4X6IA

Development of n-(functionalized benzoyl)-homocycloleucyl-glycinonitriles as potent cathepsin k inhibitors.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of N-(Functionalized benzoyl)-homocycloleucyl-glycinonitriles as Potent Cathepsin K Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4x6iA00
1YK8A 2DCAA 5CVNB 2DZYA 2FT2A 1KFUL 2FUDA 3KSEA 2YJ9A 1QMYA 3GCBA 1YVBA 3PBHA 3IOQA 2F1GA 2FYEA 5CVOB 1DF0A 4PP2E 4W4UA 3WXFA 1AU2A 5CVMA 4X6JA 5PADA 1ICFA 2F7DA 1NB5A 3NHEA 2OP3A 4FK5A 2ATOA 5CHVA 2YJCA 4QRGA 4X6HA 1X9YA 4OELA 1YALA 4FJCA 3OF9A 1MDWA 3K9MA 4CZWA 3K24A 4Q8GA 2H7JA 3V6CA 5EF4A 4CDEB 3TNXA 3H8BA 2HXZA 1POPA 3S3RA 2NQAA 1KXRA 2P86A 2AS8A 4QH6A 3CH2X 1YT7A 2NQIA 1AYWA 1K3BB 1NPZA 1PBHA 1CS8A 1MHWA 3RVXA 1CB5A 2HH5A 1EF7A 1QDQA 4KLBA 3IHPA 2BDZA 1PE6A 1U9XA 4N4ZA 1PPDA 4BPVA 2C0YA 2R9OA 4K7CA 2AIMA 1CV8A 2R9NA 2YJ2A 1S4VA 4QRVA 1AU3A 1F29A 1PPPA 3MHHA 1SNKA 3PW3A 4PADA 1BQIA 3OVXA 2FRQA 2E01A 3IEJA 4YYSA 2IPPB 4CDCB 1PXVA 3RVVA 1HUCB 4I07A 3KX1A 1BY8A 1NLJA 1VSNA 4CDFB 1MEGA 4YVAA 3BOWA 3I06A 1CQDA 5A24A 2OZ2A 2DC8A 3WXEA 3BC3A 2R9MA 2AYOA 2DZZA 3HHIA 7PCKA 3H89A 3RVWA 5EGWA 1Q6KA 3KFQA 3F75A 1AU4A 1M6DA 4PP1A 3E1ZB 3M99A 3P5XA 3HWNA 3V6EA 1U9QX 2NQDB 1PPNA 1XKGA 4N79A 1U5IA 4HWYA 4I04A 1NQCA 2CIOA 1STFE 3H7DA 1PCIA 2R9CA 5K16A 4YV8A 5JA7A 1TL9A 2DC7A 1KHQA 1U9WA 2Y5BA 2GFOA 4YYRA 2Y6EA 1JQPA 2P7UA 3KW9A 4BSQA 1Y08A 2G6DA 2E00A 4N8WA 4X6IA 2XU4A 2AUXA 1SP4B 5J94A 4AXMA 3S3QA 2AU1A 2JQGR 1DEUA 2R9FA 3KWZA 5CHTA 1TLOA 4I05A 1ME3A 2G7YA 3ZUAA 4YYUA 1ITOA 4AXLA 2DCCA 4G54A 2FRAA 3F5VA 1CJLA 1GLOA 2AYNA 5F02A 2DCBA 2XU1A 1MIRA 1AECA 2G8JA 3BWKA 3D6SA 2XU5A 2VHFA 4YYWA 4FIPA 2PREA 3CBKA 3IV2A 8PCHA 1NB3A 4YYQA 2FO5A 4W5BA 1EWLA 2HHNA 1Y4HA 3AI8A 1MEMA 3LXSA 4BQVA 3QT4A 3CH3X 4P6EA 1BGOA 1U9VA 2R6NA 1THEA 4BS5A 1IWDA 1CPJA 2AVWA 2FQ9A 2PBHA 3HHAA 1MS6A 2G8EA 3MTNA 1NL6A 2O6XA 3QJ3A 1GMYA 3B79A 4BS6A 1ATKA 2E02A 2PNSA 4MZSA 3QSDA 3WXGA 4XR7A 2XU3A 2FTDA 4Q8HA 1TU6A 3OF8A 2NQGA 1CVZA 2BDLA 3ERVA 2E03A 1KHPA 1PPOA 2OULA 4DMXA 3MORA 4QBBA 2ACTA 4MSXA 1O0EA 1GCBA 3KWBX 3PDFA 4CDDB 3P5UA 3OVZA 2GHUA 1A6RA 3BPFA 9PAPA 4XUIA 1AIMA 3KKUA 2B1MA 3USVA 4WA6A 2DCDA 1AYUA 1KFXL 1AYVA 2VHSA 3P5VA 2YJ8A 1PADA 4P6GA 4W5CA 4YYVA 1CSBB 1QXPA 1F2CA 1EWPA 1GECE 4RY2A 3O1GA 5JH3A 2DC9A 3CBJA 2P0RA 3N3GA 1BP4A 3IMAA 1EWMA 4QRXA 3HD3A 3C9EA 3LFYA 1VJVA 1ZCMA 3H8CA 1F2BA 1FH0A 3IUTA 3OISA 2HD5A 1AU0A 3I3TA 4DMYA 3DF0A 1QOLA 2AUZA 3H6SA 2YJBA 2WBFX 1YK7A 1ZIVA 3PNRA 3MHSA 4OEMA 1CTEA 3O0UA 3U8EA 3P5WA 1ME4A 2B1NA 2JQFR 2ARYA 5FPWA 3N3KA 2DJGB 3K8UA 2DJFB 2IBIA 3BCNA 1EWOA 4MZOA 3BPMA 4PI3A 1PIPA 6PADA 3N4CA 4ZUXU 1F2AA 2CB5A 2DC6A 2PADA
chains in the Genus database with same CATH superfamily
1YK8A 2DCAA 5CVNB 2DZYA 2FT2A 1KFUL 2FUDA 3KSEA 4ZTBA 4BOQA 2Z84A 2YJ9A 1QMYA 3GCBA 1YVBA 3B21A 3PBHA 3IOQA 2F1GA 2FYEA 5CVOB 1DF0A 2UZJA 4PP2E 4W4UA 3WXFA 1AU2A 5CVMA 4X6JA 5PADA 1ICFA 2F7DA 1NB5A 3NHEA 2OP3A 4FK5A 2ATOA 5CHVA 3BBAA 2YJCA 4QRGA 4BOZA 4X6HA 1X9YA 4OELA 1YALA 1UKFA 4FJCA 3OF9A 3PSEA 2J7QA 1MDWA 1YZBA 3K9MA 4CZWA 3K24A 4Q8GA 3PHUA 2H7JA 3V6CA 5EF4A 4CDEB 3TNXA 4D8IA 3H8BA 2HXZA 1POPA 3S3RA 2NQAA 1KXRA 4P16A 2P86A 2AS8A 3MTVA 4QH6A 3CH2X 1YT7A 2NQIA 4OW0A 1AYWA 1K3BB 1NPZA 1PBHA 1CS8A 1MHWA 3RVXA 1CB5A 2HH5A 1EF7A 1QDQA 4KLBA 3IHPA 2BDZA 1PE6A 3W31A 1U9XA 4N4ZA 1PPDA 4BPVA 2C0YA 2R9OA 4K7CA 3OQCA 2AIMA 1CV8A 2R9NA 2YJ2A 5KO3A 1S4VA 4QRVA 1AU3A 5EZSA 1F29A 1PPPA 3MHHA 1SNKA 3PW3A 4OVZA 4PADA 1BQIA 3OVXA 5E6JA 2FRQA 2E01A 3IEJA 4YYSA 2IPPB 4RKXA 4CDCB 1PXVA 2BTWB 1HUCB 3RVVA 4I07A 3KX1A 1BY8A 1NLJA 1VSNA 4CDFB 1MEGA 4YVAA 3BOWA 3I06A 1CQDA 5A24A 2OZ2A 2DC8A 3WXEA 3BC3A 1PVJA 2R9MA 2AYOA 2DZZA 3HHIA 7PCKA 3H89A 3TMPA 3RVWA 2JTCA 5EGWA 1Q6KA 3KFQA 3F75A 1AU4A 1M6DA 4PP1A 3E1ZB 5JZEA 3M99A 3P5XA 4GUAA 3HWNA 3V6EA 4D8BA 1U9QX 2NQDB 1PPNA 3PT2A 1XKGA 4N79A 1U5IA 4HWYA 4I04A 1NQCA 2CIOA 1STFE 4IUMA 3H7DA 2J7QC 1PCIA 2R9CA 5K16A 4YV8A 5JA7A 1TL9A 2DC7A 1KHQA 1U9WA 2Y5BA 2GFOA 4YYRA 2Y6EA 4A5UA 1JQPA 2P7UA 3KW9A 4BSQA 1Y08A 2G6DA 2E00A 4N8WA 4X6IA 2XU4A 2AUXA 1SP4B 5J94A 4AXMA 3S3QA 2AU1A 2JQGR 1DEUA 2R9FA 3KWZA 5CHTA 1TLOA 4I05A 1ME3A 2G7YA 3ZUAA 4YYUA 1ITOA 4AXLA 2DCCA 4G54A 2FRAA 3F5VA 1CJLA 1GLOA 2AYNA 5F02A 2DCBA 2XU1A 1DKIA 1MIRA 1AECA 2G8JA 3BWKA 4D8EA 3D6SA 2XU5A 2VHFA 4YYWA 4FIPA 2PREA 3CBKA 3IV2A 8PCHA 1NB3A 4YYQA 2FO5A 4BOUA 3O65A 4W5BA 1EWLA 4IP3A 4REZA 2HHNA 1Y4HA 3AI8A 1MEMA 3LXSA 4BQVA 3QT4A 3CH3X 4P6EA 1BGOA 1U9VA 2R6NA 5EZQA 1THEA 4BS5A 2JRIA 1IWDA 1CPJA 2AVWA 2FQ9A 2PBHA 3HHAA 1MS6A 2G8EA 3MTNA 1NL6A 2O6XA 3QJ3A 1GMYA 3B79A 3PHWA 4BS6A 1ATKA 3BB7A 2E02A 2PNSA 4MZSA 3TRKA 2BU3A 3QSDA 3WXGA 4XR7A 2XU3A 2FTDA 4RNAA 4Q8HA 1TU6A 3OF8A 2NQGA 1CVZA 2BDLA 3ERVA 2E03A 1KHPA 1PPOA 2OULA 4DMXA 3MORA 4QBBA 2ACTA 4MSXA 1O0EA 1GCBA 3KWBX 3PDFA 4CDDB 3P5UA 3PRPA 4M0WA 3OVZA 2GHUA 4RF1A 4XZXA 1A6RA 3BPFA 9PAPA 3PHXA 4XUIA 1AIMA 3KKUA 2B1MA 3USVA 4WA6A 2DCDA 1AYUA 1KFXL 1AYVA 2VHSA 3P5VA 2HWKA 2YJ8A 1PADA 4BOPA 3E9SA 4P6GA 4W5CA 4YYVA 1CSBB 1QXPA 4R3DA 1F2CA 4OVZB 1EWPA 1GECE 4RY2A 3O1GA 5JH3A 2DC9A 4HXDB 3CBJA 2P0RA 3N3GA 1BP4A 3IMAA 4PT5A 1EWMA 4QRXA 4MI7A 3HD3A 3RNVA 3C9EA 2BTWA 3LFYA 1VJVA 1ZCMA 2DOSA 3H8CA 1F2BA 1FH0A 3IUTA 3MJ5A 3OISA 2HD5A 2AGAA 4RF0A 1AU0A 3I3TA 4BOSA 2FE8A 4DMYA 3DF0A 1QOLA 2AUZA 4WURA 3H6SA 2YJBA 2WBFX 1YK7A 1ZIVA 3PNRA 3MHSA 4OEMA 3W30A 3ZNHA 1CTEA 3O0UA 3U8EA 3C0RA 3MP2A 3P5WA 1ME4A 2B1NA 2JQFR 2ARYA 5FPWA 3BY4A 3IFUA 3N3KA 2DJGB 3K8UA 2DJFB 2IBIA 3PRMA 3BCNA 4MM3B 1EWOA 4MZOA 3BPMA 4PI3A 1PIPA 6PADA 3N4CA 4ZUXU 1F2AA 2CB5A 2DC6A 2PADA
chains in the Genus database with same CATH topology
1YK8A 2DCAA 5CVNB 2DZYA 2FT2A 1KFUL 2FUDA 3KSEA 2YJ9A 1QMYA 3GCBA 1YVBA 2VFBA 3PBHA 3IOQA 2F1GA 2FYEA 4NV7A 5CVOB 1DF0A 4PP2E 4W4UA 3WXFA 1AU2A 5CVMA 4X6JA 5PADA 1ICFA 2F7DA 1NB5A 3NHEA 2OP3A 4FK5A 2ATOA 5CHVA 2YJCA 4QRGA 4X6HA 1X9YA 4OELA 1YALA 4FJCA 3OF9A 1MDWA 3K9MA 2BSZA 4CZWA 3K24A 4Q8GA 2H7JA 3V6CA 5EF4A 4CDEB 3TNXA 3H8BA 2HXZA 1POPA 3S3RA 2NQAA 1KXRA 2P86A 2AS8A 4QH6A 3CH2X 1YT7A 2NQIA 1AYWA 1K3BB 1NPZA 1PBHA 1CS8A 1MHWA 3RVXA 1CB5A 2HH5A 1EF7A 1QDQA 4KLBA 3IHPA 2BDZA 1PE6A 1U9XA 4N4ZA 1PPDA 4BPVA 2C0YA 2VFCA 2R9OA 4K7CA 2AIMA 1CV8A 2R9NA 2YJ2A 1S4VA 4QRVA 1AU3A 1F29A 1PPPA 3MHHA 1SNKA 4NV8A 3PW3A 4PADA 1BQIA 3OVXA 2FRQA 2E01A 3IEJA 4YYSA 2IPPB 4CDCB 1PXVA 3RVVA 1HUCB 4I07A 3KX1A 1BY8A 1NLJA 1VSNA 4CDFB 1MEGA 4YVAA 3BOWA 3I06A 1CQDA 5A24A 2OZ2A 2DC8A 3WXEA 3BC3A 2R9MA 2AYOA 2DZZA 3HHIA 7PCKA 3H89A 1E2TA 3RVWA 5EGWA 1Q6KA 3KFQA 3F75A 1AU4A 1M6DA 4PP1A 3E1ZB 3M99A 3P5XA 3HWNA 3V6EA 1U9QX 2NQDB 1PPNA 1XKGA 4BGFA 4N79A 1U5IA 4HWYA 4I04A 1NQCA 2CIOA 4B55A 1STFE 3H7DA 1PCIA 2R9CA 5K16A 4YV8A 5JA7A 1TL9A 2DC7A 4C5PA 1KHQA 1U9WA 2Y5BA 2GFOA 4YYRA 2Y6EA 1JQPA 2P7UA 3KW9A 4BSQA 1Y08A 2G6DA 2E00A 4N8WA 4X6IA 2XU4A 2AUXA 1SP4B 5J94A 4AXMA 3S3QA 2AU1A 2JQGR 1DEUA 2R9FA 3KWZA 5CHTA 1TLOA 4I05A 1ME3A 2G7YA 3ZUAA 4YYUA 1ITOA 4AXLA 2DCCA 4G54A 3D9WA 2FRAA 3F5VA 1CJLA 1GLOA 2AYNA 5F02A 2DCBA 2XU1A 1MIRA 1AECA 2G8JA 3BWKA 3D6SA 2XU5A 2VHFA 4YYWA 4FIPA 2PREA 3CBKA 3IV2A 3LTWA 8PCHA 1NB3A 4GUZA 4YYQA 2FO5A 4W5BA 1EWLA 2HHNA 1Y4HA 3AI8A 1MEMA 3LXSA 4BQVA 3QT4A 3CH3X 4P6EA 1BGOA 1U9VA 2R6NA 1THEA 4BS5A 1IWDA 1CPJA 2AVWA 2FQ9A 2PBHA 3HHAA 1W4TA 1MS6A 2G8EA 3MTNA 1NL6A 2O6XA 3QJ3A 1GMYA 3B79A 4BS6A 1ATKA 2E02A 2PNSA 4MZSA 3QSDA 3WXGA 4XR7A 2XU3A 2FTDA 4Q8HA 1TU6A 3OF8A 1GX3A 2NQGA 1CVZA 2BDLA 3ERVA 2E03A 1KHPA 1PPOA 2OULA 4DMXA 3MORA 4QBBA 2ACTA 4MSXA 1O0EA 1GCBA 3KWBX 3PDFA 4CDDB 3P5UA 3OVZA 2GHUA 1A6RA 3BPFA 9PAPA 4XUIA 1AIMA 3KKUA 2B1MA 3USVA 4WA6A 2DCDA 1AYUA 1KFXL 1AYVA 2VHSA 3P5VA 2YJ8A 1PADA 4P6GA 4W5CA 4YYVA 1CSBB 1QXPA 1F2CA 1EWPA 1GECE 4RY2A 3O1GA 5JH3A 2DC9A 3CBJA 2P0RA 3N3GA 1BP4A 3IMAA 1EWMA 4QRXA 3HD3A 3C9EA 1W6FA 3LFYA 1W5RA 1VJVA 1ZCMA 3H8CA 1F2BA 1FH0A 3IUTA 3OISA 2HD5A 1AU0A 3I3TA 4DMYA 3DF0A 1QOLA 2AUZA 3H6SA 2YJBA 2WBFX 1YK7A 1ZIVA 3PNRA 3MHSA 4OEMA 1CTEA 3O0UA 3U8EA 3P5WA 1ME4A 2B1NA 2JQFR 2ARYA 5FPWA 3N3KA 2DJGB 3K8UA 2DJFB 2IBIA 3BCNA 1EWOA 4MZOA 3BPMA 4PI3A 1PIPA 6PADA 3N4CA 4ZUXU 1F2AA 2CB5A 2DC6A 2PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK8 A;  2DCA A;  5CVN B;  2DZY A;  2FT2 A;  1KFU L;  2FUD A;  3KSE A;  2YJ9 A;  1QMY A;  3GCB A;  1YVB A;  3PBH A;  3IOQ A;  2F1G A;  2FYE A;  5CVO B;  1DF0 A;  4PP2 E;  4W4U A;  3WXF A;  1AU2 A;  5CVM A;  4X6J A;  5PAD A;  1ICF A;  2F7D A;  1NB5 A;  3NHE A;  2OP3 A;  4FK5 A;  2ATO A;  5CHV A;  2YJC A;  4QRG A;  4X6H A;  1X9Y A;  4OEL A;  1YAL A;  4FJC A;  3OF9 A;  1MDW A;  3K9M A;  4CZW A;  3K24 A;  4Q8G A;  2H7J A;  3V6C A;  5EF4 A;  4CDE B;  3TNX A;  3H8B A;  2HXZ A;  1POP A;  3S3R A;  2NQA A;  1KXR A;  2P86 A;  2AS8 A;  4QH6 A;  3CH2 X;  1YT7 A;  2NQI A;  1AYW A;  1K3B B;  1NPZ A;  1PBH A;  1CS8 A;  1MHW A;  3RVX A;  1CB5 A;  2HH5 A;  1EF7 A;  1QDQ A;  4KLB A;  3IHP A;  2BDZ A;  1PE6 A;  1U9X A;  4N4Z A;  1PPD A;  4BPV A;  2C0Y A;  2R9O A;  4K7C A;  2AIM A;  1CV8 A;  2R9N A;  2YJ2 A;  1S4V A;  4QRV A;  1AU3 A;  1F29 A;  1PPP A;  3MHH A;  1SNK A;  3PW3 A;  4PAD A;  1BQI A;  3OVX A;  2FRQ A;  2E01 A;  3IEJ A;  4YYS A;  2IPP B;  4CDC B;  1PXV A;  3RVV A;  1HUC B;  4I07 A;  3KX1 A;  1BY8 A;  1NLJ A;  1VSN A;  4CDF B;  1MEG A;  4YVA A;  3BOW A;  3I06 A;  1CQD A;  5A24 A;  2OZ2 A;  2DC8 A;  3WXE A;  3BC3 A;  2R9M A;  2AYO A;  2DZZ A;  3HHI A;  7PCK A;  3H89 A;  3RVW A;  5EGW A;  1Q6K A;  3KFQ A;  3F75 A;  1AU4 A;  1M6D A;  4PP1 A;  3E1Z B;  3M99 A;  3P5X A;  3HWN A;  3V6E A;  1U9Q X;  2NQD B;  1PPN A;  1XKG A;  4N79 A;  1U5I A;  4HWY A;  4I04 A;  1NQC A;  2CIO A;  1STF E;  3H7D A;  1PCI A;  2R9C A;  5K16 A;  4YV8 A;  5JA7 A;  1TL9 A;  2DC7 A;  1KHQ A;  1U9W A;  2Y5B A;  2GFO A;  4YYR A;  2Y6E A;  1JQP A;  2P7U A;  3KW9 A;  4BSQ A;  1Y08 A;  2G6D A;  2E00 A;  4N8W A;  4X6I A;  2XU4 A;  2AUX A;  1SP4 B;  5J94 A;  4AXM A;  3S3Q A;  2AU1 A;  2JQG R;  1DEU A;  2R9F A;  3KWZ A;  5CHT A;  1TLO A;  4I05 A;  1ME3 A;  2G7Y A;  3ZUA A;  4YYU A;  1ITO A;  4AXL A;  2DCC A;  4G54 A;  2FRA A;  3F5V A;  1CJL A;  1GLO A;  2AYN A;  5F02 A;  2DCB A;  2XU1 A;  1MIR A;  1AEC A;  2G8J A;  3BWK A;  3D6S A;  2XU5 A;  2VHF A;  4YYW A;  4FIP A;  2PRE A;  3CBK A;  3IV2 A;  8PCH A;  1NB3 A;  4YYQ A;  2FO5 A;  4W5B A;  1EWL A;  2HHN A;  1Y4H A;  3AI8 A;  1MEM A;  3LXS A;  4BQV A;  3QT4 A;  3CH3 X;  4P6E A;  1BGO A;  1U9V A;  2R6N A;  1THE A;  4BS5 A;  1IWD A;  1CPJ A;  2AVW A;  2FQ9 A;  2PBH A;  3HHA A;  1MS6 A;  2G8E A;  3MTN A;  1NL6 A;  2O6X A;  3QJ3 A;  1GMY A;  3B79 A;  4BS6 A;  1ATK A;  2E02 A;  2PNS A;  4MZS A;  3QSD A;  3WXG A;  4XR7 A;  2XU3 A;  2FTD A;  4Q8H A;  1TU6 A;  3OF8 A;  2NQG A;  1CVZ A;  2BDL A;  3ERV A;  2E03 A;  1KHP A;  1PPO A;  2OUL A;  4DMX A;  3MOR A;  4QBB A;  2ACT A;  4MSX A;  1O0E A;  1GCB A;  3KWB X;  3PDF A;  4CDD B;  3P5U A;  3OVZ A;  2GHU A;  1A6R A;  3BPF A;  9PAP A;  4XUI A;  1AIM A;  3KKU A;  2B1M A;  3USV A;  4WA6 A;  2DCD A;  1AYU A;  1KFX L;  1AYV A;  2VHS A;  3P5V A;  2YJ8 A;  1PAD A;  4P6G A;  4W5C A;  4YYV A;  1CSB B;  1QXP A;  1F2C A;  1EWP A;  1GEC E;  4RY2 A;  3O1G A;  5JH3 A;  2DC9 A;  3CBJ A;  2P0R A;  3N3G A;  1BP4 A;  3IMA A;  1EWM A;  4QRX A;  3HD3 A;  3C9E A;  3LFY A;  1VJV A;  1ZCM A;  3H8C A;  1F2B A;  1FH0 A;  3IUT A;  3OIS A;  2HD5 A;  1AU0 A;  3I3T A;  4DMY A;  3DF0 A;  1QOL A;  2AUZ A;  3H6S A;  2YJB A;  2WBF X;  1YK7 A;  1ZIV A;  3PNR A;  3MHS A;  4OEM A;  1CTE A;  3O0U A;  3U8E A;  3P5W A;  1ME4 A;  2B1N A;  2JQF R;  2ARY A;  5FPW A;  3N3K A;  2DJG B;  3K8U A;  2DJF B;  2IBI A;  3BCN A;  1EWO A;  4MZO A;  3BPM A;  4PI3 A;  1PIP A;  6PAD A;  3N4C A;  4ZUX U;  1F2A A;  2CB5 A;  2DC6 A;  2PAD A; 
#chains in the Genus database with same CATH topology
 1YK8 A;  2DCA A;  5CVN B;  2DZY A;  2FT2 A;  1KFU L;  2FUD A;  3KSE A;  4ZTB A;  4BOQ A;  2Z84 A;  2YJ9 A;  1QMY A;  3GCB A;  1YVB A;  3B21 A;  3PBH A;  3IOQ A;  2F1G A;  2FYE A;  5CVO B;  1DF0 A;  2UZJ A;  4PP2 E;  4W4U A;  3WXF A;  1AU2 A;  5CVM A;  4X6J A;  5PAD A;  1ICF A;  2F7D A;  1NB5 A;  3NHE A;  2OP3 A;  4FK5 A;  2ATO A;  5CHV A;  3BBA A;  2YJC A;  4QRG A;  4BOZ A;  4X6H A;  1X9Y A;  4OEL A;  1YAL A;  1UKF A;  4FJC A;  3OF9 A;  3PSE A;  2J7Q A;  1MDW A;  1YZB A;  3K9M A;  4CZW A;  3K24 A;  4Q8G A;  3PHU A;  2H7J A;  3V6C A;  5EF4 A;  4CDE B;  3TNX A;  4D8I A;  3H8B A;  2HXZ A;  1POP A;  3S3R A;  2NQA A;  1KXR A;  4P16 A;  2P86 A;  2AS8 A;  3MTV A;  4QH6 A;  3CH2 X;  1YT7 A;  2NQI A;  4OW0 A;  1AYW A;  1K3B B;  1NPZ A;  1PBH A;  1CS8 A;  1MHW A;  3RVX A;  1CB5 A;  2HH5 A;  1EF7 A;  1QDQ A;  4KLB A;  3IHP A;  2BDZ A;  1PE6 A;  3W31 A;  1U9X A;  4N4Z A;  1PPD A;  4BPV A;  2C0Y A;  2R9O A;  4K7C A;  3OQC A;  2AIM A;  1CV8 A;  2R9N A;  2YJ2 A;  5KO3 A;  1S4V A;  4QRV A;  1AU3 A;  5EZS A;  1F29 A;  1PPP A;  3MHH A;  1SNK A;  3PW3 A;  4OVZ A;  4PAD A;  1BQI A;  3OVX A;  5E6J A;  2FRQ A;  2E01 A;  3IEJ A;  4YYS A;  2IPP B;  4RKX A;  4CDC B;  1PXV A;  2BTW B;  1HUC B;  3RVV A;  4I07 A;  3KX1 A;  1BY8 A;  1NLJ A;  1VSN A;  4CDF B;  1MEG A;  4YVA A;  3BOW A;  3I06 A;  1CQD A;  5A24 A;  2OZ2 A;  2DC8 A;  3WXE A;  3BC3 A;  1PVJ A;  2R9M A;  2AYO A;  2DZZ A;  3HHI A;  7PCK A;  3H89 A;  3TMP A;  3RVW A;  2JTC A;  5EGW A;  1Q6K A;  3KFQ A;  3F75 A;  1AU4 A;  1M6D A;  4PP1 A;  3E1Z B;  5JZE A;  3M99 A;  3P5X A;  4GUA A;  3HWN A;  3V6E A;  4D8B A;  1U9Q X;  2NQD B;  1PPN A;  3PT2 A;  1XKG A;  4N79 A;  1U5I A;  4HWY A;  4I04 A;  1NQC A;  2CIO A;  1STF E;  4IUM A;  3H7D A;  2J7Q C;  1PCI A;  2R9C A;  5K16 A;  4YV8 A;  5JA7 A;  1TL9 A;  2DC7 A;  1KHQ A;  1U9W A;  2Y5B A;  2GFO A;  4YYR A;  2Y6E A;  4A5U A;  1JQP A;  2P7U A;  3KW9 A;  4BSQ A;  1Y08 A;  2G6D A;  2E00 A;  4N8W A;  4X6I A;  2XU4 A;  2AUX A;  1SP4 B;  5J94 A;  4AXM A;  3S3Q A;  2AU1 A;  2JQG R;  1DEU A;  2R9F A;  3KWZ A;  5CHT A;  1TLO A;  4I05 A;  1ME3 A;  2G7Y A;  3ZUA A;  4YYU A;  1ITO A;  4AXL A;  2DCC A;  4G54 A;  2FRA A;  3F5V A;  1CJL A;  1GLO A;  2AYN A;  5F02 A;  2DCB A;  2XU1 A;  1DKI A;  1MIR A;  1AEC A;  2G8J A;  3BWK A;  4D8E A;  3D6S A;  2XU5 A;  2VHF A;  4YYW A;  4FIP A;  2PRE A;  3CBK A;  3IV2 A;  8PCH A;  1NB3 A;  4YYQ A;  2FO5 A;  4BOU A;  3O65 A;  4W5B A;  1EWL A;  4IP3 A;  4REZ A;  2HHN A;  1Y4H A;  3AI8 A;  1MEM A;  3LXS A;  4BQV A;  3QT4 A;  3CH3 X;  4P6E A;  1BGO A;  1U9V A;  2R6N A;  5EZQ A;  1THE A;  4BS5 A;  2JRI A;  1IWD A;  1CPJ A;  2AVW A;  2FQ9 A;  2PBH A;  3HHA A;  1MS6 A;  2G8E A;  3MTN A;  1NL6 A;  2O6X A;  3QJ3 A;  1GMY A;  3B79 A;  3PHW A;  4BS6 A;  1ATK A;  3BB7 A;  2E02 A;  2PNS A;  4MZS A;  3TRK A;  2BU3 A;  3QSD A;  3WXG A;  4XR7 A;  2XU3 A;  2FTD A;  4RNA A;  4Q8H A;  1TU6 A;  3OF8 A;  2NQG A;  1CVZ A;  2BDL A;  3ERV A;  2E03 A;  1KHP A;  1PPO A;  2OUL A;  4DMX A;  3MOR A;  4QBB A;  2ACT A;  4MSX A;  1O0E A;  1GCB A;  3KWB X;  3PDF A;  4CDD B;  3P5U A;  3PRP A;  4M0W A;  3OVZ A;  2GHU A;  4RF1 A;  4XZX A;  1A6R A;  3BPF A;  9PAP A;  3PHX A;  4XUI A;  1AIM A;  3KKU A;  2B1M A;  3USV A;  4WA6 A;  2DCD A;  1AYU A;  1KFX L;  1AYV A;  2VHS A;  3P5V A;  2HWK A;  2YJ8 A;  1PAD A;  4BOP A;  3E9S A;  4P6G A;  4W5C A;  4YYV A;  1CSB B;  1QXP A;  4R3D A;  1F2C A;  4OVZ B;  1EWP A;  1GEC E;  4RY2 A;  3O1G A;  5JH3 A;  2DC9 A;  4HXD B;  3CBJ A;  2P0R A;  3N3G A;  1BP4 A;  3IMA A;  4PT5 A;  1EWM A;  4QRX A;  4MI7 A;  3HD3 A;  3RNV A;  3C9E A;  2BTW A;  3LFY A;  1VJV A;  1ZCM A;  2DOS A;  3H8C A;  1F2B A;  1FH0 A;  3IUT A;  3MJ5 A;  3OIS A;  2HD5 A;  2AGA A;  4RF0 A;  1AU0 A;  3I3T A;  4BOS A;  2FE8 A;  4DMY A;  3DF0 A;  1QOL A;  2AUZ A;  4WUR A;  3H6S A;  2YJB A;  2WBF X;  1YK7 A;  1ZIV A;  3PNR A;  3MHS A;  4OEM A;  3W30 A;  3ZNH A;  1CTE A;  3O0U A;  3U8E A;  3C0R A;  3MP2 A;  3P5W A;  1ME4 A;  2B1N A;  2JQF R;  2ARY A;  5FPW A;  3BY4 A;  3IFU A;  3N3K A;  2DJG B;  3K8U A;  2DJF B;  2IBI A;  3PRM A;  3BCN A;  4MM3 B;  1EWO A;  4MZO A;  3BPM A;  4PI3 A;  1PIP A;  6PAD A;  3N4C A;  4ZUX U;  1F2A A;  2CB5 A;  2DC6 A;  2PAD A; 
#chains in the Genus database with same CATH homology
 1YK8 A;  2DCA A;  5CVN B;  2DZY A;  2FT2 A;  1KFU L;  2FUD A;  3KSE A;  2YJ9 A;  1QMY A;  3GCB A;  1YVB A;  2VFB A;  3PBH A;  3IOQ A;  2F1G A;  2FYE A;  4NV7 A;  5CVO B;  1DF0 A;  4PP2 E;  4W4U A;  3WXF A;  1AU2 A;  5CVM A;  4X6J A;  5PAD A;  1ICF A;  2F7D A;  1NB5 A;  3NHE A;  2OP3 A;  4FK5 A;  2ATO A;  5CHV A;  2YJC A;  4QRG A;  4X6H A;  1X9Y A;  4OEL A;  1YAL A;  4FJC A;  3OF9 A;  1MDW A;  3K9M A;  2BSZ A;  4CZW A;  3K24 A;  4Q8G A;  2H7J A;  3V6C A;  5EF4 A;  4CDE B;  3TNX A;  3H8B A;  2HXZ A;  1POP A;  3S3R A;  2NQA A;  1KXR A;  2P86 A;  2AS8 A;  4QH6 A;  3CH2 X;  1YT7 A;  2NQI A;  1AYW A;  1K3B B;  1NPZ A;  1PBH A;  1CS8 A;  1MHW A;  3RVX A;  1CB5 A;  2HH5 A;  1EF7 A;  1QDQ A;  4KLB A;  3IHP A;  2BDZ A;  1PE6 A;  1U9X A;  4N4Z A;  1PPD A;  4BPV A;  2C0Y A;  2VFC A;  2R9O A;  4K7C A;  2AIM A;  1CV8 A;  2R9N A;  2YJ2 A;  1S4V A;  4QRV A;  1AU3 A;  1F29 A;  1PPP A;  3MHH A;  1SNK A;  4NV8 A;  3PW3 A;  4PAD A;  1BQI A;  3OVX A;  2FRQ A;  2E01 A;  3IEJ A;  4YYS A;  2IPP B;  4CDC B;  1PXV A;  3RVV A;  1HUC B;  4I07 A;  3KX1 A;  1BY8 A;  1NLJ A;  1VSN A;  4CDF B;  1MEG A;  4YVA A;  3BOW A;  3I06 A;  1CQD A;  5A24 A;  2OZ2 A;  2DC8 A;  3WXE A;  3BC3 A;  2R9M A;  2AYO A;  2DZZ A;  3HHI A;  7PCK A;  3H89 A;  1E2T A;  3RVW A;  5EGW A;  1Q6K A;  3KFQ A;  3F75 A;  1AU4 A;  1M6D A;  4PP1 A;  3E1Z B;  3M99 A;  3P5X A;  3HWN A;  3V6E A;  1U9Q X;  2NQD B;  1PPN A;  1XKG A;  4BGF A;  4N79 A;  1U5I A;  4HWY A;  4I04 A;  1NQC A;  2CIO A;  4B55 A;  1STF E;  3H7D A;  1PCI A;  2R9C A;  5K16 A;  4YV8 A;  5JA7 A;  1TL9 A;  2DC7 A;  4C5P A;  1KHQ A;  1U9W A;  2Y5B A;  2GFO A;  4YYR A;  2Y6E A;  1JQP A;  2P7U A;  3KW9 A;  4BSQ A;  1Y08 A;  2G6D A;  2E00 A;  4N8W A;  4X6I A;  2XU4 A;  2AUX A;  1SP4 B;  5J94 A;  4AXM A;  3S3Q A;  2AU1 A;  2JQG R;  1DEU A;  2R9F A;  3KWZ A;  5CHT A;  1TLO A;  4I05 A;  1ME3 A;  2G7Y A;  3ZUA A;  4YYU A;  1ITO A;  4AXL A;  2DCC A;  4G54 A;  3D9W A;  2FRA A;  3F5V A;  1CJL A;  1GLO A;  2AYN A;  5F02 A;  2DCB A;  2XU1 A;  1MIR A;  1AEC A;  2G8J A;  3BWK A;  3D6S A;  2XU5 A;  2VHF A;  4YYW A;  4FIP A;  2PRE A;  3CBK A;  3IV2 A;  3LTW A;  8PCH A;  1NB3 A;  4GUZ A;  4YYQ A;  2FO5 A;  4W5B A;  1EWL A;  2HHN A;  1Y4H A;  3AI8 A;  1MEM A;  3LXS A;  4BQV A;  3QT4 A;  3CH3 X;  4P6E A;  1BGO A;  1U9V A;  2R6N A;  1THE A;  4BS5 A;  1IWD A;  1CPJ A;  2AVW A;  2FQ9 A;  2PBH A;  3HHA A;  1W4T A;  1MS6 A;  2G8E A;  3MTN A;  1NL6 A;  2O6X A;  3QJ3 A;  1GMY A;  3B79 A;  4BS6 A;  1ATK A;  2E02 A;  2PNS A;  4MZS A;  3QSD A;  3WXG A;  4XR7 A;  2XU3 A;  2FTD A;  4Q8H A;  1TU6 A;  3OF8 A;  1GX3 A;  2NQG A;  1CVZ A;  2BDL A;  3ERV A;  2E03 A;  1KHP A;  1PPO A;  2OUL A;  4DMX A;  3MOR A;  4QBB A;  2ACT A;  4MSX A;  1O0E A;  1GCB A;  3KWB X;  3PDF A;  4CDD B;  3P5U A;  3OVZ A;  2GHU A;  1A6R A;  3BPF A;  9PAP A;  4XUI A;  1AIM A;  3KKU A;  2B1M A;  3USV A;  4WA6 A;  2DCD A;  1AYU A;  1KFX L;  1AYV A;  2VHS A;  3P5V A;  2YJ8 A;  1PAD A;  4P6G A;  4W5C A;  4YYV A;  1CSB B;  1QXP A;  1F2C A;  1EWP A;  1GEC E;  4RY2 A;  3O1G A;  5JH3 A;  2DC9 A;  3CBJ A;  2P0R A;  3N3G A;  1BP4 A;  3IMA A;  1EWM A;  4QRX A;  3HD3 A;  3C9E A;  1W6F A;  3LFY A;  1W5R A;  1VJV A;  1ZCM A;  3H8C A;  1F2B A;  1FH0 A;  3IUT A;  3OIS A;  2HD5 A;  1AU0 A;  3I3T A;  4DMY A;  3DF0 A;  1QOL A;  2AUZ A;  3H6S A;  2YJB A;  2WBF X;  1YK7 A;  1ZIV A;  3PNR A;  3MHS A;  4OEM A;  1CTE A;  3O0U A;  3U8E A;  3P5W A;  1ME4 A;  2B1N A;  2JQF R;  2ARY A;  5FPW A;  3N3K A;  2DJG B;  3K8U A;  2DJF B;  2IBI A;  3BCN A;  1EWO A;  4MZO A;  3BPM A;  4PI3 A;  1PIP A;  6PAD A;  3N4C A;  4ZUX U;  1F2A A;  2CB5 A;  2DC6 A;  2PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...