4X6IA

Development of n-(functionalized benzoyl)-homocycloleucyl-glycinonitriles as potent cathepsin k inhibitors.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Development of N-(Functionalized benzoyl)-homocycloleucyl-glycinonitriles as Potent Cathepsin K Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4x6iA00
1K3BB 3PDFA 1CV8A 1VJVA 4G54A 2P86A 3MHSA 1Q6KA 4W4UA 3H8BA 4QRXA 4BS6A 1BQIA 2P7UA 3S3QA 3MHHA 3V6CA 2OZ2A 2DCDA 2G6DA 1AECA 1TL9A 1KXRA 1DF0A 4N4ZA 2E01A 5JH3A 5F02A 1AU4A 4X6HA 1VSNA 1MEGA 3OF9A 1CB5A 4X6JA 1KHQA 2IBIA 1BY8A 2Y5BA 2XU1A 1AYUA 2CIOA 2DC8A 3RVWA 4KLBA 1JQPA 4X6IA 3CH2X 3WXGA 3RVVA 1CSBB 4PP2E 5J94A 3IUTA 4FK5A 3CBJA 2AUXA 2H7JA 2HD5A 1PPOA 3S3RA 2AU1A 1PIPA 1F29A 3PBHA 1Y4HA 2FYEA 4HWYA 4YYUA 2DC6A 2YJBA 2AIMA 2Y6EA 2NQAA 3BPFA 2GHUA 2R9OA 1ZIVA 6PADA 2DZZA 2ACTA 1GMYA 1PADA 3KWBX 4YYVA 1AYWA 1U9XA 1MEMA 3H8CA 1PPPA 5PADA 1U9VA 2HH5A 5EGWA 3IHPA 8PCHA 2HHNA 3P5WA 2AUZA 3TNXA 2C0YA 2DJFB 2YJ2A 3KX1A 3OVXA 2FO5A 2FRAA 3V6EA 5CHVA 3LFYA 5CVNB 3N4CA 2FUDA 2BDLA 3GCBA 3OF8A 3IMAA 1X9YA 1EWOA 2PNSA 1ME4A 3KSEA 2AYNA 4MZSA 4WA6A 4CDFB 1BP4A 3BC3A 4YVAA 4W5CA 4FJCA 3M99A 1GCBA 3ZUAA 4OEMA 1YVBA 1THEA 3LXSA 3HHIA 3QSDA 1AU3A 7PCKA 3K24A 4MZOA 4W5BA 3MTNA 4PI3A 1YK7A 4CZWA 1CJLA 1CTEA 4CDDB 2B1MA 2OULA 2DCAA 4XUIA 1AU0A 2PREA 1TLOA 2DC9A 3BOWA 3OISA 3P5UA 3B79A 3BPMA 2E03A 3H89A 5K16A 5CHTA 1PCIA 3KWZA 1F2AA 1A6RA 5CVMA 2WBFX 3I3TA 1AYVA 1BGOA 2AS8A 4BS5A 4FIPA 1EWLA 2YJCA 3PW3A 2DCBA 3O0UA 9PAPA 1EWPA 1YK8A 1S4VA 3P5VA 1U9QX 2O6XA 3RVXA 1PPDA 4XR7A 2NQIA 3I06A 1F2BA 2XU5A 1ATKA 2DJGB 3QT4A 3AI8A 2VHSA 1IWDA 1M6DA 2R9FA 5CVOB 3E1ZB 2OP3A 2R9CA 1ME3A 4QRGA 2YJ8A 5JA7A 1CVZA 2B1NA 3U8EA 3KFQA 1POPA 3F75A 4YYWA 1MHWA 3HHAA 3KW9A 2FT2A 2AVWA 4YYSA 2AYOA 2NQGA 1HUCB 2FRQA 1PBHA 3CBKA 2IPPB 2NQDB 3N3KA 3D6SA 1FH0A 1PE6A 1U5IA 1NB5A 2E00A 5EF4A 5A24A 4CDEB 4OELA 1MS6A 4I04A 1CQDA 1U9WA 1KFUL 2G7YA 2DZYA 3KKUA 3BCNA 4CDCB 1STFE 3IV2A 2XU4A 2PBHA 2HXZA 4MSXA 3H7DA 2FTDA 1ICFA 1CPJA 2BDZA 3F5VA 3P5XA 4Q8HA 3HWNA 3K9MA 3WXEA 4P6EA 1YALA 4Q8GA 2CB5A 4PP1A 1O0EA 3WXFA 1QXPA 2R9NA 3IOQA 4N8WA 1ZCMA 2JQFR 4YV8A 1QMYA 1NQCA 1QOLA 2F1GA 1SP4B 1DEUA 5FPWA 1Y08A 4BQVA 2R9MA 4BPVA 1MIRA 4I07A 3H6SA 3OVZA 2ARYA 1NLJA 1PXVA 4I05A 4BSQA 1EWMA 3IEJA 1CS8A 1GECE 3HD3A 4YYQA 1EF7A 2FQ9A 1AU2A 2G8JA 1GLOA 4RY2A 2DCCA 3USVA 4ZUXU 1ITOA 2GFOA 4DMYA 2F7DA 2YJ9A 3ERVA 3PNRA 1NB3A 1YT7A 2PADA 4YYRA 2DC7A 3QJ3A 3C9EA 2R6NA 2XU3A 4K7CA 2JQGR 3NHEA 3MORA 4QH6A 4QBBA 1XKGA 4PADA 3CH3X 4AXLA 4N79A 4AXMA 4P6GA 1KHPA 1AIMA 1NPZA 3BWKA 1MDWA 1QDQA 1SNKA 2E02A 1F2CA 1NL6A 2ATOA 3DF0A 3O1GA 1TU6A 2G8EA 3N3GA 4QRVA 1KFXL 2P0RA 3K8UA 1PPNA 2VHFA 4DMXA
chains in the Genus database with same CATH superfamily
1K3BB 3PDFA 1CV8A 1VJVA 4G54A 2P86A 3MHSA 1Q6KA 4W4UA 3H8BA 4QRXA 4BS6A 1BQIA 2P7UA 4REZA 3S3QA 3MHHA 3V6CA 2OZ2A 2DCDA 4RF1A 3MJ5A 2G6DA 1AECA 1TL9A 3OQCA 1KXRA 4GUAA 3RNVA 1DF0A 4N4ZA 2E01A 4D8BA 5JH3A 5F02A 1AU4A 4OVZB 4X6HA 1VSNA 1MEGA 3OF9A 1CB5A 4X6JA 1KHQA 1UKFA 2IBIA 1BY8A 2Y5BA 2XU1A 1AYUA 2CIOA 2DC8A 3RVWA 4KLBA 1JQPA 4X6IA 3CH2X 4BOSA 3WXGA 3RVVA 1CSBB 4PP2E 4PT5A 5J94A 4D8IA 4RKXA 3IUTA 4FK5A 3CBJA 2AUXA 3ZNHA 1YZBA 2H7JA 2HD5A 1PPOA 3S3RA 2AU1A 1PIPA 2J7QC 1F29A 3PBHA 4BOPA 1Y4HA 2FYEA 4HWYA 4YYUA 2DC6A 2YJBA 2AIMA 2Y6EA 2NQAA 3BPFA 2GHUA 2R9OA 1ZIVA 6PADA 2DZZA 2ACTA 4D8EA 4BOUA 1GMYA 1PADA 3KWBX 4YYVA 1AYWA 4IP3A 2BU3A 1U9XA 1MEMA 3H8CA 5EZSA 1PPPA 2BTWB 5PADA 1U9VA 2HH5A 5EGWA 3IHPA 4HXDB 8PCHA 2HHNA 3P5WA 2AUZA 4XZXA 3TNXA 2C0YA 2DJFB 2YJ2A 5E6JA 1DKIA 3KX1A 4P16A 3OVXA 2FO5A 2FRAA 3V6EA 5CHVA 3LFYA 5CVNB 3N4CA 4ZTBA 2FUDA 2BDLA 3GCBA 3OF8A 3IMAA 1X9YA 1EWOA 2PNSA 1ME4A 3KSEA 2AYNA 4MZSA 4WA6A 4CDFB 1BP4A 3BC3A 4YVAA 3W31A 4W5CA 4FJCA 3B21A 3M99A 1GCBA 5EZQA 3ZUAA 4OEMA 1YVBA 1THEA 3LXSA 3HHIA 3QSDA 1AU3A 7PCKA 3K24A 4MZOA 4W5BA 3MTNA 4WURA 4PI3A 1YK7A 4CZWA 5KO3A 1CJLA 1CTEA 4CDDB 2B1MA 2OULA 3BY4A 2DCAA 4XUIA 1AU0A 2PREA 1TLOA 2DC9A 3BOWA 3OISA 3P5UA 3B79A 3BPMA 2E03A 4MI7A 3H89A 5K16A 5CHTA 2JRIA 1PCIA 3KWZA 1F2AA 1A6RA 5CVMA 2WBFX 3I3TA 1AYVA 1BGOA 2AS8A 4RF0A 4BS5A 4FIPA 1EWLA 2YJCA 3PW3A 2DCBA 3O0UA 4OVZA 9PAPA 1EWPA 1YK8A 1S4VA 3P5VA 1U9QX 2O6XA 3RVXA 1PPDA 2FE8A 4XR7A 2NQIA 3I06A 1F2BA 2XU5A 1ATKA 2DJGB 3QT4A 3AI8A 2VHSA 1IWDA 1M6DA 2R9FA 5CVOB 3E1ZB 4M0WA 4RNAA 2OP3A 2R9CA 1ME3A 4QRGA 2YJ8A 5JA7A 1CVZA 2B1NA 3U8EA 3KFQA 4MM3B 1POPA 3F75A 4YYWA 1MHWA 3HHAA 3KW9A 3TMPA 2FT2A 3BBAA 4IUMA 2AVWA 4YYSA 2AYOA 2NQGA 1HUCB 2FRQA 1PBHA 3CBKA 2IPPB 3PSEA 2NQDB 3N3KA 3D6SA 1FH0A 4BOQA 1PE6A 1U5IA 1NB5A 2E00A 5EF4A 5A24A 4CDEB 4OELA 1MS6A 4I04A 1CQDA 1U9WA 1KFUL 2G7YA 3PHWA 2DZYA 3KKUA 2BTWA 3BCNA 4CDCB 1STFE 3BB7A 3IV2A 2XU4A 2PBHA 2HXZA 2DOSA 3TRKA 4MSXA 3H7DA 2FTDA 1ICFA 1CPJA 2BDZA 3E9SA 3F5VA 3P5XA 4Q8HA 3HWNA 3K9MA 3WXEA 4P6EA 1YALA 4Q8GA 2CB5A 4PP1A 4R3DA 1O0EA 3WXFA 1QXPA 2R9NA 3IOQA 4N8WA 5JZEA 1ZCMA 2JQFR 4YV8A 1QMYA 1NQCA 2HWKA 1QOLA 2F1GA 1SP4B 1DEUA 5FPWA 1Y08A 4BQVA 2R9MA 4BPVA 1MIRA 4I07A 3PHXA 3H6SA 3OVZA 2ARYA 1NLJA 1PXVA 4I05A 3O65A 4BSQA 2UZJA 1EWMA 3IEJA 4BOZA 1CS8A 3PHUA 1GECE 2AGAA 3HD3A 4YYQA 1EF7A 2FQ9A 1AU2A 2G8JA 1GLOA 4RY2A 2DCCA 3USVA 4ZUXU 1ITOA 2GFOA 4DMYA 1PVJA 3MTVA 2F7DA 2YJ9A 3ERVA 3PNRA 1NB3A 2JTCA 1YT7A 2PADA 4YYRA 2DC7A 3QJ3A 3C9EA 2R6NA 2XU3A 4K7CA 2JQGR 3NHEA 3MORA 4QH6A 4QBBA 1XKGA 4PADA 3MP2A 3W30A 3CH3X 4AXLA 4N79A 4AXMA 4P6GA 1KHPA 2Z84A 1AIMA 1NPZA 3PT2A 3BWKA 1MDWA 1QDQA 3PRPA 1SNKA 2E02A 1F2CA 1NL6A 2ATOA 3DF0A 2J7QA 3O1GA 3IFUA 1TU6A 2G8EA 3N3GA 4OW0A 4QRVA 1KFXL 3C0RA 2P0RA 4A5UA 3PRMA 3K8UA 1PPNA 2VHFA 4DMXA
chains in the Genus database with same CATH topology
1K3BB 3PDFA 1CV8A 1VJVA 4G54A 2P86A 3MHSA 2VFCA 1Q6KA 4W4UA 3H8BA 4QRXA 4BS6A 1BQIA 2P7UA 3S3QA 3MHHA 3V6CA 2OZ2A 2DCDA 2G6DA 1AECA 1TL9A 1KXRA 1DF0A 4N4ZA 2E01A 5JH3A 5F02A 1AU4A 4X6HA 1VSNA 1MEGA 3OF9A 1CB5A 4X6JA 1KHQA 2IBIA 1BY8A 2Y5BA 2XU1A 1AYUA 2CIOA 2DC8A 3RVWA 4KLBA 1JQPA 4X6IA 3CH2X 3WXGA 3RVVA 1CSBB 4PP2E 5J94A 3IUTA 4FK5A 3CBJA 2AUXA 2H7JA 2HD5A 1PPOA 3S3RA 2AU1A 1PIPA 1F29A 3PBHA 1Y4HA 2FYEA 4HWYA 4YYUA 2DC6A 2YJBA 2AIMA 2Y6EA 2NQAA 3BPFA 2GHUA 2R9OA 1ZIVA 6PADA 2DZZA 2ACTA 1GMYA 1PADA 3KWBX 4YYVA 1AYWA 1U9XA 1MEMA 3H8CA 1PPPA 5PADA 1U9VA 2HH5A 5EGWA 3IHPA 8PCHA 2HHNA 3P5WA 2AUZA 4BGFA 3TNXA 2C0YA 2DJFB 2YJ2A 3KX1A 3OVXA 2FO5A 2FRAA 3V6EA 4C5PA 5CHVA 3LFYA 5CVNB 3N4CA 2FUDA 2BDLA 3GCBA 3OF8A 3IMAA 1X9YA 1EWOA 2PNSA 1ME4A 3KSEA 2AYNA 4MZSA 4WA6A 4CDFB 1BP4A 3BC3A 4YVAA 4W5CA 4FJCA 3M99A 1GCBA 3ZUAA 4OEMA 1YVBA 1THEA 3LXSA 3HHIA 3QSDA 1AU3A 7PCKA 3K24A 4MZOA 4W5BA 3MTNA 4PI3A 1YK7A 4CZWA 3LTWA 1CJLA 1CTEA 4CDDB 2B1MA 2OULA 2DCAA 4XUIA 1AU0A 2PREA 1TLOA 2DC9A 3BOWA 3OISA 3P5UA 3B79A 3BPMA 2E03A 3H89A 5K16A 5CHTA 1PCIA 3KWZA 1F2AA 1A6RA 5CVMA 2WBFX 3I3TA 1AYVA 1BGOA 1E2TA 2AS8A 4BS5A 4FIPA 1EWLA 2YJCA 3PW3A 2DCBA 3O0UA 4NV7A 9PAPA 1EWPA 1YK8A 1S4VA 3P5VA 1U9QX 2O6XA 3RVXA 1PPDA 4XR7A 2NQIA 3I06A 1F2BA 2XU5A 1ATKA 2DJGB 3QT4A 3AI8A 2VHSA 1IWDA 1M6DA 2R9FA 5CVOB 4GUZA 3E1ZB 2BSZA 2OP3A 2R9CA 1ME3A 4QRGA 2YJ8A 5JA7A 1CVZA 2B1NA 3U8EA 3KFQA 1POPA 3F75A 4YYWA 1MHWA 3HHAA 3KW9A 2FT2A 2AVWA 4YYSA 2AYOA 2NQGA 1HUCB 2FRQA 1PBHA 3CBKA 2IPPB 2NQDB 3N3KA 3D6SA 1FH0A 1W6FA 1PE6A 1U5IA 1NB5A 1W5RA 2E00A 5EF4A 5A24A 4CDEB 4OELA 1MS6A 4I04A 1CQDA 1U9WA 1KFUL 2G7YA 2DZYA 3KKUA 3BCNA 4CDCB 1STFE 3IV2A 2XU4A 2PBHA 2HXZA 4MSXA 3H7DA 2FTDA 1ICFA 1CPJA 2BDZA 3F5VA 3P5XA 4Q8HA 3HWNA 3K9MA 3WXEA 4P6EA 1YALA 4Q8GA 2CB5A 4PP1A 1O0EA 3WXFA 1QXPA 2R9NA 4NV8A 3IOQA 4N8WA 1ZCMA 2JQFR 4YV8A 1QMYA 1NQCA 1QOLA 2F1GA 1SP4B 1GX3A 1DEUA 5FPWA 1Y08A 4BQVA 2R9MA 4BPVA 1MIRA 4I07A 3H6SA 3OVZA 2ARYA 1NLJA 1PXVA 4I05A 4BSQA 1EWMA 3IEJA 1CS8A 1GECE 3HD3A 4YYQA 1EF7A 2FQ9A 1AU2A 2G8JA 1GLOA 4RY2A 2DCCA 3USVA 4ZUXU 1ITOA 2GFOA 4DMYA 2F7DA 2YJ9A 3ERVA 3PNRA 1NB3A 1YT7A 2PADA 4YYRA 2DC7A 3QJ3A 3C9EA 2R6NA 2XU3A 4K7CA 2JQGR 3NHEA 3MORA 4B55A 4QH6A 4QBBA 1XKGA 4PADA 3CH3X 3D9WA 4AXLA 4N79A 4AXMA 4P6GA 1KHPA 1AIMA 1NPZA 3BWKA 1MDWA 1QDQA 1SNKA 2VFBA 2E02A 1W4TA 1F2CA 1NL6A 2ATOA 3DF0A 3O1GA 1TU6A 2G8EA 3N3GA 4QRVA 1KFXL 2P0RA 3K8UA 1PPNA 2VHFA 4DMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3B B;  3PDF A;  1CV8 A;  1VJV A;  4G54 A;  2P86 A;  3MHS A;  1Q6K A;  4W4U A;  3H8B A;  4QRX A;  4BS6 A;  1BQI A;  2P7U A;  3S3Q A;  3MHH A;  3V6C A;  2OZ2 A;  2DCD A;  2G6D A;  1AEC A;  1TL9 A;  1KXR A;  1DF0 A;  4N4Z A;  2E01 A;  5JH3 A;  5F02 A;  1AU4 A;  4X6H A;  1VSN A;  1MEG A;  3OF9 A;  1CB5 A;  4X6J A;  1KHQ A;  2IBI A;  1BY8 A;  2Y5B A;  2XU1 A;  1AYU A;  2CIO A;  2DC8 A;  3RVW A;  4KLB A;  1JQP A;  4X6I A;  3CH2 X;  3WXG A;  3RVV A;  1CSB B;  4PP2 E;  5J94 A;  3IUT A;  4FK5 A;  3CBJ A;  2AUX A;  2H7J A;  2HD5 A;  1PPO A;  3S3R A;  2AU1 A;  1PIP A;  1F29 A;  3PBH A;  1Y4H A;  2FYE A;  4HWY A;  4YYU A;  2DC6 A;  2YJB A;  2AIM A;  2Y6E A;  2NQA A;  3BPF A;  2GHU A;  2R9O A;  1ZIV A;  6PAD A;  2DZZ A;  2ACT A;  1GMY A;  1PAD A;  3KWB X;  4YYV A;  1AYW A;  1U9X A;  1MEM A;  3H8C A;  1PPP A;  5PAD A;  1U9V A;  2HH5 A;  5EGW A;  3IHP A;  8PCH A;  2HHN A;  3P5W A;  2AUZ A;  3TNX A;  2C0Y A;  2DJF B;  2YJ2 A;  3KX1 A;  3OVX A;  2FO5 A;  2FRA A;  3V6E A;  5CHV A;  3LFY A;  5CVN B;  3N4C A;  2FUD A;  2BDL A;  3GCB A;  3OF8 A;  3IMA A;  1X9Y A;  1EWO A;  2PNS A;  1ME4 A;  3KSE A;  2AYN A;  4MZS A;  4WA6 A;  4CDF B;  1BP4 A;  3BC3 A;  4YVA A;  4W5C A;  4FJC A;  3M99 A;  1GCB A;  3ZUA A;  4OEM A;  1YVB A;  1THE A;  3LXS A;  3HHI A;  3QSD A;  1AU3 A;  7PCK A;  3K24 A;  4MZO A;  4W5B A;  3MTN A;  4PI3 A;  1YK7 A;  4CZW A;  1CJL A;  1CTE A;  4CDD B;  2B1M A;  2OUL A;  2DCA A;  4XUI A;  1AU0 A;  2PRE A;  1TLO A;  2DC9 A;  3BOW A;  3OIS A;  3P5U A;  3B79 A;  3BPM A;  2E03 A;  3H89 A;  5K16 A;  5CHT A;  1PCI A;  3KWZ A;  1F2A A;  1A6R A;  5CVM A;  2WBF X;  3I3T A;  1AYV A;  1BGO A;  2AS8 A;  4BS5 A;  4FIP A;  1EWL A;  2YJC A;  3PW3 A;  2DCB A;  3O0U A;  9PAP A;  1EWP A;  1YK8 A;  1S4V A;  3P5V A;  1U9Q X;  2O6X A;  3RVX A;  1PPD A;  4XR7 A;  2NQI A;  3I06 A;  1F2B A;  2XU5 A;  1ATK A;  2DJG B;  3QT4 A;  3AI8 A;  2VHS A;  1IWD A;  1M6D A;  2R9F A;  5CVO B;  3E1Z B;  2OP3 A;  2R9C A;  1ME3 A;  4QRG A;  2YJ8 A;  5JA7 A;  1CVZ A;  2B1N A;  3U8E A;  3KFQ A;  1POP A;  3F75 A;  4YYW A;  1MHW A;  3HHA A;  3KW9 A;  2FT2 A;  2AVW A;  4YYS A;  2AYO A;  2NQG A;  1HUC B;  2FRQ A;  1PBH A;  3CBK A;  2IPP B;  2NQD B;  3N3K A;  3D6S A;  1FH0 A;  1PE6 A;  1U5I A;  1NB5 A;  2E00 A;  5EF4 A;  5A24 A;  4CDE B;  4OEL A;  1MS6 A;  4I04 A;  1CQD A;  1U9W A;  1KFU L;  2G7Y A;  2DZY A;  3KKU A;  3BCN A;  4CDC B;  1STF E;  3IV2 A;  2XU4 A;  2PBH A;  2HXZ A;  4MSX A;  3H7D A;  2FTD A;  1ICF A;  1CPJ A;  2BDZ A;  3F5V A;  3P5X A;  4Q8H A;  3HWN A;  3K9M A;  3WXE A;  4P6E A;  1YAL A;  4Q8G A;  2CB5 A;  4PP1 A;  1O0E A;  3WXF A;  1QXP A;  2R9N A;  3IOQ A;  4N8W A;  1ZCM A;  2JQF R;  4YV8 A;  1QMY A;  1NQC A;  1QOL A;  2F1G A;  1SP4 B;  1DEU A;  5FPW A;  1Y08 A;  4BQV A;  2R9M A;  4BPV A;  1MIR A;  4I07 A;  3H6S A;  3OVZ A;  2ARY A;  1NLJ A;  1PXV A;  4I05 A;  4BSQ A;  1EWM A;  3IEJ A;  1CS8 A;  1GEC E;  3HD3 A;  4YYQ A;  1EF7 A;  2FQ9 A;  1AU2 A;  2G8J A;  1GLO A;  4RY2 A;  2DCC A;  3USV A;  4ZUX U;  1ITO A;  2GFO A;  4DMY A;  2F7D A;  2YJ9 A;  3ERV A;  3PNR A;  1NB3 A;  1YT7 A;  2PAD A;  4YYR A;  2DC7 A;  3QJ3 A;  3C9E A;  2R6N A;  2XU3 A;  4K7C A;  2JQG R;  3NHE A;  3MOR A;  4QH6 A;  4QBB A;  1XKG A;  4PAD A;  3CH3 X;  4AXL A;  4N79 A;  4AXM A;  4P6G A;  1KHP A;  1AIM A;  1NPZ A;  3BWK A;  1MDW A;  1QDQ A;  1SNK A;  2E02 A;  1F2C A;  1NL6 A;  2ATO A;  3DF0 A;  3O1G A;  1TU6 A;  2G8E A;  3N3G A;  4QRV A;  1KFX L;  2P0R A;  3K8U A;  1PPN A;  2VHF A;  4DMX A; 
#chains in the Genus database with same CATH topology
 1K3B B;  3PDF A;  1CV8 A;  1VJV A;  4G54 A;  2P86 A;  3MHS A;  1Q6K A;  4W4U A;  3H8B A;  4QRX A;  4BS6 A;  1BQI A;  2P7U A;  4REZ A;  3S3Q A;  3MHH A;  3V6C A;  2OZ2 A;  2DCD A;  4RF1 A;  3MJ5 A;  2G6D A;  1AEC A;  1TL9 A;  3OQC A;  1KXR A;  4GUA A;  3RNV A;  1DF0 A;  4N4Z A;  2E01 A;  4D8B A;  5JH3 A;  5F02 A;  1AU4 A;  4OVZ B;  4X6H A;  1VSN A;  1MEG A;  3OF9 A;  1CB5 A;  4X6J A;  1KHQ A;  1UKF A;  2IBI A;  1BY8 A;  2Y5B A;  2XU1 A;  1AYU A;  2CIO A;  2DC8 A;  3RVW A;  4KLB A;  1JQP A;  4X6I A;  3CH2 X;  4BOS A;  3WXG A;  3RVV A;  1CSB B;  4PP2 E;  4PT5 A;  5J94 A;  4D8I A;  4RKX A;  3IUT A;  4FK5 A;  3CBJ A;  2AUX A;  3ZNH A;  1YZB A;  2H7J A;  2HD5 A;  1PPO A;  3S3R A;  2AU1 A;  1PIP A;  2J7Q C;  1F29 A;  3PBH A;  4BOP A;  1Y4H A;  2FYE A;  4HWY A;  4YYU A;  2DC6 A;  2YJB A;  2AIM A;  2Y6E A;  2NQA A;  3BPF A;  2GHU A;  2R9O A;  1ZIV A;  6PAD A;  2DZZ A;  2ACT A;  4D8E A;  4BOU A;  1GMY A;  1PAD A;  3KWB X;  4YYV A;  1AYW A;  4IP3 A;  2BU3 A;  1U9X A;  1MEM A;  3H8C A;  5EZS A;  1PPP A;  2BTW B;  5PAD A;  1U9V A;  2HH5 A;  5EGW A;  3IHP A;  4HXD B;  8PCH A;  2HHN A;  3P5W A;  2AUZ A;  4XZX A;  3TNX A;  2C0Y A;  2DJF B;  2YJ2 A;  5E6J A;  1DKI A;  3KX1 A;  4P16 A;  3OVX A;  2FO5 A;  2FRA A;  3V6E A;  5CHV A;  3LFY A;  5CVN B;  3N4C A;  4ZTB A;  2FUD A;  2BDL A;  3GCB A;  3OF8 A;  3IMA A;  1X9Y A;  1EWO A;  2PNS A;  1ME4 A;  3KSE A;  2AYN A;  4MZS A;  4WA6 A;  4CDF B;  1BP4 A;  3BC3 A;  4YVA A;  3W31 A;  4W5C A;  4FJC A;  3B21 A;  3M99 A;  1GCB A;  5EZQ A;  3ZUA A;  4OEM A;  1YVB A;  1THE A;  3LXS A;  3HHI A;  3QSD A;  1AU3 A;  7PCK A;  3K24 A;  4MZO A;  4W5B A;  3MTN A;  4WUR A;  4PI3 A;  1YK7 A;  4CZW A;  5KO3 A;  1CJL A;  1CTE A;  4CDD B;  2B1M A;  2OUL A;  3BY4 A;  2DCA A;  4XUI A;  1AU0 A;  2PRE A;  1TLO A;  2DC9 A;  3BOW A;  3OIS A;  3P5U A;  3B79 A;  3BPM A;  2E03 A;  4MI7 A;  3H89 A;  5K16 A;  5CHT A;  2JRI A;  1PCI A;  3KWZ A;  1F2A A;  1A6R A;  5CVM A;  2WBF X;  3I3T A;  1AYV A;  1BGO A;  2AS8 A;  4RF0 A;  4BS5 A;  4FIP A;  1EWL A;  2YJC A;  3PW3 A;  2DCB A;  3O0U A;  4OVZ A;  9PAP A;  1EWP A;  1YK8 A;  1S4V A;  3P5V A;  1U9Q X;  2O6X A;  3RVX A;  1PPD A;  2FE8 A;  4XR7 A;  2NQI A;  3I06 A;  1F2B A;  2XU5 A;  1ATK A;  2DJG B;  3QT4 A;  3AI8 A;  2VHS A;  1IWD A;  1M6D A;  2R9F A;  5CVO B;  3E1Z B;  4M0W A;  4RNA A;  2OP3 A;  2R9C A;  1ME3 A;  4QRG A;  2YJ8 A;  5JA7 A;  1CVZ A;  2B1N A;  3U8E A;  3KFQ A;  4MM3 B;  1POP A;  3F75 A;  4YYW A;  1MHW A;  3HHA A;  3KW9 A;  3TMP A;  2FT2 A;  3BBA A;  4IUM A;  2AVW A;  4YYS A;  2AYO A;  2NQG A;  1HUC B;  2FRQ A;  1PBH A;  3CBK A;  2IPP B;  3PSE A;  2NQD B;  3N3K A;  3D6S A;  1FH0 A;  4BOQ A;  1PE6 A;  1U5I A;  1NB5 A;  2E00 A;  5EF4 A;  5A24 A;  4CDE B;  4OEL A;  1MS6 A;  4I04 A;  1CQD A;  1U9W A;  1KFU L;  2G7Y A;  3PHW A;  2DZY A;  3KKU A;  2BTW A;  3BCN A;  4CDC B;  1STF E;  3BB7 A;  3IV2 A;  2XU4 A;  2PBH A;  2HXZ A;  2DOS A;  3TRK A;  4MSX A;  3H7D A;  2FTD A;  1ICF A;  1CPJ A;  2BDZ A;  3E9S A;  3F5V A;  3P5X A;  4Q8H A;  3HWN A;  3K9M A;  3WXE A;  4P6E A;  1YAL A;  4Q8G A;  2CB5 A;  4PP1 A;  4R3D A;  1O0E A;  3WXF A;  1QXP A;  2R9N A;  3IOQ A;  4N8W A;  5JZE A;  1ZCM A;  2JQF R;  4YV8 A;  1QMY A;  1NQC A;  2HWK A;  1QOL A;  2F1G A;  1SP4 B;  1DEU A;  5FPW A;  1Y08 A;  4BQV A;  2R9M A;  4BPV A;  1MIR A;  4I07 A;  3PHX A;  3H6S A;  3OVZ A;  2ARY A;  1NLJ A;  1PXV A;  4I05 A;  3O65 A;  4BSQ A;  2UZJ A;  1EWM A;  3IEJ A;  4BOZ A;  1CS8 A;  3PHU A;  1GEC E;  2AGA A;  3HD3 A;  4YYQ A;  1EF7 A;  2FQ9 A;  1AU2 A;  2G8J A;  1GLO A;  4RY2 A;  2DCC A;  3USV A;  4ZUX U;  1ITO A;  2GFO A;  4DMY A;  1PVJ A;  3MTV A;  2F7D A;  2YJ9 A;  3ERV A;  3PNR A;  1NB3 A;  2JTC A;  1YT7 A;  2PAD A;  4YYR A;  2DC7 A;  3QJ3 A;  3C9E A;  2R6N A;  2XU3 A;  4K7C A;  2JQG R;  3NHE A;  3MOR A;  4QH6 A;  4QBB A;  1XKG A;  4PAD A;  3MP2 A;  3W30 A;  3CH3 X;  4AXL A;  4N79 A;  4AXM A;  4P6G A;  1KHP A;  2Z84 A;  1AIM A;  1NPZ A;  3PT2 A;  3BWK A;  1MDW A;  1QDQ A;  3PRP A;  1SNK A;  2E02 A;  1F2C A;  1NL6 A;  2ATO A;  3DF0 A;  2J7Q A;  3O1G A;  3IFU A;  1TU6 A;  2G8E A;  3N3G A;  4OW0 A;  4QRV A;  1KFX L;  3C0R A;  2P0R A;  4A5U A;  3PRM A;  3K8U A;  1PPN A;  2VHF A;  4DMX A; 
#chains in the Genus database with same CATH homology
 1K3B B;  3PDF A;  1CV8 A;  1VJV A;  4G54 A;  2P86 A;  3MHS A;  2VFC A;  1Q6K A;  4W4U A;  3H8B A;  4QRX A;  4BS6 A;  1BQI A;  2P7U A;  3S3Q A;  3MHH A;  3V6C A;  2OZ2 A;  2DCD A;  2G6D A;  1AEC A;  1TL9 A;  1KXR A;  1DF0 A;  4N4Z A;  2E01 A;  5JH3 A;  5F02 A;  1AU4 A;  4X6H A;  1VSN A;  1MEG A;  3OF9 A;  1CB5 A;  4X6J A;  1KHQ A;  2IBI A;  1BY8 A;  2Y5B A;  2XU1 A;  1AYU A;  2CIO A;  2DC8 A;  3RVW A;  4KLB A;  1JQP A;  4X6I A;  3CH2 X;  3WXG A;  3RVV A;  1CSB B;  4PP2 E;  5J94 A;  3IUT A;  4FK5 A;  3CBJ A;  2AUX A;  2H7J A;  2HD5 A;  1PPO A;  3S3R A;  2AU1 A;  1PIP A;  1F29 A;  3PBH A;  1Y4H A;  2FYE A;  4HWY A;  4YYU A;  2DC6 A;  2YJB A;  2AIM A;  2Y6E A;  2NQA A;  3BPF A;  2GHU A;  2R9O A;  1ZIV A;  6PAD A;  2DZZ A;  2ACT A;  1GMY A;  1PAD A;  3KWB X;  4YYV A;  1AYW A;  1U9X A;  1MEM A;  3H8C A;  1PPP A;  5PAD A;  1U9V A;  2HH5 A;  5EGW A;  3IHP A;  8PCH A;  2HHN A;  3P5W A;  2AUZ A;  4BGF A;  3TNX A;  2C0Y A;  2DJF B;  2YJ2 A;  3KX1 A;  3OVX A;  2FO5 A;  2FRA A;  3V6E A;  4C5P A;  5CHV A;  3LFY A;  5CVN B;  3N4C A;  2FUD A;  2BDL A;  3GCB A;  3OF8 A;  3IMA A;  1X9Y A;  1EWO A;  2PNS A;  1ME4 A;  3KSE A;  2AYN A;  4MZS A;  4WA6 A;  4CDF B;  1BP4 A;  3BC3 A;  4YVA A;  4W5C A;  4FJC A;  3M99 A;  1GCB A;  3ZUA A;  4OEM A;  1YVB A;  1THE A;  3LXS A;  3HHI A;  3QSD A;  1AU3 A;  7PCK A;  3K24 A;  4MZO A;  4W5B A;  3MTN A;  4PI3 A;  1YK7 A;  4CZW A;  3LTW A;  1CJL A;  1CTE A;  4CDD B;  2B1M A;  2OUL A;  2DCA A;  4XUI A;  1AU0 A;  2PRE A;  1TLO A;  2DC9 A;  3BOW A;  3OIS A;  3P5U A;  3B79 A;  3BPM A;  2E03 A;  3H89 A;  5K16 A;  5CHT A;  1PCI A;  3KWZ A;  1F2A A;  1A6R A;  5CVM A;  2WBF X;  3I3T A;  1AYV A;  1BGO A;  1E2T A;  2AS8 A;  4BS5 A;  4FIP A;  1EWL A;  2YJC A;  3PW3 A;  2DCB A;  3O0U A;  4NV7 A;  9PAP A;  1EWP A;  1YK8 A;  1S4V A;  3P5V A;  1U9Q X;  2O6X A;  3RVX A;  1PPD A;  4XR7 A;  2NQI A;  3I06 A;  1F2B A;  2XU5 A;  1ATK A;  2DJG B;  3QT4 A;  3AI8 A;  2VHS A;  1IWD A;  1M6D A;  2R9F A;  5CVO B;  4GUZ A;  3E1Z B;  2BSZ A;  2OP3 A;  2R9C A;  1ME3 A;  4QRG A;  2YJ8 A;  5JA7 A;  1CVZ A;  2B1N A;  3U8E A;  3KFQ A;  1POP A;  3F75 A;  4YYW A;  1MHW A;  3HHA A;  3KW9 A;  2FT2 A;  2AVW A;  4YYS A;  2AYO A;  2NQG A;  1HUC B;  2FRQ A;  1PBH A;  3CBK A;  2IPP B;  2NQD B;  3N3K A;  3D6S A;  1FH0 A;  1W6F A;  1PE6 A;  1U5I A;  1NB5 A;  1W5R A;  2E00 A;  5EF4 A;  5A24 A;  4CDE B;  4OEL A;  1MS6 A;  4I04 A;  1CQD A;  1U9W A;  1KFU L;  2G7Y A;  2DZY A;  3KKU A;  3BCN A;  4CDC B;  1STF E;  3IV2 A;  2XU4 A;  2PBH A;  2HXZ A;  4MSX A;  3H7D A;  2FTD A;  1ICF A;  1CPJ A;  2BDZ A;  3F5V A;  3P5X A;  4Q8H A;  3HWN A;  3K9M A;  3WXE A;  4P6E A;  1YAL A;  4Q8G A;  2CB5 A;  4PP1 A;  1O0E A;  3WXF A;  1QXP A;  2R9N A;  4NV8 A;  3IOQ A;  4N8W A;  1ZCM A;  2JQF R;  4YV8 A;  1QMY A;  1NQC A;  1QOL A;  2F1G A;  1SP4 B;  1GX3 A;  1DEU A;  5FPW A;  1Y08 A;  4BQV A;  2R9M A;  4BPV A;  1MIR A;  4I07 A;  3H6S A;  3OVZ A;  2ARY A;  1NLJ A;  1PXV A;  4I05 A;  4BSQ A;  1EWM A;  3IEJ A;  1CS8 A;  1GEC E;  3HD3 A;  4YYQ A;  1EF7 A;  2FQ9 A;  1AU2 A;  2G8J A;  1GLO A;  4RY2 A;  2DCC A;  3USV A;  4ZUX U;  1ITO A;  2GFO A;  4DMY A;  2F7D A;  2YJ9 A;  3ERV A;  3PNR A;  1NB3 A;  1YT7 A;  2PAD A;  4YYR A;  2DC7 A;  3QJ3 A;  3C9E A;  2R6N A;  2XU3 A;  4K7C A;  2JQG R;  3NHE A;  3MOR A;  4B55 A;  4QH6 A;  4QBB A;  1XKG A;  4PAD A;  3CH3 X;  3D9W A;  4AXL A;  4N79 A;  4AXM A;  4P6G A;  1KHP A;  1AIM A;  1NPZ A;  3BWK A;  1MDW A;  1QDQ A;  1SNK A;  2VFB A;  2E02 A;  1W4T A;  1F2C A;  1NL6 A;  2ATO A;  3DF0 A;  3O1G A;  1TU6 A;  2G8E A;  3N3G A;  4QRV A;  1KFX L;  2P0R A;  3K8U A;  1PPN A;  2VHF A;  4DMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...