1YALA

Carica papaya chymopapain at 1.7 angstroms resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
218
structure length
216
Chain Sequence
YPQSIDWRAKGAVTPVKNQGACGSWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFKGFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOPAPAIN
publication title Structure of chymopapain at 1.7 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 216
sequence length 218
ec nomenclature ec 3.4.22.6: Chymopapain.
pdb deposition date 1996-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yalA00
2ATOA 1F2CA 1CTEA 4QRGA 2Y5BA 2B1NA 1EWMA 4YVAA 1CV8A 2YJBA 3S3QA 4Q8GA 1QDQA 1CJLA 1SP4B 4X6HA 1YALA 4BSQA 4CDEB 5CHTA 2DZZA 2DC6A 4XR7A 1F29A 3QJ3A 1KHQA 1HUCB 3V6EA 4QBBA 3HHAA 1Y4HA 3RVXA 3I06A 3KWZA 1CB5A 4YYWA 1MEGA 4CDFB 2G6DA 1MS6A 1PPNA 3LXSA 2BDLA 9PAPA 2R9OA 2XU5A 1BY8A 1GLOA 1SNKA 1AECA 1U9WA 4I04A 1EF7A 4P6EA 1PADA 3KX1A 3PBHA 3USVA 3WXEA 1NLJA 3OF9A 3BWKA 1XKGA 1M6DA 4YYUA 1YVBA 3BCNA 3OVZA 3OF8A 3WXGA 3CH2X 1PIPA 3IV2A 1ZIVA 2DC9A 1AYWA 3N4CA 1BQIA 1EWLA 1CSBB 3U8EA 2R9CA 1VSNA 3BPFA 1EWOA 2FT2A 2FQ9A 3BOWA 3KFQA 2XU1A 3HHIA 1AU3A 1DF0A 1CS8A 4AXMA 3IEJA 4BQVA 1PE6A 4YYSA 2PBHA 2NQDB 1NB3A 2G8JA 2DC8A 3ZUAA 2DZYA 2FO5A 2FUDA 1Q6KA 1QMYA 4QRVA 2WBFX 1ATKA 2C0YA 3IOQA 1GMYA 2AS8A 1BGOA 1VJVA 1U9VA 4I05A 4K7CA 4HWYA 1ME3A 4OELA 3P5UA 4FK5A 2E01A 2AUZA 3MTNA 1GECE 1AU2A 1AYUA 2IPPB 3KWBX 3KKUA 4RY2A 3H6SA 2IBIA 1YK7A 3DF0A 2DJFB 2FRAA 2AIMA 1X9YA 4YYQA 1PBHA 1IWDA 4QRXA 4BS6A 3NHEA 5A24A 2R9NA 2XU3A 1PXVA 1DEUA 1TU6A 2NQAA 3P5XA 4FIPA 3C9EA 3MHHA 2AVWA 3E1ZB 1BP4A 3OVXA 3I3TA 2E00A 2GHUA 1PPOA 2R9MA 3H8BA 5EF4A 8PCHA 1TL9A 4W5CA 3HD3A 1PPDA 2F1GA 1TLOA 2P7UA 5EGWA 2FRQA 1EWPA 4MZOA 1GCBA 2Y6EA 3V6CA 1NB5A 3BPMA 3OISA 4G54A 4KLBA 4W5BA 2JQGR 2G7YA 4YYRA 2YJ2A 5F02A 1KXRA 2B1MA 3P5VA 1AU0A 1PCIA 2DCCA 1NL6A 1S4VA 1ME4A 1AIMA 2DCAA 3TNXA 1NQCA 2DJGB 1ZCMA 2GFOA 1MEMA 1YK8A 3QSDA 4MZSA 1YT7A 2R6NA 1U5IA 5FPWA 1A6RA 3BC3A 2OP3A 3CH3X 1FH0A 2E03A 3QT4A 4XUIA 3K8UA 4MSXA 4ZUXU 1K3BB 4CZWA 3F5VA 2CIOA 3H8CA 5CHVA 4YYVA 3LFYA 3RVVA 2CB5A 1MIRA 1CQDA 4Q8HA 5J94A 3S3RA 3F75A 1Y08A 3N3GA 4PP2E 4AXLA 4PI3A 3ERVA 3O1GA 1QOLA 5JA7A 1O0EA 1F2AA 4DMYA 2AYOA 4W4UA 5K16A 4N8WA 3AI8A 1POPA 3K24A 2PNSA 4X6IA 3B79A 2P86A 1CVZA 2FYEA 1MDWA 2DCBA 4N4ZA 7PCKA 2PADA 2AUXA 3O0UA 2AYNA 1KFUL 1AYVA 2NQIA 4PADA 1NPZA 2XU4A 4I07A 2HH5A 3H89A 4PP1A 2YJ8A 2ACTA 1CPJA 3KSEA 6PADA 1U9QX 1QXPA 2HD5A 3D6SA 5PADA 4OEMA 2O6XA 2R9FA 3KW9A 2HXZA 4QH6A 3PNRA 2AU1A 2NQGA 3IHPA 3CBJA 3WXFA 2DCDA 4P6GA 4CDDB 3MHSA 2PREA 2DC7A 2BDZA 1ICFA 2FTDA 3HWNA 3IUTA 2YJCA 3MORA 2YJ9A 4DMXA 2VHFA 5CVMA 3P5WA 5CVOB 3RVWA 2HHNA 3M99A 4WA6A 1U9XA 3K9MA 2G8EA 4CDCB 4BS5A 1MHWA 5JH3A 1ITOA 2F7DA 3CBKA 3IMAA 2VHSA 3PW3A 2P0RA 1F2BA 2JQFR 4N79A 4YV8A 5CVNB 3H7DA 1KHPA 2H7JA 1PPPA 3GCBA 1THEA 1STFE 2OULA 1AU4A 4FJCA 2ARYA 3PDFA 3N3KA 4X6JA 1KFXL 4BPVA 2OZ2A 2E02A 1JQPA
chains in the Genus database with same CATH superfamily
2ATOA 1F2CA 1CTEA 4QRGA 2Y5BA 2B1NA 1EWMA 4YVAA 1CV8A 2YJBA 3W30A 3S3QA 4Q8GA 1QDQA 1CJLA 1SP4B 4X6HA 1YALA 4BSQA 4CDEB 5CHTA 3PHXA 4OW0A 4BOPA 2DZZA 2DC6A 4XR7A 1F29A 3QJ3A 4M0WA 2BU3A 1KHQA 1HUCB 3V6EA 4QBBA 3HHAA 1Y4HA 3RVXA 3I06A 3KWZA 1CB5A 4YYWA 1MEGA 4CDFB 2G6DA 4PT5A 1MS6A 3TMPA 5EZQA 3MJ5A 1PPNA 3LXSA 2BDLA 9PAPA 2R9OA 2XU5A 1BY8A 1GLOA 1SNKA 1AECA 1U9WA 4I04A 4IUMA 1EF7A 4P6EA 3OQCA 1PADA 3KX1A 4R3DA 3PBHA 2JRIA 3USVA 3WXEA 1NLJA 3TRKA 3OF9A 3BWKA 1XKGA 4RNAA 1M6DA 4YYUA 3IFUA 1YVBA 3BCNA 3OVZA 3OF8A 3WXGA 3CH2X 1PIPA 3IV2A 1ZIVA 2DC9A 1AYWA 3N4CA 1BQIA 1EWLA 2FE8A 1CSBB 3U8EA 2R9CA 1VSNA 3BPFA 1EWOA 2FT2A 2FQ9A 3BOWA 3KFQA 2XU1A 3HHIA 1AU3A 1DF0A 1CS8A 4AXMA 3IEJA 4OVZB 4BQVA 1PE6A 4YYSA 3PSEA 2PBHA 2NQDB 1NB3A 2G8JA 2DC8A 3ZUAA 2DZYA 2FO5A 2FUDA 4OVZA 1Q6KA 1QMYA 4QRVA 2WBFX 1ATKA 2C0YA 3IOQA 1GMYA 2AS8A 1BGOA 1VJVA 1U9VA 4I05A 4K7CA 4HWYA 1ME3A 4OELA 3P5UA 4FK5A 2E01A 2AUZA 3MTNA 1GECE 1AU2A 1AYUA 2IPPB 3KWBX 3KKUA 5E6JA 4RY2A 3H6SA 2IBIA 1YK7A 3DF0A 2DJFB 2FRAA 2AIMA 1X9YA 4YYQA 1PBHA 1IWDA 4QRXA 4BS6A 3NHEA 5A24A 2R9NA 2XU3A 1PXVA 1DEUA 1TU6A 4D8BA 2NQAA 3P5XA 4FIPA 3C9EA 3MHHA 2AVWA 3E1ZB 1BP4A 4MM3B 3PRPA 3OVXA 3I3TA 2E00A 2GHUA 1PPOA 2R9MA 3H8BA 4RKXA 5EF4A 8PCHA 1TL9A 4W5CA 3HD3A 1PPDA 2F1GA 1TLOA 2JTCA 1YZBA 2P7UA 5EGWA 2FRQA 3W31A 1EWPA 4MZOA 3PHWA 1GCBA 2Y6EA 3V6CA 1NB5A 3ZNHA 3BPMA 3OISA 4G54A 1DKIA 4KLBA 4W5BA 2JQGR 2G7YA 4YYRA 2YJ2A 5F02A 1KXRA 1UKFA 2B1MA 3P5VA 1AU0A 4BOZA 1PCIA 2DCCA 1NL6A 1S4VA 1ME4A 1AIMA 2DCAA 3TNXA 1NQCA 2DJGB 1ZCMA 2GFOA 1MEMA 1YK8A 3PT2A 4ZTBA 3QSDA 4MZSA 1YT7A 2R6NA 1U5IA 5FPWA 1A6RA 3C0RA 3BC3A 2OP3A 2DOSA 3CH3X 1FH0A 2E03A 3QT4A 3B21A 4XUIA 3K8UA 4MSXA 4ZUXU 1K3BB 4CZWA 3F5VA 2CIOA 3H8CA 5CHVA 4YYVA 3LFYA 3RVVA 2CB5A 1MIRA 1CQDA 4Q8HA 4HXDB 5J94A 3S3RA 3F75A 4IP3A 1Y08A 3N3GA 4PP2E 4AXLA 4PI3A 3ERVA 3O1GA 1QOLA 1PVJA 4BOSA 5JA7A 1O0EA 4REZA 1F2AA 4DMYA 2AYOA 4W4UA 5K16A 4N8WA 3E9SA 3MP2A 5EZSA 3AI8A 1POPA 3K24A 2PNSA 2HWKA 3BB7A 4X6IA 3B79A 2P86A 1CVZA 2FYEA 1MDWA 2DCBA 4N4ZA 7PCKA 2PADA 2AUXA 3O0UA 2AYNA 1KFUL 1AYVA 2NQIA 4PADA 1NPZA 2XU4A 4I07A 2HH5A 3RNVA 4RF1A 3H89A 4PP1A 2YJ8A 2ACTA 1CPJA 3KSEA 4WURA 6PADA 1U9QX 3BY4A 1QXPA 4GUAA 3MTVA 2HD5A 3D6SA 2AGAA 5PADA 4OEMA 2O6XA 2R9FA 3KW9A 2HXZA 4QH6A 3PNRA 2AU1A 2NQGA 3IHPA 3PHUA 4XZXA 3CBJA 3WXFA 4BOQA 2DCDA 4P6GA 4CDDB 3MHSA 2PREA 5KO3A 2DC7A 2UZJA 2BDZA 1ICFA 2FTDA 3HWNA 3IUTA 2YJCA 3MORA 2J7QA 2YJ9A 4DMXA 2VHFA 5CVMA 4D8IA 3P5WA 3PRMA 5CVOB 3RVWA 2HHNA 3M99A 2J7QC 4BOUA 4WA6A 4P16A 1U9XA 2Z84A 3K9MA 2G8EA 4CDCB 4BS5A 1MHWA 5JH3A 1ITOA 2F7DA 3CBKA 2BTWB 4RF0A 3IMAA 3O65A 2VHSA 4D8EA 3BBAA 3PW3A 2P0RA 1F2BA 2BTWA 2JQFR 4N79A 5JZEA 4YV8A 5CVNB 3H7DA 4MI7A 1KHPA 2H7JA 1PPPA 3GCBA 1THEA 1STFE 2OULA 1AU4A 4FJCA 2ARYA 3PDFA 3N3KA 4X6JA 1KFXL 4BPVA 2OZ2A 2E02A 4A5UA 1JQPA
chains in the Genus database with same CATH topology
2ATOA 1F2CA 1CTEA 4QRGA 2Y5BA 2B1NA 1EWMA 4YVAA 1CV8A 2YJBA 3S3QA 4Q8GA 1QDQA 1CJLA 1SP4B 4X6HA 1YALA 4BSQA 4CDEB 5CHTA 2DZZA 2DC6A 4XR7A 1F29A 3QJ3A 1W4TA 1KHQA 1HUCB 3V6EA 4QBBA 2BSZA 3HHAA 1Y4HA 3RVXA 3I06A 3KWZA 1CB5A 4YYWA 1MEGA 4CDFB 2G6DA 1MS6A 1PPNA 3LXSA 2BDLA 9PAPA 2R9OA 2XU5A 1BY8A 1GLOA 1SNKA 1AECA 1U9WA 4I04A 1EF7A 4P6EA 1PADA 3KX1A 3PBHA 3USVA 3WXEA 1NLJA 3OF9A 3BWKA 1XKGA 1M6DA 4YYUA 1YVBA 3BCNA 3OVZA 3OF8A 3WXGA 3CH2X 1PIPA 3IV2A 1ZIVA 2DC9A 1AYWA 3N4CA 1BQIA 1EWLA 1CSBB 3U8EA 2R9CA 1VSNA 3BPFA 1EWOA 2FT2A 2FQ9A 3BOWA 3KFQA 2XU1A 3HHIA 1AU3A 2VFBA 1DF0A 1CS8A 4AXMA 3IEJA 4BQVA 1PE6A 4YYSA 2PBHA 2NQDB 1NB3A 2G8JA 2DC8A 3ZUAA 2DZYA 2FO5A 2FUDA 1Q6KA 1QMYA 4QRVA 2WBFX 1ATKA 2C0YA 3IOQA 1GMYA 1E2TA 2AS8A 1BGOA 1VJVA 1U9VA 4I05A 4K7CA 4HWYA 1ME3A 4OELA 3P5UA 4FK5A 2E01A 2AUZA 3MTNA 1GECE 1AU2A 1AYUA 3LTWA 2IPPB 3KWBX 3KKUA 4RY2A 3H6SA 2IBIA 1YK7A 3DF0A 2DJFB 2FRAA 2AIMA 1X9YA 4YYQA 1PBHA 1IWDA 4QRXA 4BS6A 3NHEA 5A24A 2R9NA 2XU3A 1PXVA 1DEUA 1TU6A 1GX3A 2NQAA 3P5XA 4FIPA 3C9EA 3MHHA 2AVWA 3E1ZB 1BP4A 4NV7A 3OVXA 3I3TA 2E00A 2GHUA 4B55A 1PPOA 2R9MA 3H8BA 5EF4A 8PCHA 1TL9A 4W5CA 3HD3A 1PPDA 2F1GA 1TLOA 2P7UA 5EGWA 2FRQA 1EWPA 4MZOA 1GCBA 2Y6EA 3V6CA 1NB5A 3BPMA 3OISA 4G54A 4KLBA 4W5BA 2JQGR 2G7YA 4YYRA 2YJ2A 5F02A 1KXRA 2B1MA 3P5VA 1AU0A 1PCIA 2DCCA 1NL6A 1S4VA 1ME4A 1AIMA 2DCAA 3TNXA 1NQCA 2DJGB 1ZCMA 4GUZA 2GFOA 1MEMA 1YK8A 3QSDA 4MZSA 1YT7A 2R6NA 1U5IA 5FPWA 1A6RA 3BC3A 2OP3A 3CH3X 1FH0A 2E03A 3QT4A 4XUIA 3K8UA 4MSXA 4ZUXU 1K3BB 4CZWA 3F5VA 2CIOA 3H8CA 5CHVA 4YYVA 3LFYA 3RVVA 2CB5A 1MIRA 1CQDA 4Q8HA 5J94A 3S3RA 3F75A 1Y08A 3N3GA 4PP2E 4AXLA 4PI3A 3ERVA 3O1GA 1QOLA 5JA7A 1O0EA 1F2AA 4DMYA 2AYOA 4W4UA 5K16A 4N8WA 3AI8A 1POPA 3K24A 2PNSA 4X6IA 3B79A 2P86A 1CVZA 2FYEA 1MDWA 2DCBA 4N4ZA 7PCKA 2PADA 2AUXA 4BGFA 3O0UA 2AYNA 1KFUL 1AYVA 2NQIA 4PADA 1NPZA 4I07A 2VFCA 2HH5A 2XU4A 3H89A 4PP1A 2YJ8A 2ACTA 1CPJA 3KSEA 6PADA 1U9QX 4NV8A 1QXPA 2HD5A 3D6SA 5PADA 4OEMA 2O6XA 2R9FA 3KW9A 2HXZA 4QH6A 3PNRA 2AU1A 2NQGA 3IHPA 3CBJA 3WXFA 2DCDA 4P6GA 4C5PA 4CDDB 3MHSA 2PREA 2DC7A 2BDZA 1ICFA 2FTDA 3HWNA 3IUTA 2YJCA 3MORA 2YJ9A 4DMXA 2VHFA 3D9WA 5CVMA 3P5WA 5CVOB 3RVWA 2HHNA 3M99A 4WA6A 1W5RA 1W6FA 1U9XA 3K9MA 2G8EA 4CDCB 4BS5A 1MHWA 5JH3A 1ITOA 2F7DA 3CBKA 3IMAA 2VHSA 3PW3A 2P0RA 1F2BA 2JQFR 4N79A 4YV8A 5CVNB 3H7DA 1KHPA 2H7JA 1PPPA 3GCBA 1THEA 1STFE 2OULA 1AU4A 4FJCA 2ARYA 3PDFA 3N3KA 4X6JA 1KFXL 4BPVA 2OZ2A 2E02A 1JQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATO A;  1F2C A;  1CTE A;  4QRG A;  2Y5B A;  2B1N A;  1EWM A;  4YVA A;  1CV8 A;  2YJB A;  3S3Q A;  4Q8G A;  1QDQ A;  1CJL A;  1SP4 B;  4X6H A;  1YAL A;  4BSQ A;  4CDE B;  5CHT A;  2DZZ A;  2DC6 A;  4XR7 A;  1F29 A;  3QJ3 A;  1KHQ A;  1HUC B;  3V6E A;  4QBB A;  3HHA A;  1Y4H A;  3RVX A;  3I06 A;  3KWZ A;  1CB5 A;  4YYW A;  1MEG A;  4CDF B;  2G6D A;  1MS6 A;  1PPN A;  3LXS A;  2BDL A;  9PAP A;  2R9O A;  2XU5 A;  1BY8 A;  1GLO A;  1SNK A;  1AEC A;  1U9W A;  4I04 A;  1EF7 A;  4P6E A;  1PAD A;  3KX1 A;  3PBH A;  3USV A;  3WXE A;  1NLJ A;  3OF9 A;  3BWK A;  1XKG A;  1M6D A;  4YYU A;  1YVB A;  3BCN A;  3OVZ A;  3OF8 A;  3WXG A;  3CH2 X;  1PIP A;  3IV2 A;  1ZIV A;  2DC9 A;  1AYW A;  3N4C A;  1BQI A;  1EWL A;  1CSB B;  3U8E A;  2R9C A;  1VSN A;  3BPF A;  1EWO A;  2FT2 A;  2FQ9 A;  3BOW A;  3KFQ A;  2XU1 A;  3HHI A;  1AU3 A;  1DF0 A;  1CS8 A;  4AXM A;  3IEJ A;  4BQV A;  1PE6 A;  4YYS A;  2PBH A;  2NQD B;  1NB3 A;  2G8J A;  2DC8 A;  3ZUA A;  2DZY A;  2FO5 A;  2FUD A;  1Q6K A;  1QMY A;  4QRV A;  2WBF X;  1ATK A;  2C0Y A;  3IOQ A;  1GMY A;  2AS8 A;  1BGO A;  1VJV A;  1U9V A;  4I05 A;  4K7C A;  4HWY A;  1ME3 A;  4OEL A;  3P5U A;  4FK5 A;  2E01 A;  2AUZ A;  3MTN A;  1GEC E;  1AU2 A;  1AYU A;  2IPP B;  3KWB X;  3KKU A;  4RY2 A;  3H6S A;  2IBI A;  1YK7 A;  3DF0 A;  2DJF B;  2FRA A;  2AIM A;  1X9Y A;  4YYQ A;  1PBH A;  1IWD A;  4QRX A;  4BS6 A;  3NHE A;  5A24 A;  2R9N A;  2XU3 A;  1PXV A;  1DEU A;  1TU6 A;  2NQA A;  3P5X A;  4FIP A;  3C9E A;  3MHH A;  2AVW A;  3E1Z B;  1BP4 A;  3OVX A;  3I3T A;  2E00 A;  2GHU A;  1PPO A;  2R9M A;  3H8B A;  5EF4 A;  8PCH A;  1TL9 A;  4W5C A;  3HD3 A;  1PPD A;  2F1G A;  1TLO A;  2P7U A;  5EGW A;  2FRQ A;  1EWP A;  4MZO A;  1GCB A;  2Y6E A;  3V6C A;  1NB5 A;  3BPM A;  3OIS A;  4G54 A;  4KLB A;  4W5B A;  2JQG R;  2G7Y A;  4YYR A;  2YJ2 A;  5F02 A;  1KXR A;  2B1M A;  3P5V A;  1AU0 A;  1PCI A;  2DCC A;  1NL6 A;  1S4V A;  1ME4 A;  1AIM A;  2DCA A;  3TNX A;  1NQC A;  2DJG B;  1ZCM A;  2GFO A;  1MEM A;  1YK8 A;  3QSD A;  4MZS A;  1YT7 A;  2R6N A;  1U5I A;  5FPW A;  1A6R A;  3BC3 A;  2OP3 A;  3CH3 X;  1FH0 A;  2E03 A;  3QT4 A;  4XUI A;  3K8U A;  4MSX A;  4ZUX U;  1K3B B;  4CZW A;  3F5V A;  2CIO A;  3H8C A;  5CHV A;  4YYV A;  3LFY A;  3RVV A;  2CB5 A;  1MIR A;  1CQD A;  4Q8H A;  5J94 A;  3S3R A;  3F75 A;  1Y08 A;  3N3G A;  4PP2 E;  4AXL A;  4PI3 A;  3ERV A;  3O1G A;  1QOL A;  5JA7 A;  1O0E A;  1F2A A;  4DMY A;  2AYO A;  4W4U A;  5K16 A;  4N8W A;  3AI8 A;  1POP A;  3K24 A;  2PNS A;  4X6I A;  3B79 A;  2P86 A;  1CVZ A;  2FYE A;  1MDW A;  2DCB A;  4N4Z A;  7PCK A;  2PAD A;  2AUX A;  3O0U A;  2AYN A;  1KFU L;  1AYV A;  2NQI A;  4PAD A;  1NPZ A;  2XU4 A;  4I07 A;  2HH5 A;  3H89 A;  4PP1 A;  2YJ8 A;  2ACT A;  1CPJ A;  3KSE A;  6PAD A;  1U9Q X;  1QXP A;  2HD5 A;  3D6S A;  5PAD A;  4OEM A;  2O6X A;  2R9F A;  3KW9 A;  2HXZ A;  4QH6 A;  3PNR A;  2AU1 A;  2NQG A;  3IHP A;  3CBJ A;  3WXF A;  2DCD A;  4P6G A;  4CDD B;  3MHS A;  2PRE A;  2DC7 A;  2BDZ A;  1ICF A;  2FTD A;  3HWN A;  3IUT A;  2YJC A;  3MOR A;  2YJ9 A;  4DMX A;  2VHF A;  5CVM A;  3P5W A;  5CVO B;  3RVW A;  2HHN A;  3M99 A;  4WA6 A;  1U9X A;  3K9M A;  2G8E A;  4CDC B;  4BS5 A;  1MHW A;  5JH3 A;  1ITO A;  2F7D A;  3CBK A;  3IMA A;  2VHS A;  3PW3 A;  2P0R A;  1F2B A;  2JQF R;  4N79 A;  4YV8 A;  5CVN B;  3H7D A;  1KHP A;  2H7J A;  1PPP A;  3GCB A;  1THE A;  1STF E;  2OUL A;  1AU4 A;  4FJC A;  2ARY A;  3PDF A;  3N3K A;  4X6J A;  1KFX L;  4BPV A;  2OZ2 A;  2E02 A;  1JQP A; 
#chains in the Genus database with same CATH topology
 2ATO A;  1F2C A;  1CTE A;  4QRG A;  2Y5B A;  2B1N A;  1EWM A;  4YVA A;  1CV8 A;  2YJB A;  3W30 A;  3S3Q A;  4Q8G A;  1QDQ A;  1CJL A;  1SP4 B;  4X6H A;  1YAL A;  4BSQ A;  4CDE B;  5CHT A;  3PHX A;  4OW0 A;  4BOP A;  2DZZ A;  2DC6 A;  4XR7 A;  1F29 A;  3QJ3 A;  4M0W A;  2BU3 A;  1KHQ A;  1HUC B;  3V6E A;  4QBB A;  3HHA A;  1Y4H A;  3RVX A;  3I06 A;  3KWZ A;  1CB5 A;  4YYW A;  1MEG A;  4CDF B;  2G6D A;  4PT5 A;  1MS6 A;  3TMP A;  5EZQ A;  3MJ5 A;  1PPN A;  3LXS A;  2BDL A;  9PAP A;  2R9O A;  2XU5 A;  1BY8 A;  1GLO A;  1SNK A;  1AEC A;  1U9W A;  4I04 A;  4IUM A;  1EF7 A;  4P6E A;  3OQC A;  1PAD A;  3KX1 A;  4R3D A;  3PBH A;  2JRI A;  3USV A;  3WXE A;  1NLJ A;  3TRK A;  3OF9 A;  3BWK A;  1XKG A;  4RNA A;  1M6D A;  4YYU A;  3IFU A;  1YVB A;  3BCN A;  3OVZ A;  3OF8 A;  3WXG A;  3CH2 X;  1PIP A;  3IV2 A;  1ZIV A;  2DC9 A;  1AYW A;  3N4C A;  1BQI A;  1EWL A;  2FE8 A;  1CSB B;  3U8E A;  2R9C A;  1VSN A;  3BPF A;  1EWO A;  2FT2 A;  2FQ9 A;  3BOW A;  3KFQ A;  2XU1 A;  3HHI A;  1AU3 A;  1DF0 A;  1CS8 A;  4AXM A;  3IEJ A;  4OVZ B;  4BQV A;  1PE6 A;  4YYS A;  3PSE A;  2PBH A;  2NQD B;  1NB3 A;  2G8J A;  2DC8 A;  3ZUA A;  2DZY A;  2FO5 A;  2FUD A;  4OVZ A;  1Q6K A;  1QMY A;  4QRV A;  2WBF X;  1ATK A;  2C0Y A;  3IOQ A;  1GMY A;  2AS8 A;  1BGO A;  1VJV A;  1U9V A;  4I05 A;  4K7C A;  4HWY A;  1ME3 A;  4OEL A;  3P5U A;  4FK5 A;  2E01 A;  2AUZ A;  3MTN A;  1GEC E;  1AU2 A;  1AYU A;  2IPP B;  3KWB X;  3KKU A;  5E6J A;  4RY2 A;  3H6S A;  2IBI A;  1YK7 A;  3DF0 A;  2DJF B;  2FRA A;  2AIM A;  1X9Y A;  4YYQ A;  1PBH A;  1IWD A;  4QRX A;  4BS6 A;  3NHE A;  5A24 A;  2R9N A;  2XU3 A;  1PXV A;  1DEU A;  1TU6 A;  4D8B A;  2NQA A;  3P5X A;  4FIP A;  3C9E A;  3MHH A;  2AVW A;  3E1Z B;  1BP4 A;  4MM3 B;  3PRP A;  3OVX A;  3I3T A;  2E00 A;  2GHU A;  1PPO A;  2R9M A;  3H8B A;  4RKX A;  5EF4 A;  8PCH A;  1TL9 A;  4W5C A;  3HD3 A;  1PPD A;  2F1G A;  1TLO A;  2JTC A;  1YZB A;  2P7U A;  5EGW A;  2FRQ A;  3W31 A;  1EWP A;  4MZO A;  3PHW A;  1GCB A;  2Y6E A;  3V6C A;  1NB5 A;  3ZNH A;  3BPM A;  3OIS A;  4G54 A;  1DKI A;  4KLB A;  4W5B A;  2JQG R;  2G7Y A;  4YYR A;  2YJ2 A;  5F02 A;  1KXR A;  1UKF A;  2B1M A;  3P5V A;  1AU0 A;  4BOZ A;  1PCI A;  2DCC A;  1NL6 A;  1S4V A;  1ME4 A;  1AIM A;  2DCA A;  3TNX A;  1NQC A;  2DJG B;  1ZCM A;  2GFO A;  1MEM A;  1YK8 A;  3PT2 A;  4ZTB A;  3QSD A;  4MZS A;  1YT7 A;  2R6N A;  1U5I A;  5FPW A;  1A6R A;  3C0R A;  3BC3 A;  2OP3 A;  2DOS A;  3CH3 X;  1FH0 A;  2E03 A;  3QT4 A;  3B21 A;  4XUI A;  3K8U A;  4MSX A;  4ZUX U;  1K3B B;  4CZW A;  3F5V A;  2CIO A;  3H8C A;  5CHV A;  4YYV A;  3LFY A;  3RVV A;  2CB5 A;  1MIR A;  1CQD A;  4Q8H A;  4HXD B;  5J94 A;  3S3R A;  3F75 A;  4IP3 A;  1Y08 A;  3N3G A;  4PP2 E;  4AXL A;  4PI3 A;  3ERV A;  3O1G A;  1QOL A;  1PVJ A;  4BOS A;  5JA7 A;  1O0E A;  4REZ A;  1F2A A;  4DMY A;  2AYO A;  4W4U A;  5K16 A;  4N8W A;  3E9S A;  3MP2 A;  5EZS A;  3AI8 A;  1POP A;  3K24 A;  2PNS A;  2HWK A;  3BB7 A;  4X6I A;  3B79 A;  2P86 A;  1CVZ A;  2FYE A;  1MDW A;  2DCB A;  4N4Z A;  7PCK A;  2PAD A;  2AUX A;  3O0U A;  2AYN A;  1KFU L;  1AYV A;  2NQI A;  4PAD A;  1NPZ A;  2XU4 A;  4I07 A;  2HH5 A;  3RNV A;  4RF1 A;  3H89 A;  4PP1 A;  2YJ8 A;  2ACT A;  1CPJ A;  3KSE A;  4WUR A;  6PAD A;  1U9Q X;  3BY4 A;  1QXP A;  4GUA A;  3MTV A;  2HD5 A;  3D6S A;  2AGA A;  5PAD A;  4OEM A;  2O6X A;  2R9F A;  3KW9 A;  2HXZ A;  4QH6 A;  3PNR A;  2AU1 A;  2NQG A;  3IHP A;  3PHU A;  4XZX A;  3CBJ A;  3WXF A;  4BOQ A;  2DCD A;  4P6G A;  4CDD B;  3MHS A;  2PRE A;  5KO3 A;  2DC7 A;  2UZJ A;  2BDZ A;  1ICF A;  2FTD A;  3HWN A;  3IUT A;  2YJC A;  3MOR A;  2J7Q A;  2YJ9 A;  4DMX A;  2VHF A;  5CVM A;  4D8I A;  3P5W A;  3PRM A;  5CVO B;  3RVW A;  2HHN A;  3M99 A;  2J7Q C;  4BOU A;  4WA6 A;  4P16 A;  1U9X A;  2Z84 A;  3K9M A;  2G8E A;  4CDC B;  4BS5 A;  1MHW A;  5JH3 A;  1ITO A;  2F7D A;  3CBK A;  2BTW B;  4RF0 A;  3IMA A;  3O65 A;  2VHS A;  4D8E A;  3BBA A;  3PW3 A;  2P0R A;  1F2B A;  2BTW A;  2JQF R;  4N79 A;  5JZE A;  4YV8 A;  5CVN B;  3H7D A;  4MI7 A;  1KHP A;  2H7J A;  1PPP A;  3GCB A;  1THE A;  1STF E;  2OUL A;  1AU4 A;  4FJC A;  2ARY A;  3PDF A;  3N3K A;  4X6J A;  1KFX L;  4BPV A;  2OZ2 A;  2E02 A;  4A5U A;  1JQP A; 
#chains in the Genus database with same CATH homology
 2ATO A;  1F2C A;  1CTE A;  4QRG A;  2Y5B A;  2B1N A;  1EWM A;  4YVA A;  1CV8 A;  2YJB A;  3S3Q A;  4Q8G A;  1QDQ A;  1CJL A;  1SP4 B;  4X6H A;  1YAL A;  4BSQ A;  4CDE B;  5CHT A;  2DZZ A;  2DC6 A;  4XR7 A;  1F29 A;  3QJ3 A;  1W4T A;  1KHQ A;  1HUC B;  3V6E A;  4QBB A;  2BSZ A;  3HHA A;  1Y4H A;  3RVX A;  3I06 A;  3KWZ A;  1CB5 A;  4YYW A;  1MEG A;  4CDF B;  2G6D A;  1MS6 A;  1PPN A;  3LXS A;  2BDL A;  9PAP A;  2R9O A;  2XU5 A;  1BY8 A;  1GLO A;  1SNK A;  1AEC A;  1U9W A;  4I04 A;  1EF7 A;  4P6E A;  1PAD A;  3KX1 A;  3PBH A;  3USV A;  3WXE A;  1NLJ A;  3OF9 A;  3BWK A;  1XKG A;  1M6D A;  4YYU A;  1YVB A;  3BCN A;  3OVZ A;  3OF8 A;  3WXG A;  3CH2 X;  1PIP A;  3IV2 A;  1ZIV A;  2DC9 A;  1AYW A;  3N4C A;  1BQI A;  1EWL A;  1CSB B;  3U8E A;  2R9C A;  1VSN A;  3BPF A;  1EWO A;  2FT2 A;  2FQ9 A;  3BOW A;  3KFQ A;  2XU1 A;  3HHI A;  1AU3 A;  2VFB A;  1DF0 A;  1CS8 A;  4AXM A;  3IEJ A;  4BQV A;  1PE6 A;  4YYS A;  2PBH A;  2NQD B;  1NB3 A;  2G8J A;  2DC8 A;  3ZUA A;  2DZY A;  2FO5 A;  2FUD A;  1Q6K A;  1QMY A;  4QRV A;  2WBF X;  1ATK A;  2C0Y A;  3IOQ A;  1GMY A;  1E2T A;  2AS8 A;  1BGO A;  1VJV A;  1U9V A;  4I05 A;  4K7C A;  4HWY A;  1ME3 A;  4OEL A;  3P5U A;  4FK5 A;  2E01 A;  2AUZ A;  3MTN A;  1GEC E;  1AU2 A;  1AYU A;  3LTW A;  2IPP B;  3KWB X;  3KKU A;  4RY2 A;  3H6S A;  2IBI A;  1YK7 A;  3DF0 A;  2DJF B;  2FRA A;  2AIM A;  1X9Y A;  4YYQ A;  1PBH A;  1IWD A;  4QRX A;  4BS6 A;  3NHE A;  5A24 A;  2R9N A;  2XU3 A;  1PXV A;  1DEU A;  1TU6 A;  1GX3 A;  2NQA A;  3P5X A;  4FIP A;  3C9E A;  3MHH A;  2AVW A;  3E1Z B;  1BP4 A;  4NV7 A;  3OVX A;  3I3T A;  2E00 A;  2GHU A;  4B55 A;  1PPO A;  2R9M A;  3H8B A;  5EF4 A;  8PCH A;  1TL9 A;  4W5C A;  3HD3 A;  1PPD A;  2F1G A;  1TLO A;  2P7U A;  5EGW A;  2FRQ A;  1EWP A;  4MZO A;  1GCB A;  2Y6E A;  3V6C A;  1NB5 A;  3BPM A;  3OIS A;  4G54 A;  4KLB A;  4W5B A;  2JQG R;  2G7Y A;  4YYR A;  2YJ2 A;  5F02 A;  1KXR A;  2B1M A;  3P5V A;  1AU0 A;  1PCI A;  2DCC A;  1NL6 A;  1S4V A;  1ME4 A;  1AIM A;  2DCA A;  3TNX A;  1NQC A;  2DJG B;  1ZCM A;  4GUZ A;  2GFO A;  1MEM A;  1YK8 A;  3QSD A;  4MZS A;  1YT7 A;  2R6N A;  1U5I A;  5FPW A;  1A6R A;  3BC3 A;  2OP3 A;  3CH3 X;  1FH0 A;  2E03 A;  3QT4 A;  4XUI A;  3K8U A;  4MSX A;  4ZUX U;  1K3B B;  4CZW A;  3F5V A;  2CIO A;  3H8C A;  5CHV A;  4YYV A;  3LFY A;  3RVV A;  2CB5 A;  1MIR A;  1CQD A;  4Q8H A;  5J94 A;  3S3R A;  3F75 A;  1Y08 A;  3N3G A;  4PP2 E;  4AXL A;  4PI3 A;  3ERV A;  3O1G A;  1QOL A;  5JA7 A;  1O0E A;  1F2A A;  4DMY A;  2AYO A;  4W4U A;  5K16 A;  4N8W A;  3AI8 A;  1POP A;  3K24 A;  2PNS A;  4X6I A;  3B79 A;  2P86 A;  1CVZ A;  2FYE A;  1MDW A;  2DCB A;  4N4Z A;  7PCK A;  2PAD A;  2AUX A;  4BGF A;  3O0U A;  2AYN A;  1KFU L;  1AYV A;  2NQI A;  4PAD A;  1NPZ A;  4I07 A;  2VFC A;  2HH5 A;  2XU4 A;  3H89 A;  4PP1 A;  2YJ8 A;  2ACT A;  1CPJ A;  3KSE A;  6PAD A;  1U9Q X;  4NV8 A;  1QXP A;  2HD5 A;  3D6S A;  5PAD A;  4OEM A;  2O6X A;  2R9F A;  3KW9 A;  2HXZ A;  4QH6 A;  3PNR A;  2AU1 A;  2NQG A;  3IHP A;  3CBJ A;  3WXF A;  2DCD A;  4P6G A;  4C5P A;  4CDD B;  3MHS A;  2PRE A;  2DC7 A;  2BDZ A;  1ICF A;  2FTD A;  3HWN A;  3IUT A;  2YJC A;  3MOR A;  2YJ9 A;  4DMX A;  2VHF A;  3D9W A;  5CVM A;  3P5W A;  5CVO B;  3RVW A;  2HHN A;  3M99 A;  4WA6 A;  1W5R A;  1W6F A;  1U9X A;  3K9M A;  2G8E A;  4CDC B;  4BS5 A;  1MHW A;  5JH3 A;  1ITO A;  2F7D A;  3CBK A;  3IMA A;  2VHS A;  3PW3 A;  2P0R A;  1F2B A;  2JQF R;  4N79 A;  4YV8 A;  5CVN B;  3H7D A;  1KHP A;  2H7J A;  1PPP A;  3GCB A;  1THE A;  1STF E;  2OUL A;  1AU4 A;  4FJC A;  2ARY A;  3PDF A;  3N3K A;  4X6J A;  1KFX L;  4BPV A;  2OZ2 A;  2E02 A;  1JQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...