;  4WA6 A;  1NL6 A;  3BPM A;  2YJ9 A;  3CBK A;  2F7D A;  1CVZ A;  1M6D A;  2R9O A;  2YJC A;  4XR7 A;  4I04 A;  3ERV A;  3QT4 A;  3IHP A;  5JA7 A;  3H89 A;  1SP4 B;  1U5I A;  3HHI A;  4PAD A;  2E01 A;  1NB3 A;  3IEJ A;  4AXL A;  1CV8 A;  4G54 A;  2ATO A;  3PNR A;  4W4U A;  5EF4 A;  3NHE A;  2PRE A;  1CS8 A;  3MHS A;  5CHT A;  2AU1 A;  3KWZ A;  5J94 A;  1S4V A;  4W5C A;  2OP3 A;  3KKU A;  5F02 A;  2HHN A;  2IBI A;  3D9W A;  3WXF A;  2E00 A;  4XUI A;  1AYW A;  2AVW A;  3K8U A;  2VHS A;  1GX3 A;  3K24 A;  3OIS A;  2ACT A;  4PI3 A;  2B1N A;  1PPO A;  1YT7 A;  3P5U A;  3OF8 A;  3N3K A;  4YYR A;  1ICF A;  5CVM A;  3H8C A;  2FYE A;  4FIP A;  1K3B B;  3M99 A;  3LTW A;  1NB5 A;  4KLB A;  3I06 A;  1STF E;  1KFX L;  3PBH A;  2CIO A;  1CQD A;  2Y6E A;  3MOR A;  4X6H A;  2DC6 A;  2E02 A;  3AI8 A;  1O0E A;  2GFO A;  1QOL A;  1NLJ A;  3P5V A;  3CH2 X;  3WXG A;  2G7Y A;  4B55 A;  2YJB A;  2VFC A;  4X6I A;  2VHF A;  2B1M A;  3S3R A;  3HD3 A;  1ITO A;  3F5V A;  2YJ2 A;  3USV A;  1JQP A;  1QDQ A;  2R9M A;  5PAD A;  1PXV A;  2WBF X;  2FRQ A;  1NQC A;  3U8E A;  1CPJ A;  4Q8G A;  4BSQ A;  1YAL A;  1W4T A;  2R9C A;  1PPP A;  1PE6 A;  1A6R A;  3P5W A;  4I05 A;  2AYO A;  3IOQ A;  3KFQ A;  3B79 A;  2F1G A;  1KHQ A;  1ME3 A;  4NV7 A;  1U9W A;  4YYQ A;  4QH6 A;  3E1Z B;  2AIM A;  4QBB A;  3KX1 A;  1EWP A;  1GMY A;  5K16 A;  3H7D A;  2DCD A;  2NQI A;  3OF9 A;  1ATK A;  4FJC A;  1MIR A;  3PDF A;  2PAD A;  2P86 A;  1PBH A;  1MDW A;  4N8W A;  4BS5 A;  1AU2 A;  1XKG A;  3ZUA A;  1FH0 A;  2OUL A;  1POP A;  4YYW A;  4NV8 A;  1Q6K A;  4DMX A;  1PIP A;  4DMY A;  1AU4 A;  3LFY A;  2CB5 A;  1DF0 A;  7PCK A;  2DCA A;  2DC7 A;  1MEM A;  9PAP A;  4N4Z A;  1ZIV A;  2G8E A;  2JQF R;  2FQ9 A;  3IMA A;  3LXS A;  1ZCM A;  3H6S A;  3IUT A;  1KXR A;  3CH3 X;  3TNX A;  2NQG A;  3RVV A;  2YJ8 A;  4BGF A;  1YK7 A;  2AS8 A;  2H7J A;  2FUD A;  3PW3 A;  2NQA A;  2PBH A;  1BY8 A;  3QJ3 A;  1U9Q X;  4QRX A;  3D6S A;  4CDF B;  1THE A;  1U9X A;  2Y5B A;  5CVO B;  4YVA A;  1W5R A;  2FRA A;  5A24 A;  4I07 A;  1NPZ A;  2R9N A;  2BDL A;  1CJL A;  2HH5 A;  4PP1 A;  1DEU A;  1EWM A;  2O6X A;  1F2C A;  1F2A A;  2E03 A;  2AUZ A;  2JQG R;  1TU6 A;  1F2B A;  3C9E A;  1E2T A;  2DC8 A;  2DCB A;  4AXM A;  5EGW A;  4OEM A;  2G6D A;  2DJG B;  1PCI A;  2DC9 A;  1AU3 A;  1MEG A;  3QSD A;  1AEC A;  1SNK A;  1W6F A;  1GEC E;  1Y4H A;  3KW9 A;  3IV2 A;  4BPV A;  1VSN A;  1PPN A;  4CDC B;  3P5X A;  3K9M A;  4GUZ A;  2XU1 A;  1MHW A;  1Y08 A;  3I3T A;  3GCB A;  2G8J A;  2DZY A;  3HHA A;  5CHV A;  3RVX A;  4X6J A;  1HUC B;  3OVZ A;  1AYU A;  2NQD B;  3CBJ A;  4QRG A;  4CDE B;  6PAD A;  3BCN A;  4YV8 A;  2GHU A;  5FPW A;  1IWD A;  2PNS A;  1KFU L;  1CB5 A;  2FO5 A;  1GCB A;  1TLO A;  1U9V A;  2R6N A;  3N4C A;  3V6E A;  8PCH A;  1PAD A;  5JH3 A;  3HWN A;  2C0Y A;  3F75 A;  4P6G A;  3BWK A;  4YYU A;  4MSX A;  2BDZ A;  2R9F A;  1AYV A;  2FTD A;  2OZ2 A;  3O1G A;  4BQV A;  1MS6 A;  4N79 A;  3OVX A;  4HWY A;  4BS6 A;  3DF0 A;  2AYN A;  4ZUX U;  1ME4 A;  2HD5 A;  2FT2 A;  2HXZ A;  3V6C A;  1EWO A;  3KSE A;  4YYS A;  3O0U A;  4OEL A;  1CTE A;  3H8B A;  2XU5 A;  4RY2 A;  3BC3 A;  4MZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...