1YALA

Carica papaya chymopapain at 1.7 angstroms resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
218
structure length
216
Chain Sequence
b'YPQSIDWRAKGAVTPVKNQGACGSWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFKGFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOPAPAIN
publication title Structure of chymopapain at 1.7 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 216
sequence length 218
ec nomenclature ec 3.4.22.6: Chymopapain.
pdb deposition date 1996-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yalA00
4G54A 3P5UA 2YJ2A 3TNXA 4AXMA 1QXPA 1CQDA 3MHSA 2HHNA 3KX1A 4CDCB 2E03A 3N3KA 4AXLA 3HHIA 2NQGA 1QOLA 4QRGA 2P86A 3H89A 1GLOA 2AUZA 1AU4A 2VHSA 1AYVA 2AS8A 1VSNA 3OVZA 1Y08A 1DF0A 4W5CA 3S3QA 2NQAA 1X9YA 2HXZA 2E01A 3N4CA 2YJ9A 4K7CA 3B79A 3D6SA 1ITOA 3O0UA 3ERVA 4P6GA 1F2CA 3H6SA 3NHEA 4BSQA 2GFOA 4CDEB 5CHVA 3USVA 1GCBA 3RVVA 1AU2A 2R9OA 1PCIA 1EWPA 2AUXA 4YYQA 2OULA 3IUTA 1MIRA 5K16A 1F2BA 3HWNA 3K9MA 3F5VA 4CZWA 1KFXL 2NQDB 1YK7A 2E00A 2DC7A 3IOQA 2OP3A 2WBFX 1AYWA 1Y4HA 2R9CA 2DCBA 5CHTA 3BWKA 1EF7A 2G8JA 3KKUA 2FQ9A 3H7DA 1STFE 2Y6EA 2R9MA 5EF4A 5JA7A 4X6JA 2FRQA 2DC9A 1CTEA 2P0RA 3OISA 2YJ8A 7PCKA 3KW9A 1NB3A 4YYVA 1BY8A 1CPJA 1MEMA 1U9VA 2G6DA 1TU6A 5A24A 1NPZA 3BOWA 1CB5A 5FPWA 1EWLA 2DJFB 2ATOA 4QRXA 2FTDA 2JQFR 3H8CA 4MZOA 1GMYA 2FUDA 4KLBA 1SNKA 4YYRA 3RVWA 3QJ3A 4YYSA 1NL6A 4PP2E 2O6XA 4W5BA 1AIMA 2AYOA 2VHFA 4BPVA 3P5WA 3S3RA 1NLJA 3M99A 2R9FA 4YV8A 1ME3A 1ZCMA 1MDWA 1ZIVA 3WXFA 3BPFA 3IEJA 1FH0A 1YALA 1YT7A 2F7DA 2PREA 1YK8A 3C9EA 3GCBA 1PPNA 2IPPB 3MHHA 3PBHA 3IV2A 2BDZA 4QH6A 2DJGB 1POPA 6PADA 3P5VA 2XU5A 2FYEA 2B1NA 2PADA 4X6IA 2CIOA 3H8BA 1PPDA 2DC8A 4XUIA 1PIPA 4FIPA 1QDQA 2FO5A 2G8EA 3V6CA 4DMYA 1PADA 3BCNA 2JQGR 3LFYA 2HD5A 2AU1A 4PADA 1DEUA 3I06A 3ZUAA 4QRVA 3PW3A 1TL9A 3QSDA 3P5XA 1F29A 2IBIA 4OEMA 3OF8A 2FRAA 2DZZA 4HWYA 2P7UA 2E02A 2C0YA 3PNRA 3HD3A 1MEGA 2R9NA 4N4ZA 3E1ZB 4YYUA 2DC6A 2DZYA 2YJCA 1QMYA 4YYWA 4YVAA 1F2AA 3MTNA 1M6DA 3KSEA 4Q8GA 1Q6KA 3IHPA 4Q8HA 3F75A 2YJBA 2DCCA 1U9WA 3KWBX 1THEA 4PI3A 3N3GA 3KFQA 1CSBB 1AU0A 1AYUA 9PAPA 4WA6A 1XKGA 3CH2X 4OELA 2ACTA 3V6EA 2PNSA 2AYNA 2R6NA 2B1MA 1NQCA 2AIMA 1U5IA 1YVBA 1SP4B 4RY2A 1JQPA 3RVXA 2Y5BA 2GHUA 4BQVA 2FT2A 4DMXA 4MSXA 1CS8A 5CVMA 5J94A 4MZSA 4N79A 5F02A 1U9XA 1BP4A 1CV8A 2OZ2A 3BC3A 2AVWA 1PXVA 1HUCB 1KFUL 4CDDB 1AU3A 2HH5A 3OF9A 3OVXA 4N8WA 3LXSA 4I07A 3I3TA 1PPPA 3QT4A 5JH3A 1O0EA 2CB5A 2H7JA 4BS5A 1K3BB 4QBBA 1VJVA 2PBHA 3PDFA 1EWOA 4XR7A 1MS6A 4I05A 4W4UA 1PBHA 1IWDA 3WXEA 5EGWA 1ME4A 3HHAA 4ZUXU 2XU1A 4CDFB 1BGOA 1KHQA 1NB5A 3K8UA 1A6RA 3O1GA 5CVNB 3CBJA 3K24A 3DF0A 1BQIA 4PP1A 2DCAA 3KWZA 8PCHA 2XU4A 3CBKA 3MORA 1MHWA 1U9QX 1TLOA 2BDLA 1CVZA 3BPMA 4FK5A 5PADA 2XU3A 4X6HA 4BS6A 4FJCA 1EWMA 1S4VA 1ICFA 1KXRA 3IMAA 2F1GA 4I04A 5CVOB 4P6EA 3WXGA 1PPOA 3CH3X 2ARYA 3AI8A 1PE6A 1GECE 2DCDA 1AECA 2G7YA 2NQIA 3U8EA 1CJLA 1ATKA 1KHPA
chains in the Genus database with same CATH superfamily
4G54A 3P5UA 2YJ2A 3TNXA 4AXMA 1QXPA 1CQDA 3MHSA 2HHNA 3KX1A 4CDCB 2E03A 3N3KA 4AXLA 2FE8A 3HHIA 2NQGA 1QOLA 4QRGA 2P86A 3H89A 1GLOA 2AUZA 5EZQA 1AU4A 2VHSA 1AYVA 2AS8A 1VSNA 3OVZA 1Y08A 4PT5A 1DF0A 4W5CA 3S3QA 4D8EA 2NQAA 1X9YA 2HXZA 2E01A 3N4CA 2YJ9A 4K7CA 3B79A 3D6SA 1ITOA 3O0UA 3ERVA 2DOSA 4ZTBA 3TRKA 4P6GA 2BU3A 1F2CA 3H6SA 3NHEA 3O65A 4BSQA 2GFOA 4CDEB 5CHVA 3PRMA 3USVA 1GCBA 3RVVA 1AU2A 2R9OA 4WURA 1PCIA 1EWPA 2AUXA 4YYQA 4BOZA 5KO3A 2OULA 3IUTA 1MIRA 5K16A 1F2BA 3HWNA 5E6JA 3K9MA 4BOSA 3F5VA 4CZWA 1KFXL 2NQDB 1YK7A 2E00A 2DC7A 3IOQA 2OP3A 2WBFX 1AYWA 4MM3B 1Y4HA 2R9CA 2DCBA 5CHTA 3BWKA 1EF7A 2G8JA 3KKUA 2FQ9A 3PT2A 2UZJA 3H7DA 1STFE 1PVJA 2Y6EA 2R9MA 5EF4A 5JA7A 4X6JA 2FRQA 2DC9A 1CTEA 2P0RA 3OISA 2YJ8A 7PCKA 3KW9A 1NB3A 3W31A 4YYVA 1BY8A 3PSEA 1CPJA 1MEMA 1U9VA 2G6DA 1TU6A 5A24A 1NPZA 3BOWA 1CB5A 2HWKA 5FPWA 1EWLA 2DJFB 2ATOA 4QRXA 2FTDA 2JQFR 3H8CA 4MZOA 1GMYA 2FUDA 4KLBA 1SNKA 4YYRA 3RVWA 3QJ3A 5JZEA 4YYSA 1NL6A 4PP2E 2O6XA 4W5BA 1AIMA 2AYOA 4RF1A 2VHFA 4BPVA 3E9SA 3P5WA 3S3RA 1NLJA 3M99A 2R9FA 4YV8A 1ME3A 4XZXA 1ZCMA 1MDWA 3W30A 3MJ5A 1ZIVA 3WXFA 4OVZA 3BPFA 3IEJA 1FH0A 1YALA 3B21A 1YT7A 2F7DA 2PREA 1YK8A 3C9EA 3GCBA 1PPNA 2IPPB 3MHHA 3PBHA 3IV2A 2BDZA 4QH6A 2DJGB 1POPA 6PADA 3P5VA 2XU5A 2FYEA 2B1NA 2PADA 4X6IA 2CIOA 3H8BA 1PPDA 3ZNHA 2DC8A 4XUIA 1PIPA 5EZSA 4FIPA 1QDQA 4D8IA 2FO5A 2G8EA 3V6CA 4DMYA 1PADA 3BCNA 2JQGR 4REZA 3LFYA 2HD5A 2AU1A 4RKXA 2AGAA 4BOQA 4PADA 1DEUA 3I06A 3ZUAA 4QRVA 3PW3A 1TL9A 3QSDA 3IFUA 3P5XA 1F29A 2IBIA 4OEMA 3BY4A 3BBAA 3OF8A 4M0WA 4D8BA 2FRAA 2DZZA 3PHUA 3OQCA 4HWYA 2P7UA 2E02A 2C0YA 4OVZB 3PNRA 2J7QC 3HD3A 1MEGA 2R9NA 4IUMA 4N4ZA 3E1ZB 4YYUA 2DC6A 4BOUA 2DZYA 2YJCA 1QMYA 4YYWA 4BOPA 4YVAA 2BTWB 1F2AA 3MTNA 1M6DA 3KSEA 4Q8GA 1Q6KA 3IHPA 4Q8HA 3BB7A 3F75A 2YJBA 2DCCA 1U9WA 2JTCA 3KWBX 3PHWA 1THEA 4PI3A 3N3GA 3RNVA 3KFQA 1CSBB 1AU0A 1AYUA 9PAPA 4WA6A 1XKGA 3CH2X 4OELA 2ACTA 3V6EA 2PNSA 2AYNA 3MTVA 2R6NA 2B1MA 1NQCA 2AIMA 1U5IA 1YVBA 3TMPA 1SP4B 4RY2A 1JQPA 3RVXA 2Y5BA 2GHUA 4MI7A 2FT2A 4BQVA 4DMXA 4MSXA 1CS8A 5CVMA 5J94A 4MZSA 4N79A 2BTWA 5F02A 1U9XA 1BP4A 1CV8A 2OZ2A 3BC3A 2AVWA 1PXVA 1HUCB 1KFUL 4CDDB 1AU3A 2HH5A 3OF9A 3OVXA 4HXDB 4N8WA 3LXSA 4I07A 3I3TA 1PPPA 3QT4A 3MP2A 5JH3A 1O0EA 2CB5A 2H7JA 4BS5A 1K3BB 4QBBA 1VJVA 2PBHA 3PDFA 1EWOA 2J7QA 4RNAA 4XR7A 1MS6A 4I05A 4A5UA 4P16A 4W4UA 1PBHA 4RF0A 1IWDA 3WXEA 5EGWA 1ME4A 3HHAA 4ZUXU 2XU1A 4CDFB 1BGOA 1KHQA 1NB5A 2JRIA 3K8UA 1A6RA 3O1GA 5CVNB 3CBJA 3K24A 3DF0A 1BQIA 4PP1A 2DCAA 3KWZA 2Z84A 1DKIA 8PCHA 1YZBA 2XU4A 3CBKA 3MORA 1MHWA 1U9QX 1TLOA 2BDLA 1CVZA 3BPMA 4FK5A 5PADA 2XU3A 4X6HA 4BS6A 4FJCA 4GUAA 4R3DA 1EWMA 4IP3A 3PRPA 1UKFA 1S4VA 1ICFA 1KXRA 3IMAA 2F1GA 4I04A 5CVOB 4P6EA 3WXGA 1PPOA 3CH3X 3C0RA 2ARYA 3AI8A 1PE6A 1GECE 2DCDA 1AECA 3PHXA 2G7YA 2NQIA 4OW0A 3U8EA 1CJLA 1ATKA 1KHPA
chains in the Genus database with same CATH topology
4G54A 3P5UA 2YJ2A 3TNXA 4AXMA 1QXPA 1CQDA 3MHSA 2HHNA 3KX1A 4CDCB 2E03A 3N3KA 4AXLA 3HHIA 2NQGA 1QOLA 4QRGA 2P86A 3H89A 1GLOA 2AUZA 1AU4A 2VHSA 1AYVA 4NV8A 2AS8A 1VSNA 3OVZA 1Y08A 1DF0A 4W5CA 3S3QA 2NQAA 1X9YA 2HXZA 2E01A 3N4CA 2YJ9A 4K7CA 3B79A 3D6SA 1ITOA 3O0UA 3ERVA 4P6GA 1F2CA 3H6SA 3NHEA 4BSQA 2GFOA 4CDEB 5CHVA 1W5RA 2VFCA 3USVA 1GCBA 3RVVA 1AU2A 2R9OA 1PCIA 1EWPA 2AUXA 4YYQA 2OULA 3IUTA 1MIRA 5K16A 1F2BA 2VFBA 3HWNA 3K9MA 3F5VA 2BSZA 4CZWA 1KFXL 2NQDB 1YK7A 2E00A 2DC7A 3IOQA 2OP3A 2WBFX 1AYWA 1Y4HA 2R9CA 2DCBA 5CHTA 3BWKA 1EF7A 2G8JA 3KKUA 2FQ9A 3H7DA 1STFE 2Y6EA 2R9MA 5EF4A 5JA7A 4X6JA 2FRQA 2DC9A 1CTEA 2P0RA 3OISA 2YJ8A 7PCKA 3KW9A 1NB3A 4BGFA 4YYVA 1BY8A 1CPJA 1MEMA 1U9VA 2G6DA 1TU6A 5A24A 1NPZA 3BOWA 1CB5A 5FPWA 1EWLA 2DJFB 2ATOA 4QRXA 2FTDA 2JQFR 3H8CA 4MZOA 1GMYA 2FUDA 4KLBA 1SNKA 4YYRA 3RVWA 3QJ3A 4YYSA 1NL6A 4PP2E 2O6XA 4W5BA 1AIMA 2AYOA 2VHFA 4BPVA 3P5WA 3S3RA 1NLJA 3M99A 2R9FA 4YV8A 1ME3A 1ZCMA 1MDWA 1ZIVA 3WXFA 3BPFA 3IEJA 1FH0A 1YALA 1YT7A 2F7DA 2PREA 1YK8A 3C9EA 3GCBA 1PPNA 2IPPB 3MHHA 3PBHA 3IV2A 2BDZA 4QH6A 2DJGB 1POPA 6PADA 3P5VA 2XU5A 2FYEA 2B1NA 2PADA 4X6IA 2CIOA 3H8BA 1PPDA 2DC8A 4XUIA 3LTWA 1PIPA 4FIPA 1QDQA 4GUZA 4B55A 2FO5A 2G8EA 3V6CA 4DMYA 1PADA 3BCNA 2JQGR 3LFYA 2HD5A 2AU1A 4PADA 1DEUA 3I06A 3ZUAA 4QRVA 3PW3A 1TL9A 3QSDA 3P5XA 1E2TA 1F29A 2IBIA 4OEMA 3OF8A 2FRAA 2DZZA 4HWYA 2P7UA 2E02A 2C0YA 3PNRA 3HD3A 1MEGA 2R9NA 4N4ZA 3E1ZB 4YYUA 2DC6A 2DZYA 2YJCA 1QMYA 4YYWA 4YVAA 1F2AA 3MTNA 1M6DA 3KSEA 4Q8GA 1Q6KA 3IHPA 4Q8HA 3F75A 2YJBA 2DCCA 1U9WA 4C5PA 3KWBX 1THEA 4PI3A 3N3GA 3KFQA 1CSBB 3D9WA 1AU0A 1AYUA 9PAPA 4WA6A 1XKGA 3CH2X 4OELA 2ACTA 3V6EA 2PNSA 2AYNA 2R6NA 2B1MA 1NQCA 2AIMA 1U5IA 1YVBA 1SP4B 4RY2A 1JQPA 3RVXA 1GX3A 2Y5BA 2GHUA 4BQVA 2FT2A 4DMXA 4MSXA 1CS8A 5CVMA 5J94A 4MZSA 4N79A 5F02A 1U9XA 1BP4A 1CV8A 2OZ2A 3BC3A 2AVWA 4NV7A 1PXVA 1HUCB 1KFUL 4CDDB 1AU3A 2HH5A 3OF9A 3OVXA 4N8WA 3LXSA 4I07A 3I3TA 1PPPA 3QT4A 5JH3A 1O0EA 2CB5A 2H7JA 4BS5A 1K3BB 4QBBA 1VJVA 2PBHA 3PDFA 1EWOA 4XR7A 1MS6A 4I05A 4W4UA 1PBHA 1IWDA 3WXEA 5EGWA 1ME4A 3HHAA 4ZUXU 2XU1A 4CDFB 1BGOA 1KHQA 1NB5A 3K8UA 1A6RA 3O1GA 5CVNB 3CBJA 3K24A 3DF0A 1BQIA 4PP1A 2DCAA 3KWZA 8PCHA 2XU4A 3CBKA 3MORA 1MHWA 1U9QX 1TLOA 2BDLA 1CVZA 3BPMA 4FK5A 5PADA 2XU3A 4X6HA 1W6FA 4FJCA 4BS6A 1EWMA 1S4VA 1ICFA 1KXRA 3IMAA 2F1GA 4I04A 5CVOB 4P6EA 3WXGA 1PPOA 3CH3X 2ARYA 3AI8A 1PE6A 1GECE 2DCDA 1W4TA 1AECA 2G7YA 2NQIA 3U8EA 1CJLA 1ATKA 1KHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G54 A;  3P5U A;  2YJ2 A;  3TNX A;  4AXM A;  1QXP A;  1CQD A;  3MHS A;  2HHN A;  3KX1 A;  4CDC B;  2E03 A;  3N3K A;  4AXL A;  3HHI A;  2NQG A;  1QOL A;  4QRG A;  2P86 A;  3H89 A;  1GLO A;  2AUZ A;  1AU4 A;  2VHS A;  1AYV A;  2AS8 A;  1VSN A;  3OVZ A;  1Y08 A;  1DF0 A;  4W5C A;  3S3Q A;  2NQA A;  1X9Y A;  2HXZ A;  2E01 A;  3N4C A;  2YJ9 A;  4K7C A;  3B79 A;  3D6S A;  1ITO A;  3O0U A;  3ERV A;  4P6G A;  1F2C A;  3H6S A;  3NHE A;  4BSQ A;  2GFO A;  4CDE B;  5CHV A;  3USV A;  1GCB A;  3RVV A;  1AU2 A;  2R9O A;  1PCI A;  1EWP A;  2AUX A;  4YYQ A;  2OUL A;  3IUT A;  1MIR A;  5K16 A;  1F2B A;  3HWN A;  3K9M A;  3F5V A;  4CZW A;  1KFX L;  2NQD B;  1YK7 A;  2E00 A;  2DC7 A;  3IOQ A;  2OP3 A;  2WBF X;  1AYW A;  1Y4H A;  2R9C A;  2DCB A;  5CHT A;  3BWK A;  1EF7 A;  2G8J A;  3KKU A;  2FQ9 A;  3H7D A;  1STF E;  2Y6E A;  2R9M A;  5EF4 A;  5JA7 A;  4X6J A;  2FRQ A;  2DC9 A;  1CTE A;  2P0R A;  3OIS A;  2YJ8 A;  7PCK A;  3KW9 A;  1NB3 A;  4YYV A;  1BY8 A;  1CPJ A;  1MEM A;  1U9V A;  2G6D A;  1TU6 A;  5A24 A;  1NPZ A;  3BOW A;  1CB5 A;  5FPW A;  1EWL A;  2DJF B;  2ATO A;  4QRX A;  2FTD A;  2JQF R;  3H8C A;  4MZO A;  1GMY A;  2FUD A;  4KLB A;  1SNK A;  4YYR A;  3RVW A;  3QJ3 A;  4YYS A;  1NL6 A;  4PP2 E;  2O6X A;  4W5B A;  1AIM A;  2AYO A;  2VHF A;  4BPV A;  3P5W A;  3S3R A;  1NLJ A;  3M99 A;  2R9F A;  4YV8 A;  1ME3 A;  1ZCM A;  1MDW A;  1ZIV A;  3WXF A;  3BPF A;  3IEJ A;  1FH0 A;  1YAL A;  1YT7 A;  2F7D A;  2PRE A;  1YK8 A;  3C9E A;  3GCB A;  1PPN A;  2IPP B;  3MHH A;  3PBH A;  3IV2 A;  2BDZ A;  4QH6 A;  2DJG B;  1POP A;  6PAD A;  3P5V A;  2XU5 A;  2FYE A;  2B1N A;  2PAD A;  4X6I A;  2CIO A;  3H8B A;  1PPD A;  2DC8 A;  4XUI A;  1PIP A;  4FIP A;  1QDQ A;  2FO5 A;  2G8E A;  3V6C A;  4DMY A;  1PAD A;  3BCN A;  2JQG R;  3LFY A;  2HD5 A;  2AU1 A;  4PAD A;  1DEU A;  3I06 A;  3ZUA A;  4QRV A;  3PW3 A;  1TL9 A;  3QSD A;  3P5X A;  1F29 A;  2IBI A;  4OEM A;  3OF8 A;  2FRA A;  2DZZ A;  4HWY A;  2P7U A;  2E02 A;  2C0Y A;  3PNR A;  3HD3 A;  1MEG A;  2R9N A;  4N4Z A;  3E1Z B;  4YYU A;  2DC6 A;  2DZY A;  2YJC A;  1QMY A;  4YYW A;  4YVA A;  1F2A A;  3MTN A;  1M6D A;  3KSE A;  4Q8G A;  1Q6K A;  3IHP A;  4Q8H A;  3F75 A;  2YJB A;  2DCC A;  1U9W A;  3KWB X;  1THE A;  4PI3 A;  3N3G A;  3KFQ A;  1CSB B;  1AU0 A;  1AYU A;  9PAP A;  4WA6 A;  1XKG A;  3CH2 X;  4OEL A;  2ACT A;  3V6E A;  2PNS A;  2AYN A;  2R6N A;  2B1M A;  1NQC A;  2AIM A;  1U5I A;  1YVB A;  1SP4 B;  4RY2 A;  1JQP A;  3RVX A;  2Y5B A;  2GHU A;  4BQV A;  2FT2 A;  4DMX A;  4MSX A;  1CS8 A;  5CVM A;  5J94 A;  4MZS A;  4N79 A;  5F02 A;  1U9X A;  1BP4 A;  1CV8 A;  2OZ2 A;  3BC3 A;  2AVW A;  1PXV A;  1HUC B;  1KFU L;  4CDD B;  1AU3 A;  2HH5 A;  3OF9 A;  3OVX A;  4N8W A;  3LXS A;  4I07 A;  3I3T A;  1PPP A;  3QT4 A;  5JH3 A;  1O0E A;  2CB5 A;  2H7J A;  4BS5 A;  1K3B B;  4QBB A;  1VJV A;  2PBH A;  3PDF A;  1EWO A;  4XR7 A;  1MS6 A;  4I05 A;  4W4U A;  1PBH A;  1IWD A;  3WXE A;  5EGW A;  1ME4 A;  3HHA A;  4ZUX U;  2XU1 A;  4CDF B;  1BGO A;  1KHQ A;  1NB5 A;  3K8U A;  1A6R A;  3O1G A;  5CVN B;  3CBJ A;  3K24 A;  3DF0 A;  1BQI A;  4PP1 A;  2DCA A;  3KWZ A;  8PCH A;  2XU4 A;  3CBK A;  3MOR A;  1MHW A;  1U9Q X;  1TLO A;  2BDL A;  1CVZ A;  3BPM A;  4FK5 A;  5PAD A;  2XU3 A;  4X6H A;  4BS6 A;  4FJC A;  1EWM A;  1S4V A;  1ICF A;  1KXR A;  3IMA A;  2F1G A;  4I04 A;  5CVO B;  4P6E A;  3WXG A;  1PPO A;  3CH3 X;  2ARY A;  3AI8 A;  1PE6 A;  1GEC E;  2DCD A;  1AEC A;  2G7Y A;  2NQI A;  3U8E A;  1CJL A;  1ATK A;  1KHP A; 
#chains in the Genus database with same CATH topology
 4G54 A;  3P5U A;  2YJ2 A;  3TNX A;  4AXM A;  1QXP A;  1CQD A;  3MHS A;  2HHN A;  3KX1 A;  4CDC B;  2E03 A;  3N3K A;  4AXL A;  2FE8 A;  3HHI A;  2NQG A;  1QOL A;  4QRG A;  2P86 A;  3H89 A;  1GLO A;  2AUZ A;  5EZQ A;  1AU4 A;  2VHS A;  1AYV A;  2AS8 A;  1VSN A;  3OVZ A;  1Y08 A;  4PT5 A;  1DF0 A;  4W5C A;  3S3Q A;  4D8E A;  2NQA A;  1X9Y A;  2HXZ A;  2E01 A;  3N4C A;  2YJ9 A;  4K7C A;  3B79 A;  3D6S A;  1ITO A;  3O0U A;  3ERV A;  2DOS A;  4ZTB A;  3TRK A;  4P6G A;  2BU3 A;  1F2C A;  3H6S A;  3NHE A;  3O65 A;  4BSQ A;  2GFO A;  4CDE B;  5CHV A;  3PRM A;  3USV A;  1GCB A;  3RVV A;  1AU2 A;  2R9O A;  4WUR A;  1PCI A;  1EWP A;  2AUX A;  4YYQ A;  4BOZ A;  5KO3 A;  2OUL A;  3IUT A;  1MIR A;  5K16 A;  1F2B A;  3HWN A;  5E6J A;  3K9M A;  4BOS A;  3F5V A;  4CZW A;  1KFX L;  2NQD B;  1YK7 A;  2E00 A;  2DC7 A;  3IOQ A;  2OP3 A;  2WBF X;  1AYW A;  4MM3 B;  1Y4H A;  2R9C A;  2DCB A;  5CHT A;  3BWK A;  1EF7 A;  2G8J A;  3KKU A;  2FQ9 A;  3PT2 A;  2UZJ A;  3H7D A;  1STF E;  1PVJ A;  2Y6E A;  2R9M A;  5EF4 A;  5JA7 A;  4X6J A;  2FRQ A;  2DC9 A;  1CTE A;  2P0R A;  3OIS A;  2YJ8 A;  7PCK A;  3KW9 A;  1NB3 A;  3W31 A;  4YYV A;  1BY8 A;  3PSE A;  1CPJ A;  1MEM A;  1U9V A;  2G6D A;  1TU6 A;  5A24 A;  1NPZ A;  3BOW A;  1CB5 A;  2HWK A;  5FPW A;  1EWL A;  2DJF B;  2ATO A;  4QRX A;  2FTD A;  2JQF R;  3H8C A;  4MZO A;  1GMY A;  2FUD A;  4KLB A;  1SNK A;  4YYR A;  3RVW A;  3QJ3 A;  5JZE A;  4YYS A;  1NL6 A;  4PP2 E;  2O6X A;  4W5B A;  1AIM A;  2AYO A;  4RF1 A;  2VHF A;  4BPV A;  3E9S A;  3P5W A;  3S3R A;  1NLJ A;  3M99 A;  2R9F A;  4YV8 A;  1ME3 A;  4XZX A;  1ZCM A;  1MDW A;  3W30 A;  3MJ5 A;  1ZIV A;  3WXF A;  4OVZ A;  3BPF A;  3IEJ A;  1FH0 A;  1YAL A;  3B21 A;  1YT7 A;  2F7D A;  2PRE A;  1YK8 A;  3C9E A;  3GCB A;  1PPN A;  2IPP B;  3MHH A;  3PBH A;  3IV2 A;  2BDZ A;  4QH6 A;  2DJG B;  1POP A;  6PAD A;  3P5V A;  2XU5 A;  2FYE A;  2B1N A;  2PAD A;  4X6I A;  2CIO A;  3H8B A;  1PPD A;  3ZNH A;  2DC8 A;  4XUI A;  1PIP A;  5EZS A;  4FIP A;  1QDQ A;  4D8I A;  2FO5 A;  2G8E A;  3V6C A;  4DMY A;  1PAD A;  3BCN A;  2JQG R;  4REZ A;  3LFY A;  2HD5 A;  2AU1 A;  4RKX A;  2AGA A;  4BOQ A;  4PAD A;  1DEU A;  3I06 A;  3ZUA A;  4QRV A;  3PW3 A;  1TL9 A;  3QSD A;  3IFU A;  3P5X A;  1F29 A;  2IBI A;  4OEM A;  3BY4 A;  3BBA A;  3OF8 A;  4M0W A;  4D8B A;  2FRA A;  2DZZ A;  3PHU A;  3OQC A;  4HWY A;  2P7U A;  2E02 A;  2C0Y A;  4OVZ B;  3PNR A;  2J7Q C;  3HD3 A;  1MEG A;  2R9N A;  4IUM A;  4N4Z A;  3E1Z B;  4YYU A;  2DC6 A;  4BOU A;  2DZY A;  2YJC A;  1QMY A;  4YYW A;  4BOP A;  4YVA A;  2BTW B;  1F2A A;  3MTN A;  1M6D A;  3KSE A;  4Q8G A;  1Q6K A;  3IHP A;  4Q8H A;  3BB7 A;  3F75 A;  2YJB A;  2DCC A;  1U9W A;  2JTC A;  3KWB X;  3PHW A;  1THE A;  4PI3 A;  3N3G A;  3RNV A;  3KFQ A;  1CSB B;  1AU0 A;  1AYU A;  9PAP A;  4WA6 A;  1XKG A;  3CH2 X;  4OEL A;  2ACT A;  3V6E A;  2PNS A;  2AYN A;  3MTV A;  2R6N A;  2B1M A;  1NQC A;  2AIM A;  1U5I A;  1YVB A;  3TMP A;  1SP4 B;  4RY2 A;  1JQP A;  3RVX A;  2Y5B A;  2GHU A;  4MI7 A;  2FT2 A;  4BQV A;  4DMX A;  4MSX A;  1CS8 A;  5CVM A;  5J94 A;  4MZS A;  4N79 A;  2BTW A;  5F02 A;  1U9X A;  1BP4 A;  1CV8 A;  2OZ2 A;  3BC3 A;  2AVW A;  1PXV A;  1HUC B;  1KFU L;  4CDD B;  1AU3 A;  2HH5 A;  3OF9 A;  3OVX A;  4HXD B;  4N8W A;  3LXS A;  4I07 A;  3I3T A;  1PPP A;  3QT4 A;  3MP2 A;  5JH3 A;  1O0E A;  2CB5 A;  2H7J A;  4BS5 A;  1K3B B;  4QBB A;  1VJV A;  2PBH A;  3PDF A;  1EWO A;  2J7Q A;  4RNA A;  4XR7 A;  1MS6 A;  4I05 A;  4A5U A;  4P16 A;  4W4U A;  1PBH A;  4RF0 A;  1IWD A;  3WXE A;  5EGW A;  1ME4 A;  3HHA A;  4ZUX U;  2XU1 A;  4CDF B;  1BGO A;  1KHQ A;  1NB5 A;  2JRI A;  3K8U A;  1A6R A;  3O1G A;  5CVN B;  3CBJ A;  3K24 A;  3DF0 A;  1BQI A;  4PP1 A;  2DCA A;  3KWZ A;  2Z84 A;  1DKI A;  8PCH A;  1YZB A;  2XU4 A;  3CBK A;  3MOR A;  1MHW A;  1U9Q X;  1TLO A;  2BDL A;  1CVZ A;  3BPM A;  4FK5 A;  5PAD A;  2XU3 A;  4X6H A;  4BS6 A;  4FJC A;  4GUA A;  4R3D A;  1EWM A;  4IP3 A;  3PRP A;  1UKF A;  1S4V A;  1ICF A;  1KXR A;  3IMA A;  2F1G A;  4I04 A;  5CVO B;  4P6E A;  3WXG A;  1PPO A;  3CH3 X;  3C0R A;  2ARY A;  3AI8 A;  1PE6 A;  1GEC E;  2DCD A;  1AEC A;  3PHX A;  2G7Y A;  2NQI A;  4OW0 A;  3U8E A;  1CJL A;  1ATK A;  1KHP A; 
#chains in the Genus database with same CATH homology
 4G54 A;  3P5U A;  2YJ2 A;  3TNX A;  4AXM A;  1QXP A;  1CQD A;  3MHS A;  2HHN A;  3KX1 A;  4CDC B;  2E03 A;  3N3K A;  4AXL A;  3HHI A;  2NQG A;  1QOL A;  4QRG A;  2P86 A;  3H89 A;  1GLO A;  2AUZ A;  1AU4 A;  2VHS A;  1AYV A;  4NV8 A;  2AS8 A;  1VSN A;  3OVZ A;  1Y08 A;  1DF0 A;  4W5C A;  3S3Q A;  2NQA A;  1X9Y A;  2HXZ A;  2E01 A;  3N4C A;  2YJ9 A;  4K7C A;  3B79 A;  3D6S A;  1ITO A;  3O0U A;  3ERV A;  4P6G A;  1F2C A;  3H6S A;  3NHE A;  4BSQ A;  2GFO A;  4CDE B;  5CHV A;  1W5R A;  2VFC A;  3USV A;  1GCB A;  3RVV A;  1AU2 A;  2R9O A;  1PCI A;  1EWP A;  2AUX A;  4YYQ A;  2OUL A;  3IUT A;  1MIR A;  5K16 A;  1F2B A;  2VFB A;  3HWN A;  3K9M A;  3F5V A;  2BSZ A;  4CZW A;  1KFX L;  2NQD B;  1YK7 A;  2E00 A;  2DC7 A;  3IOQ A;  2OP3 A;  2WBF X;  1AYW A;  1Y4H A;  2R9C A;  2DCB A;  5CHT A;  3BWK A;  1EF7 A;  2G8J A;  3KKU A;  2FQ9 A;  3H7D A;  1STF E;  2Y6E A;  2R9M A;  5EF4 A;  5JA7 A;  4X6J A;  2FRQ A;  2DC9 A;  1CTE A;  2P0R A;  3OIS A;  2YJ8 A;  7PCK A;  3KW9 A;  1NB3 A;  4BGF A;  4YYV A;  1BY8 A;  1CPJ A;  1MEM A;  1U9V A;  2G6D A;  1TU6 A;  5A24 A;  1NPZ A;  3BOW A;  1CB5 A;  5FPW A;  1EWL A;  2DJF B;  2ATO A;  4QRX A;  2FTD A;  2JQF R;  3H8C A;  4MZO A;  1GMY A;  2FUD A;  4KLB A;  1SNK A;  4YYR A;  3RVW A;  3QJ3 A;  4YYS A;  1NL6 A;  4PP2 E;  2O6X A;  4W5B A;  1AIM A;  2AYO A;  2VHF A;  4BPV A;  3P5W A;  3S3R A;  1NLJ A;  3M99 A;  2R9F A;  4YV8 A;  1ME3 A;  1ZCM A;  1MDW A;  1ZIV A;  3WXF A;  3BPF A;  3IEJ A;  1FH0 A;  1YAL A;  1YT7 A;  2F7D A;  2PRE A;  1YK8 A;  3C9E A;  3GCB A;  1PPN A;  2IPP B;  3MHH A;  3PBH A;  3IV2 A;  2BDZ A;  4QH6 A;  2DJG B;  1POP A;  6PAD A;  3P5V A;  2XU5 A;  2FYE A;  2B1N A;  2PAD A;  4X6I A;  2CIO A;  3H8B A;  1PPD A;  2DC8 A;  4XUI A;  3LTW A;  1PIP A;  4FIP A;  1QDQ A;  4GUZ A;  4B55 A;  2FO5 A;  2G8E A;  3V6C A;  4DMY A;  1PAD A;  3BCN A;  2JQG R;  3LFY A;  2HD5 A;  2AU1 A;  4PAD A;  1DEU A;  3I06 A;  3ZUA A;  4QRV A;  3PW3 A;  1TL9 A;  3QSD A;  3P5X A;  1E2T A;  1F29 A;  2IBI A;  4OEM A;  3OF8 A;  2FRA A;  2DZZ A;  4HWY A;  2P7U A;  2E02 A;  2C0Y A;  3PNR A;  3HD3 A;  1MEG A;  2R9N A;  4N4Z A;  3E1Z B;  4YYU A;  2DC6 A;  2DZY A;  2YJC A;  1QMY A;  4YYW A;  4YVA A;  1F2A A;  3MTN A;  1M6D A;  3KSE A;  4Q8G A;  1Q6K A;  3IHP A;  4Q8H A;  3F75 A;  2YJB A;  2DCC A;  1U9W A;  4C5P A;  3KWB X;  1THE A;  4PI3 A;  3N3G A;  3KFQ A;  1CSB B;  3D9W A;  1AU0 A;  1AYU A;  9PAP A;  4WA6 A;  1XKG A;  3CH2 X;  4OEL A;  2ACT A;  3V6E A;  2PNS A;  2AYN A;  2R6N A;  2B1M A;  1NQC A;  2AIM A;  1U5I A;  1YVB A;  1SP4 B;  4RY2 A;  1JQP A;  3RVX A;  1GX3 A;  2Y5B A;  2GHU A;  4BQV A;  2FT2 A;  4DMX A;  4MSX A;  1CS8 A;  5CVM A;  5J94 A;  4MZS A;  4N79 A;  5F02 A;  1U9X A;  1BP4 A;  1CV8 A;  2OZ2 A;  3BC3 A;  2AVW A;  4NV7 A;  1PXV A;  1HUC B;  1KFU L;  4CDD B;  1AU3 A;  2HH5 A;  3OF9 A;  3OVX A;  4N8W A;  3LXS A;  4I07 A;  3I3T A;  1PPP A;  3QT4 A;  5JH3 A;  1O0E A;  2CB5 A;  2H7J A;  4BS5 A;  1K3B B;  4QBB A;  1VJV A;  2PBH A;  3PDF A;  1EWO A;  4XR7 A;  1MS6 A;  4I05 A;  4W4U A;  1PBH A;  1IWD A;  3WXE A;  5EGW A;  1ME4 A;  3HHA A;  4ZUX U;  2XU1 A;  4CDF B;  1BGO A;  1KHQ A;  1NB5 A;  3K8U A;  1A6R A;  3O1G A;  5CVN B;  3CBJ A;  3K24 A;  3DF0 A;  1BQI A;  4PP1 A;  2DCA A;  3KWZ A;  8PCH A;  2XU4 A;  3CBK A;  3MOR A;  1MHW A;  1U9Q X;  1TLO A;  2BDL A;  1CVZ A;  3BPM A;  4FK5 A;  5PAD A;  2XU3 A;  4X6H A;  1W6F A;  4FJC A;  4BS6 A;  1EWM A;  1S4V A;  1ICF A;  1KXR A;  3IMA A;  2F1G A;  4I04 A;  5CVO B;  4P6E A;  3WXG A;  1PPO A;  3CH3 X;  2ARY A;  3AI8 A;  1PE6 A;  1GEC E;  2DCD A;  1W4T A;  1AEC A;  2G7Y A;  2NQI A;  3U8E A;  1CJL A;  1ATK A;  1KHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...