4X6IA

Development of n-(functionalized benzoyl)-homocycloleucyl-glycinonitriles as potent cathepsin k inhibitors.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Development of N-(Functionalized benzoyl)-homocycloleucyl-glycinonitriles as Potent Cathepsin K Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4x6iA00
2VHFA 1CVZA 1NPZA 2NQDB 3HHIA 9PAPA 1JQPA 1AYUA 1YK7A 3CBJA 2ATOA 1PADA 1PCIA 3OF8A 2DCAA 3K9MA 4RY2A 1KFXL 3PW3A 3CH2X 2YJCA 5CVOB 3KX1A 1F29A 2NQIA 2GHUA 1MEGA 3ERVA 4BSQA 3H7DA 1O0EA 1PPDA 3V6EA 1SP4B 3WXGA 1TU6A 2AYOA 1KFUL 3OVXA 3ZUAA 1X9YA 2BDLA 3BPMA 1GCBA 3H89A 4W5CA 1KHPA 4MZOA 2XU5A 2NQAA 2R9CA 2JQFR 2G8EA 3LXSA 4BS6A 8PCHA 1KHQA 1AU3A 4X6IA 2JQGR 1CTEA 6PADA 1PPOA 1AU4A 2OP3A 2G6DA 3CH3X 1AIMA 4QRVA 1ZIVA 2AUXA 4DMYA 1YT7A 4QRGA 3OVZA 3P5UA 3V6CA 4BPVA 4YYUA 2FTDA 1PPNA 4YYWA 2Y6EA 3CBKA 3GCBA 3NHEA 3IV2A 3RVWA 3KWBX 4KLBA 5EF4A 3O0UA 1AYWA 1IWDA 2HD5A 1U9WA 3WXFA 2OZ2A 4N79A 2ARYA 2IBIA 4X6JA 1S4VA 3KWZA 1QDQA 1POPA 2BDZA 3KKUA 3LFYA 3MORA 1AU2A 2DC8A 4FIPA 1CJLA 3IHPA 1FH0A 3MTNA 1MS6A 2CIOA 2R9OA 2B1MA 4W5BA 1ATKA 4XUIA 1U9XA 2AS8A 1CB5A 4FK5A 1DF0A 1BQIA 1MHWA 1NB3A 1AECA 4DMXA 4WA6A 2R6NA 3PBHA 2F1GA 4OEMA 2F7DA 2XU4A 4W4UA 3BC3A 3H8BA 4QH6A 3H8CA 3P5WA 2PBHA 1VJVA 1PE6A 4YVAA 4CDFB 1EWPA 2OULA 4MSXA 2E02A 4YYQA 1CSBB 2PNSA 2HH5A 3BWKA 1EWLA 1MDWA 2DZZA 1TL9A 2VHSA 4BS5A 1Q6KA 3QJ3A 1GLOA 4CDDB 4I05A 3I3TA 2C0YA 1TLOA 1EF7A 3E1ZB 3O1GA 2GFOA 5CVMA 2XU1A 1F2BA 3F75A 1EWOA 4AXLA 1K3BB 3KSEA 2FYEA 3S3RA 7PCKA 5K16A 3BOWA 3MHHA 4YYRA 1STFE 2DCDA 5CVNB 1CV8A 2FUDA 2ACTA 1EWMA 4Q8HA 4FJCA 2DC7A 1GECE 4I07A 1Y08A 3QT4A 1F2AA 5JH3A 2FQ9A 1VSNA 2IPPB 4MZSA 4YYVA 4ZUXU 2YJBA 5F02A 1A6RA 3KW9A 2O6XA 3U8EA 3F5VA 3OISA 1PXVA 1BP4A 2E01A 1U9QX 2YJ9A 2DZYA 4N8WA 2P86A 1XKGA 3BCNA 3USVA 4N4ZA 2R9FA 4CZWA 2HXZA 4HWYA 4AXMA 4G54A 4PP2E 2FO5A 3C9EA 3IMAA 4I04A 1AU0A 4PI3A 1CPJA 1U5IA 3P5VA 2WBFX 1F2CA 1YK8A 1AYVA 3IOQA 1KXRA 3OF9A 5EGWA 1ITOA 5PADA 1QXPA 3DF0A 2G8JA 3WXEA 1SNKA 2R9MA 2AIMA 2P0RA 1Y4HA 4QRXA 1ME3A 1YVBA 2H7JA 2R9NA 3M99A 2DCCA 3K8UA 2G7YA 1THEA 4CDCB 1QOLA 3TNXA 5A24A 1U9VA 2DC6A 3P5XA 1DEUA 2DCBA 4X6HA 4PADA 4OELA 5CHVA 2FRAA 1M6DA 3RVXA 1QMYA 3HD3A 3KFQA 1ZCMA 1NLJA 1YALA 5J94A 2B1NA 2CB5A 3IEJA 1CS8A 4CDEB 2HHNA 4P6GA 3H6SA 2FT2A 1NL6A 1HUCB 2Y5BA 1CQDA 1BY8A 1NQCA 4YYSA 3RVVA 2AVWA 5FPWA 2AYNA 3S3QA 3AI8A 2E03A 3HWNA 1MIRA 3I06A 3N4CA 2AUZA 3BPFA 3IUTA 1PIPA 1MEMA 2FRQA 5CHTA 2NQGA 3HHAA 2E00A 2XU3A 4K7CA 4XR7A 4QBBA 1PPPA 2DJFB 3K24A 2PADA 4YV8A 4PP1A 1NB5A 2YJ2A 2P7UA 1BGOA 2DC9A 4BQVA 2YJ8A 3MHSA 1ICFA 3PDFA 3B79A 3D6SA 5JA7A 4Q8GA 1PBHA 3N3GA 2AU1A 3PNRA 1GMYA 2PREA 2DJGB 1ME4A 3QSDA 4P6EA 3N3KA
chains in the Genus database with same CATH superfamily
2DOSA 2VHFA 1CVZA 1NPZA 2NQDB 3HHIA 4MI7A 9PAPA 1JQPA 1AYUA 5JZEA 1YK7A 3CBJA 2ATOA 1PADA 1PCIA 3OF8A 2DCAA 1YZBA 3K9MA 4BOQA 4RY2A 1KFXL 3PW3A 3CH2X 2YJCA 2HWKA 5CVOB 3KX1A 1F29A 2NQIA 5EZQA 2GHUA 1MEGA 3ERVA 4BSQA 3H7DA 1O0EA 1PPDA 3V6EA 1SP4B 3WXGA 1TU6A 2AYOA 1KFUL 3OVXA 3ZUAA 1X9YA 2BDLA 3BPMA 2BU3A 4XZXA 4P16A 1GCBA 3H89A 4OVZA 3PHXA 4W5CA 1KHPA 4MZOA 2XU5A 2NQAA 2R9CA 2JQFR 2G8EA 2AGAA 3LXSA 4BS6A 8PCHA 1KHQA 3BY4A 1AU3A 4X6IA 2JQGR 1CTEA 6PADA 1PPOA 2J7QC 1AU4A 4RKXA 2OP3A 2G6DA 3PT2A 3CH3X 1AIMA 4QRVA 1ZIVA 2AUXA 4OVZB 3ZNHA 4GUAA 4DMYA 1YT7A 4QRGA 3OVZA 4RF1A 3P5UA 3V6CA 4BPVA 4D8BA 4YYUA 2FTDA 1PPNA 4YYWA 2Y6EA 3CBKA 4WURA 4MM3B 3OQCA 3GCBA 3NHEA 5KO3A 3IV2A 3RVWA 1DKIA 3KWBX 4KLBA 5EF4A 3C0RA 3O0UA 1AYWA 1IWDA 2HD5A 1U9WA 3WXFA 2OZ2A 3MTVA 4N79A 2ARYA 2IBIA 4X6JA 1S4VA 3KWZA 1QDQA 1POPA 2BDZA 3KKUA 3LFYA 3MORA 1AU2A 2DC8A 4FIPA 1CJLA 3IHPA 1FH0A 3MTNA 1MS6A 2Z84A 2CIOA 2R9OA 2B1MA 4W5BA 1ATKA 4XUIA 1U9XA 2AS8A 2UZJA 1CB5A 4FK5A 1DF0A 1BQIA 1MHWA 1NB3A 3IFUA 1AECA 4DMXA 4WA6A 3PRPA 2R6NA 3PBHA 2F1GA 4OEMA 2F7DA 2XU4A 4W4UA 3BC3A 3H8BA 4QH6A 3H8CA 3P5WA 2PBHA 1VJVA 1PE6A 4YVAA 4CDFB 1EWPA 2OULA 4MSXA 2E02A 4YYQA 1CSBB 2PNSA 2HH5A 3BWKA 1EWLA 1MDWA 2DZZA 1TL9A 2VHSA 4BS5A 1Q6KA 3PSEA 3QJ3A 1GLOA 4CDDB 4BOPA 4I05A 3I3TA 2C0YA 1TLOA 1EF7A 3E1ZB 3O1GA 2GFOA 2JRIA 5CVMA 2XU1A 4OW0A 1F2BA 3F75A 1EWOA 5E6JA 4AXLA 1K3BB 3KSEA 2FYEA 3S3RA 7PCKA 2FE8A 5K16A 3BOWA 3MHHA 4YYRA 1STFE 2DCDA 5CVNB 1CV8A 2BTWB 2FUDA 2ACTA 1EWMA 4Q8HA 4FJCA 2DC7A 1GECE 4I07A 1Y08A 3QT4A 1F2AA 5JH3A 2FQ9A 1VSNA 2IPPB 4MZSA 4YYVA 4ZUXU 2YJBA 3TRKA 5F02A 1A6RA 3KW9A 2O6XA 3U8EA 3F5VA 3O65A 3OISA 1PXVA 1BP4A 2E01A 1U9QX 2YJ9A 2DZYA 3TMPA 4N8WA 2P86A 1XKGA 4BOZA 3BCNA 3USVA 4N4ZA 2R9FA 4CZWA 2HXZA 4HWYA 4AXMA 2JTCA 3B21A 4G54A 2FO5A 3C9EA 4PP2E 3IMAA 4I04A 1AU0A 4PI3A 1CPJA 4BOUA 1U5IA 3P5VA 2WBFX 1F2CA 4A5UA 1YK8A 1AYVA 3IOQA 1KXRA 3OF9A 5EGWA 3RNVA 1ITOA 5PADA 1QXPA 3DF0A 2G8JA 3WXEA 1SNKA 3W31A 2R9MA 2AIMA 2P0RA 1Y4HA 4QRXA 1ME3A 1YVBA 2H7JA 2R9NA 3MJ5A 3M99A 2DCCA 3K8UA 2G7YA 1THEA 4CDCB 3W30A 1QOLA 3TNXA 5A24A 1U9VA 2DC6A 3P5XA 1DEUA 2DCBA 4X6HA 4PADA 4OELA 5EZSA 2BTWA 3E9SA 4REZA 5CHVA 2FRAA 1M6DA 3RVXA 1QMYA 3BBAA 3HD3A 3KFQA 1ZCMA 1NLJA 1YALA 5J94A 3PHWA 2B1NA 3PRMA 4PT5A 3BB7A 2CB5A 3IEJA 1CS8A 4CDEB 2HHNA 4P6GA 4IUMA 3H6SA 2FT2A 1NL6A 4D8IA 1HUCB 2Y5BA 1CQDA 2J7QA 1BY8A 3PHUA 1NQCA 4YYSA 3RVVA 2AVWA 5FPWA 2AYNA 3S3QA 3AI8A 4R3DA 2E03A 3HWNA 1MIRA 3I06A 3N4CA 2AUZA 3BPFA 1PVJA 3IUTA 1PIPA 4RF0A 1MEMA 2FRQA 5CHTA 4RNAA 2NQGA 4BOSA 3HHAA 4ZTBA 2E00A 2XU3A 4K7CA 4XR7A 4QBBA 1PPPA 2DJFB 3K24A 2PADA 4YV8A 4PP1A 1NB5A 4D8EA 2YJ2A 2P7UA 4HXDB 1BGOA 2DC9A 4BQVA 2YJ8A 3MHSA 4M0WA 1ICFA 4IP3A 3PDFA 3B79A 3D6SA 5JA7A 4Q8GA 1PBHA 3MP2A 2AU1A 3N3GA 3PNRA 1GMYA 2PREA 2DJGB 1ME4A 3QSDA 4P6EA 1UKFA 3N3KA
chains in the Genus database with same CATH topology
2VHFA 1CVZA 1NPZA 2NQDB 3HHIA 9PAPA 1JQPA 1AYUA 1YK7A 3CBJA 2ATOA 1PADA 1PCIA 3OF8A 1W6FA 2DCAA 3K9MA 4RY2A 1KFXL 3PW3A 3CH2X 2BSZA 2YJCA 5CVOB 3KX1A 1F29A 2NQIA 2GHUA 1MEGA 3ERVA 4BSQA 3H7DA 1O0EA 1PPDA 3V6EA 1SP4B 3WXGA 1TU6A 2AYOA 1KFUL 3OVXA 3ZUAA 1X9YA 2BDLA 3BPMA 1GCBA 3H89A 4BGFA 4W5CA 1KHPA 4MZOA 2XU5A 2NQAA 2R9CA 2JQFR 2G8EA 3LXSA 4BS6A 8PCHA 1KHQA 1AU3A 4X6IA 2JQGR 1CTEA 6PADA 1PPOA 1AU4A 2OP3A 2G6DA 3CH3X 1AIMA 4QRVA 1ZIVA 2AUXA 4DMYA 1YT7A 4QRGA 3OVZA 3P5UA 3V6CA 4BPVA 4YYUA 2FTDA 1PPNA 4YYWA 2Y6EA 3CBKA 3GCBA 3NHEA 3IV2A 3RVWA 3KWBX 4KLBA 4B55A 5EF4A 3O0UA 1AYWA 1IWDA 2HD5A 1U9WA 3WXFA 2OZ2A 4NV7A 4N79A 2ARYA 2IBIA 4X6JA 1S4VA 3KWZA 1QDQA 1POPA 2BDZA 3KKUA 3LFYA 3MORA 1AU2A 2DC8A 4FIPA 1CJLA 3IHPA 1FH0A 3MTNA 1MS6A 2CIOA 2R9OA 2B1MA 4W5BA 1ATKA 4XUIA 1U9XA 2AS8A 1CB5A 4FK5A 1DF0A 2VFCA 1BQIA 1MHWA 1NB3A 1AECA 4DMXA 4WA6A 2R6NA 3PBHA 2F1GA 4OEMA 2F7DA 2XU4A 4NV8A 4W4UA 3BC3A 3H8BA 4QH6A 3H8CA 3P5WA 2PBHA 1VJVA 1PE6A 4YVAA 4CDFB 1EWPA 2OULA 4MSXA 2E02A 4YYQA 1CSBB 2PNSA 3LTWA 2HH5A 3BWKA 1EWLA 1MDWA 2DZZA 1TL9A 2VHSA 4BS5A 1Q6KA 3QJ3A 1GLOA 4CDDB 4I05A 3I3TA 2C0YA 4GUZA 1TLOA 1EF7A 3E1ZB 3O1GA 2GFOA 5CVMA 2XU1A 1F2BA 4C5PA 3F75A 1EWOA 4AXLA 1W4TA 1K3BB 3KSEA 2FYEA 3S3RA 7PCKA 5K16A 3BOWA 3MHHA 4YYRA 1STFE 2DCDA 5CVNB 1CV8A 2FUDA 2ACTA 1EWMA 4Q8HA 4FJCA 2DC7A 1GECE 4I07A 1Y08A 3QT4A 1F2AA 5JH3A 2FQ9A 1VSNA 2IPPB 4MZSA 4YYVA 4ZUXU 2YJBA 5F02A 1A6RA 3KW9A 2O6XA 3U8EA 3F5VA 3OISA 1PXVA 1BP4A 2E01A 1U9QX 2YJ9A 2DZYA 4N8WA 2P86A 1XKGA 3BCNA 3USVA 4N4ZA 2R9FA 4CZWA 2HXZA 4HWYA 4AXMA 4G54A 2FO5A 3C9EA 4PP2E 3IMAA 4I04A 1AU0A 4PI3A 1CPJA 1U5IA 3P5VA 2WBFX 1F2CA 1YK8A 1AYVA 3IOQA 1KXRA 3OF9A 5EGWA 1ITOA 5PADA 1QXPA 3DF0A 2G8JA 3WXEA 1SNKA 2R9MA 2AIMA 2P0RA 1Y4HA 4QRXA 1ME3A 1YVBA 2H7JA 2R9NA 3M99A 2DCCA 3K8UA 2G7YA 1THEA 4CDCB 1QOLA 3TNXA 5A24A 1U9VA 2DC6A 3P5XA 1DEUA 2DCBA 4X6HA 4PADA 4OELA 5CHVA 2FRAA 1M6DA 3RVXA 1QMYA 3HD3A 3KFQA 1ZCMA 1NLJA 1YALA 5J94A 2B1NA 2CB5A 1GX3A 3IEJA 1CS8A 4CDEB 2HHNA 4P6GA 2VFBA 3H6SA 2FT2A 3D9WA 1NL6A 1HUCB 2Y5BA 1CQDA 1BY8A 1NQCA 4YYSA 3RVVA 2AVWA 5FPWA 2AYNA 3S3QA 3AI8A 2E03A 3HWNA 1MIRA 3I06A 3N4CA 2AUZA 3BPFA 3IUTA 1PIPA 1MEMA 2FRQA 5CHTA 2NQGA 3HHAA 2E00A 2XU3A 4K7CA 4XR7A 4QBBA 1PPPA 1W5RA 2DJFB 3K24A 1E2TA 2PADA 4YV8A 4PP1A 1NB5A 2YJ2A 2P7UA 1BGOA 2DC9A 4BQVA 2YJ8A 3MHSA 1ICFA 3PDFA 3B79A 3D6SA 5JA7A 4Q8GA 1PBHA 3N3GA 2AU1A 3PNRA 1GMYA 2PREA 2DJGB 1ME4A 3QSDA 4P6EA 3N3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VHF A;  1CVZ A;  1NPZ A;  2NQD B;  3HHI A;  9PAP A;  1JQP A;  1AYU A;  1YK7 A;  3CBJ A;  2ATO A;  1PAD A;  1PCI A;  3OF8 A;  2DCA A;  3K9M A;  4RY2 A;  1KFX L;  3PW3 A;  3CH2 X;  2YJC A;  5CVO B;  3KX1 A;  1F29 A;  2NQI A;  2GHU A;  1MEG A;  3ERV A;  4BSQ A;  3H7D A;  1O0E A;  1PPD A;  3V6E A;  1SP4 B;  3WXG A;  1TU6 A;  2AYO A;  1KFU L;  3OVX A;  3ZUA A;  1X9Y A;  2BDL A;  3BPM A;  1GCB A;  3H89 A;  4W5C A;  1KHP A;  4MZO A;  2XU5 A;  2NQA A;  2R9C A;  2JQF R;  2G8E A;  3LXS A;  4BS6 A;  8PCH A;  1KHQ A;  1AU3 A;  4X6I A;  2JQG R;  1CTE A;  6PAD A;  1PPO A;  1AU4 A;  2OP3 A;  2G6D A;  3CH3 X;  1AIM A;  4QRV A;  1ZIV A;  2AUX A;  4DMY A;  1YT7 A;  4QRG A;  3OVZ A;  3P5U A;  3V6C A;  4BPV A;  4YYU A;  2FTD A;  1PPN A;  4YYW A;  2Y6E A;  3CBK A;  3GCB A;  3NHE A;  3IV2 A;  3RVW A;  3KWB X;  4KLB A;  5EF4 A;  3O0U A;  1AYW A;  1IWD A;  2HD5 A;  1U9W A;  3WXF A;  2OZ2 A;  4N79 A;  2ARY A;  2IBI A;  4X6J A;  1S4V A;  3KWZ A;  1QDQ A;  1POP A;  2BDZ A;  3KKU A;  3LFY A;  3MOR A;  1AU2 A;  2DC8 A;  4FIP A;  1CJL A;  3IHP A;  1FH0 A;  3MTN A;  1MS6 A;  2CIO A;  2R9O A;  2B1M A;  4W5B A;  1ATK A;  4XUI A;  1U9X A;  2AS8 A;  1CB5 A;  4FK5 A;  1DF0 A;  1BQI A;  1MHW A;  1NB3 A;  1AEC A;  4DMX A;  4WA6 A;  2R6N A;  3PBH A;  2F1G A;  4OEM A;  2F7D A;  2XU4 A;  4W4U A;  3BC3 A;  3H8B A;  4QH6 A;  3H8C A;  3P5W A;  2PBH A;  1VJV A;  1PE6 A;  4YVA A;  4CDF B;  1EWP A;  2OUL A;  4MSX A;  2E02 A;  4YYQ A;  1CSB B;  2PNS A;  2HH5 A;  3BWK A;  1EWL A;  1MDW A;  2DZZ A;  1TL9 A;  2VHS A;  4BS5 A;  1Q6K A;  3QJ3 A;  1GLO A;  4CDD B;  4I05 A;  3I3T A;  2C0Y A;  1TLO A;  1EF7 A;  3E1Z B;  3O1G A;  2GFO A;  5CVM A;  2XU1 A;  1F2B A;  3F75 A;  1EWO A;  4AXL A;  1K3B B;  3KSE A;  2FYE A;  3S3R A;  7PCK A;  5K16 A;  3BOW A;  3MHH A;  4YYR A;  1STF E;  2DCD A;  5CVN B;  1CV8 A;  2FUD A;  2ACT A;  1EWM A;  4Q8H A;  4FJC A;  2DC7 A;  1GEC E;  4I07 A;  1Y08 A;  3QT4 A;  1F2A A;  5JH3 A;  2FQ9 A;  1VSN A;  2IPP B;  4MZS A;  4YYV A;  4ZUX U;  2YJB A;  5F02 A;  1A6R A;  3KW9 A;  2O6X A;  3U8E A;  3F5V A;  3OIS A;  1PXV A;  1BP4 A;  2E01 A;  1U9Q X;  2YJ9 A;  2DZY A;  4N8W A;  2P86 A;  1XKG A;  3BCN A;  3USV A;  4N4Z A;  2R9F A;  4CZW A;  2HXZ A;  4HWY A;  4AXM A;  4G54 A;  4PP2 E;  2FO5 A;  3C9E A;  3IMA A;  4I04 A;  1AU0 A;  4PI3 A;  1CPJ A;  1U5I A;  3P5V A;  2WBF X;  1F2C A;  1YK8 A;  1AYV A;  3IOQ A;  1KXR A;  3OF9 A;  5EGW A;  1ITO A;  5PAD A;  1QXP A;  3DF0 A;  2G8J A;  3WXE A;  1SNK A;  2R9M A;  2AIM A;  2P0R A;  1Y4H A;  4QRX A;  1ME3 A;  1YVB A;  2H7J A;  2R9N A;  3M99 A;  2DCC A;  3K8U A;  2G7Y A;  1THE A;  4CDC B;  1QOL A;  3TNX A;  5A24 A;  1U9V A;  2DC6 A;  3P5X A;  1DEU A;  2DCB A;  4X6H A;  4PAD A;  4OEL A;  5CHV A;  2FRA A;  1M6D A;  3RVX A;  1QMY A;  3HD3 A;  3KFQ A;  1ZCM A;  1NLJ A;  1YAL A;  5J94 A;  2B1N A;  2CB5 A;  3IEJ A;  1CS8 A;  4CDE B;  2HHN A;  4P6G A;  3H6S A;  2FT2 A;  1NL6 A;  1HUC B;  2Y5B A;  1CQD A;  1BY8 A;  1NQC A;  4YYS A;  3RVV A;  2AVW A;  5FPW A;  2AYN A;  3S3Q A;  3AI8 A;  2E03 A;  3HWN A;  1MIR A;  3I06 A;  3N4C A;  2AUZ A;  3BPF A;  3IUT A;  1PIP A;  1MEM A;  2FRQ A;  5CHT A;  2NQG A;  3HHA A;  2E00 A;  2XU3 A;  4K7C A;  4XR7 A;  4QBB A;  1PPP A;  2DJF B;  3K24 A;  2PAD A;  4YV8 A;  4PP1 A;  1NB5 A;  2YJ2 A;  2P7U A;  1BGO A;  2DC9 A;  4BQV A;  2YJ8 A;  3MHS A;  1ICF A;  3PDF A;  3B79 A;  3D6S A;  5JA7 A;  4Q8G A;  1PBH A;  3N3G A;  2AU1 A;  3PNR A;  1GMY A;  2PRE A;  2DJG B;  1ME4 A;  3QSD A;  4P6E A;  3N3K A; 
#chains in the Genus database with same CATH topology
 2DOS A;  2VHF A;  1CVZ A;  1NPZ A;  2NQD B;  3HHI A;  4MI7 A;  9PAP A;  1JQP A;  1AYU A;  5JZE A;  1YK7 A;  3CBJ A;  2ATO A;  1PAD A;  1PCI A;  3OF8 A;  2DCA A;  1YZB A;  3K9M A;  4BOQ A;  4RY2 A;  1KFX L;  3PW3 A;  3CH2 X;  2YJC A;  2HWK A;  5CVO B;  3KX1 A;  1F29 A;  2NQI A;  5EZQ A;  2GHU A;  1MEG A;  3ERV A;  4BSQ A;  3H7D A;  1O0E A;  1PPD A;  3V6E A;  1SP4 B;  3WXG A;  1TU6 A;  2AYO A;  1KFU L;  3OVX A;  3ZUA A;  1X9Y A;  2BDL A;  3BPM A;  2BU3 A;  4XZX A;  4P16 A;  1GCB A;  3H89 A;  4OVZ A;  3PHX A;  4W5C A;  1KHP A;  4MZO A;  2XU5 A;  2NQA A;  2R9C A;  2JQF R;  2G8E A;  2AGA A;  3LXS A;  4BS6 A;  8PCH A;  1KHQ A;  3BY4 A;  1AU3 A;  4X6I A;  2JQG R;  1CTE A;  6PAD A;  1PPO A;  2J7Q C;  1AU4 A;  4RKX A;  2OP3 A;  2G6D A;  3PT2 A;  3CH3 X;  1AIM A;  4QRV A;  1ZIV A;  2AUX A;  4OVZ B;  3ZNH A;  4GUA A;  4DMY A;  1YT7 A;  4QRG A;  3OVZ A;  4RF1 A;  3P5U A;  3V6C A;  4BPV A;  4D8B A;  4YYU A;  2FTD A;  1PPN A;  4YYW A;  2Y6E A;  3CBK A;  4WUR A;  4MM3 B;  3OQC A;  3GCB A;  3NHE A;  5KO3 A;  3IV2 A;  3RVW A;  1DKI A;  3KWB X;  4KLB A;  5EF4 A;  3C0R A;  3O0U A;  1AYW A;  1IWD A;  2HD5 A;  1U9W A;  3WXF A;  2OZ2 A;  3MTV A;  4N79 A;  2ARY A;  2IBI A;  4X6J A;  1S4V A;  3KWZ A;  1QDQ A;  1POP A;  2BDZ A;  3KKU A;  3LFY A;  3MOR A;  1AU2 A;  2DC8 A;  4FIP A;  1CJL A;  3IHP A;  1FH0 A;  3MTN A;  1MS6 A;  2Z84 A;  2CIO A;  2R9O A;  2B1M A;  4W5B A;  1ATK A;  4XUI A;  1U9X A;  2AS8 A;  2UZJ A;  1CB5 A;  4FK5 A;  1DF0 A;  1BQI A;  1MHW A;  1NB3 A;  3IFU A;  1AEC A;  4DMX A;  4WA6 A;  3PRP A;  2R6N A;  3PBH A;  2F1G A;  4OEM A;  2F7D A;  2XU4 A;  4W4U A;  3BC3 A;  3H8B A;  4QH6 A;  3H8C A;  3P5W A;  2PBH A;  1VJV A;  1PE6 A;  4YVA A;  4CDF B;  1EWP A;  2OUL A;  4MSX A;  2E02 A;  4YYQ A;  1CSB B;  2PNS A;  2HH5 A;  3BWK A;  1EWL A;  1MDW A;  2DZZ A;  1TL9 A;  2VHS A;  4BS5 A;  1Q6K A;  3PSE A;  3QJ3 A;  1GLO A;  4CDD B;  4BOP A;  4I05 A;  3I3T A;  2C0Y A;  1TLO A;  1EF7 A;  3E1Z B;  3O1G A;  2GFO A;  2JRI A;  5CVM A;  2XU1 A;  4OW0 A;  1F2B A;  3F75 A;  1EWO A;  5E6J A;  4AXL A;  1K3B B;  3KSE A;  2FYE A;  3S3R A;  7PCK A;  2FE8 A;  5K16 A;  3BOW A;  3MHH A;  4YYR A;  1STF E;  2DCD A;  5CVN B;  1CV8 A;  2BTW B;  2FUD A;  2ACT A;  1EWM A;  4Q8H A;  4FJC A;  2DC7 A;  1GEC E;  4I07 A;  1Y08 A;  3QT4 A;  1F2A A;  5JH3 A;  2FQ9 A;  1VSN A;  2IPP B;  4MZS A;  4YYV A;  4ZUX U;  2YJB A;  3TRK A;  5F02 A;  1A6R A;  3KW9 A;  2O6X A;  3U8E A;  3F5V A;  3O65 A;  3OIS A;  1PXV A;  1BP4 A;  2E01 A;  1U9Q X;  2YJ9 A;  2DZY A;  3TMP A;  4N8W A;  2P86 A;  1XKG A;  4BOZ A;  3BCN A;  3USV A;  4N4Z A;  2R9F A;  4CZW A;  2HXZ A;  4HWY A;  4AXM A;  2JTC A;  3B21 A;  4G54 A;  2FO5 A;  3C9E A;  4PP2 E;  3IMA A;  4I04 A;  1AU0 A;  4PI3 A;  1CPJ A;  4BOU A;  1U5I A;  3P5V A;  2WBF X;  1F2C A;  4A5U A;  1YK8 A;  1AYV A;  3IOQ A;  1KXR A;  3OF9 A;  5EGW A;  3RNV A;  1ITO A;  5PAD A;  1QXP A;  3DF0 A;  2G8J A;  3WXE A;  1SNK A;  3W31 A;  2R9M A;  2AIM A;  2P0R A;  1Y4H A;  4QRX A;  1ME3 A;  1YVB A;  2H7J A;  2R9N A;  3MJ5 A;  3M99 A;  2DCC A;  3K8U A;  2G7Y A;  1THE A;  4CDC B;  3W30 A;  1QOL A;  3TNX A;  5A24 A;  1U9V A;  2DC6 A;  3P5X A;  1DEU A;  2DCB A;  4X6H A;  4PAD A;  4OEL A;  5EZS A;  2BTW A;  3E9S A;  4REZ A;  5CHV A;  2FRA A;  1M6D A;  3RVX A;  1QMY A;  3BBA A;  3HD3 A;  3KFQ A;  1ZCM A;  1NLJ A;  1YAL A;  5J94 A;  3PHW A;  2B1N A;  3PRM A;  4PT5 A;  3BB7 A;  2CB5 A;  3IEJ A;  1CS8 A;  4CDE B;  2HHN A;  4P6G A;  4IUM A;  3H6S A;  2FT2 A;  1NL6 A;  4D8I A;  1HUC B;  2Y5B A;  1CQD A;  2J7Q A;  1BY8 A;  3PHU A;  1NQC A;  4YYS A;  3RVV A;  2AVW A;  5FPW A;  2AYN A;  3S3Q A;  3AI8 A;  4R3D A;  2E03 A;  3HWN A;  1MIR A;  3I06 A;  3N4C A;  2AUZ A;  3BPF A;  1PVJ A;  3IUT A;  1PIP A;  4RF0 A;  1MEM A;  2FRQ A;  5CHT A;  4RNA A;  2NQG A;  4BOS A;  3HHA A;  4ZTB A;  2E00 A;  2XU3 A;  4K7C A;  4XR7 A;  4QBB A;  1PPP A;  2DJF B;  3K24 A;  2PAD A;  4YV8 A;  4PP1 A;  1NB5 A;  4D8E A;  2YJ2 A;  2P7U A;  4HXD B;  1BGO A;  2DC9 A;  4BQV A;  2YJ8 A;  3MHS A;  4M0W A;  1ICF A;  4IP3 A;  3PDF A;  3B79 A;  3D6S A;  5JA7 A;  4Q8G A;  1PBH A;  3MP2 A;  2AU1 A;  3N3G A;  3PNR A;  1GMY A;  2PRE A;  2DJG B;  1ME4 A;  3QSD A;  4P6E A;  1UKF A;  3N3K A; 
#chains in the Genus database with same CATH homology
 2VHF A;  1CVZ A;  1NPZ A;  2NQD B;  3HHI A;  9PAP A;  1JQP A;  1AYU A;  1YK7 A;  3CBJ A;  2ATO A;  1PAD A;  1PCI A;  3OF8 A;  1W6F A;  2DCA A;  3K9M A;  4RY2 A;  1KFX L;  3PW3 A;  3CH2 X;  2BSZ A;  2YJC A;  5CVO B;  3KX1 A;  1F29 A;  2NQI A;  2GHU A;  1MEG A;  3ERV A;  4BSQ A;  3H7D A;  1O0E A;  1PPD A;  3V6E A;  1SP4 B;  3WXG A;  1TU6 A;  2AYO A;  1KFU L;  3OVX A;  3ZUA A;  1X9Y A;  2BDL A;  3BPM A;  1GCB A;  3H89 A;  4BGF A;  4W5C A;  1KHP A;  4MZO A;  2XU5 A;  2NQA A;  2R9C A;  2JQF R;  2G8E A;  3LXS A;  4BS6 A;  8PCH A;  1KHQ A;  1AU3 A;  4X6I A;  2JQG R;  1CTE A;  6PAD A;  1PPO A;  1AU4 A;  2OP3 A;  2G6D A;  3CH3 X;  1AIM A;  4QRV A;  1ZIV A;  2AUX A;  4DMY A;  1YT7 A;  4QRG A;  3OVZ A;  3P5U A;  3V6C A;  4BPV A;  4YYU A;  2FTD A;  1PPN A;  4YYW A;  2Y6E A;  3CBK A;  3GCB A;  3NHE A;  3IV2 A;  3RVW A;  3KWB X;  4KLB A;  4B55 A;  5EF4 A;  3O0U A;  1AYW A;  1IWD A;  2HD5 A;  1U9W A;  3WXF A;  2OZ2 A;  4NV7 A;  4N79 A;  2ARY A;  2IBI A;  4X6J A;  1S4V A;  3KWZ A;  1QDQ A;  1POP A;  2BDZ A;  3KKU A;  3LFY A;  3MOR A;  1AU2 A;  2DC8 A;  4FIP A;  1CJL A;  3IHP A;  1FH0 A;  3MTN A;  1MS6 A;  2CIO A;  2R9O A;  2B1M A;  4W5B A;  1ATK A;  4XUI A;  1U9X A;  2AS8 A;  1CB5 A;  4FK5 A;  1DF0 A;  2VFC A;  1BQI A;  1MHW A;  1NB3 A;  1AEC A;  4DMX A;  4WA6 A;  2R6N A;  3PBH A;  2F1G A;  4OEM A;  2F7D A;  2XU4 A;  4NV8 A;  4W4U A;  3BC3 A;  3H8B A;  4QH6 A;  3H8C A;  3P5W A;  2PBH A;  1VJV A;  1PE6 A;  4YVA A;  4CDF B;  1EWP A;  2OUL A;  4MSX A;  2E02 A;  4YYQ A;  1CSB B;  2PNS A;  3LTW A;  2HH5 A;  3BWK A;  1EWL A;  1MDW A;  2DZZ A;  1TL9 A;  2VHS A;  4BS5 A;  1Q6K A;  3QJ3 A;  1GLO A;  4CDD B;  4I05 A;  3I3T A;  2C0Y A;  4GUZ A;  1TLO A;  1EF7 A;  3E1Z B;  3O1G A;  2GFO A;  5CVM A;  2XU1 A;  1F2B A;  4C5P A;  3F75 A;  1EWO A;  4AXL A;  1W4T A;  1K3B B;  3KSE A;  2FYE A;  3S3R A;  7PCK A;  5K16 A;  3BOW A;  3MHH A;  4YYR A;  1STF E;  2DCD A;  5CVN B;  1CV8 A;  2FUD A;  2ACT A;  1EWM A;  4Q8H A;  4FJC A;  2DC7 A;  1GEC E;  4I07 A;  1Y08 A;  3QT4 A;  1F2A A;  5JH3 A;  2FQ9 A;  1VSN A;  2IPP B;  4MZS A;  4YYV A;  4ZUX U;  2YJB A;  5F02 A;  1A6R A;  3KW9 A;  2O6X A;  3U8E A;  3F5V A;  3OIS A;  1PXV A;  1BP4 A;  2E01 A;  1U9Q X;  2YJ9 A;  2DZY A;  4N8W A;  2P86 A;  1XKG A;  3BCN A;  3USV A;  4N4Z A;  2R9F A;  4CZW A;  2HXZ A;  4HWY A;  4AXM A;  4G54 A;  2FO5 A;  3C9E A;  4PP2 E;  3IMA A;  4I04 A;  1AU0 A;  4PI3 A;  1CPJ A;  1U5I A;  3P5V A;  2WBF X;  1F2C A;  1YK8 A;  1AYV A;  3IOQ A;  1KXR A;  3OF9 A;  5EGW A;  1ITO A;  5PAD A;  1QXP A;  3DF0 A;  2G8J A;  3WXE A;  1SNK A;  2R9M A;  2AIM A;  2P0R A;  1Y4H A;  4QRX A;  1ME3 A;  1YVB A;  2H7J A;  2R9N A;  3M99 A;  2DCC A;  3K8U A;  2G7Y A;  1THE A;  4CDC B;  1QOL A;  3TNX A;  5A24 A;  1U9V A;  2DC6 A;  3P5X A;  1DEU A;  2DCB A;  4X6H A;  4PAD A;  4OEL A;  5CHV A;  2FRA A;  1M6D A;  3RVX A;  1QMY A;  3HD3 A;  3KFQ A;  1ZCM A;  1NLJ A;  1YAL A;  5J94 A;  2B1N A;  2CB5 A;  1GX3 A;  3IEJ A;  1CS8 A;  4CDE B;  2HHN A;  4P6G A;  2VFB A;  3H6S A;  2FT2 A;  3D9W A;  1NL6 A;  1HUC B;  2Y5B A;  1CQD A;  1BY8 A;  1NQC A;  4YYS A;  3RVV A;  2AVW A;  5FPW A;  2AYN A;  3S3Q A;  3AI8 A;  2E03 A;  3HWN A;  1MIR A;  3I06 A;  3N4C A;  2AUZ A;  3BPF A;  3IUT A;  1PIP A;  1MEM A;  2FRQ A;  5CHT A;  2NQG A;  3HHA A;  2E00 A;  2XU3 A;  4K7C A;  4XR7 A;  4QBB A;  1PPP A;  1W5R A;  2DJF B;  3K24 A;  1E2T A;  2PAD A;  4YV8 A;  4PP1 A;  1NB5 A;  2YJ2 A;  2P7U A;  1BGO A;  2DC9 A;  4BQV A;  2YJ8 A;  3MHS A;  1ICF A;  3PDF A;  3B79 A;  3D6S A;  5JA7 A;  4Q8G A;  1PBH A;  3N3G A;  2AU1 A;  3PNR A;  1GMY A;  2PRE A;  2DJG B;  1ME4 A;  3QSD A;  4P6E A;  3N3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...