1YALA

Carica papaya chymopapain at 1.7 angstroms resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
218
structure length
216
Chain Sequence
YPQSIDWRAKGAVTPVKNQGACGSWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFKGFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHYMOPAPAIN
publication title Structure of chymopapain at 1.7 A resolution.
pubmed doi rcsb
total genus 60
structure length 216
sequence length 218
ec nomenclature ec 3.4.22.6: Chymopapain.
pdb deposition date 1996-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yalA00
1Y4HA 1MDWA 3H6SA 4BPVA 1BP4A 3BOWA 3PW3A 4W5CA 2DC8A 2DC7A 4YYQA 2E03A 3KSEA 4PI3A 3H8BA 3KFQA 1U9WA 4W4UA 3K24A 3K9MA 2E01A 3H7DA 3KW9A 4YYVA 1EF7A 2DZYA 4X6JA 1CQDA 2AVWA 3KKUA 4BS5A 3IOQA 4HWYA 2FYEA 3KWBX 5K16A 4CZWA 1QMYA 1PBHA 1GCBA 9PAPA 3TNXA 3HD3A 1MHWA 1S4VA 2OULA 4MSXA 4FJCA 2DCBA 4AXMA 2BDZA 2G8JA 4Q8GA 2ARYA 4CDCB 3N3KA 4MZSA 2R6NA 3MHSA 4G54A 5EGWA 1KXRA 2R9OA 4QRGA 1EWOA 3OVXA 3V6CA 2NQGA 4PP1A 2PADA 5CHVA 1PPPA 1DF0A 2FRQA 3HWNA 1TL9A 2FTDA 3QT4A 1BQIA 1POPA 3ZUAA 2E02A 3H8CA 1EWPA 4MZOA 2HH5A 2HD5A 3O0UA 1MEMA 4FIPA 3H89A 2WBFX 1O0EA 2P0RA 2FUDA 1QOLA 3BPMA 4XR7A 4ZUXU 3N3GA 3S3QA 1MS6A 4PADA 2YJ9A 3P5WA 1KHQA 1Y08A 1PIPA 3I06A 2E00A 4YVAA 3IMAA 1NPZA 3LXSA 1Q6KA 2AUXA 3IV2A 2FQ9A 2YJ2A 2AUZA 3C9EA 1ITOA 3F75A 1AU0A 6PADA 2R9FA 4QH6A 1VJVA 1PXVA 3IUTA 2FO5A 1IWDA 3CBKA 3WXFA 2DCDA 2YJCA 1KHPA 3BWKA 4YYUA 5EF4A 2XU1A 3KX1A 4AXLA 3IHPA 4W5BA 3WXGA 1YALA 4BSQA 4CDFB 2R9CA 4OELA 1MEGA 1PCIA 1CJLA 2G6DA 1SP4B 3CH3X 3PNRA 1CS8A 4N4ZA 1ZIVA 4K7CA 5CVOB 8PCHA 1NQCA 2Y5BA 4OEMA 2G7YA 4KLBA 1TU6A 3OF9A 3BPFA 2DC9A 3V6EA 5JH3A 3M99A 3PBHA 2XU5A 2C0YA 3U8EA 3CH2X 3P5XA 4FK5A 7PCKA 3I3TA 5A24A 2AU1A 1CTEA 1KFUL 1K3BB 5JA7A 5F02A 3RVWA 1F2CA 5PADA 3HHAA 2ATOA 2OZ2A 3PDFA 1CPJA 3OISA 2DCAA 4P6EA 3E1ZB 1ME4A 1FH0A 3MORA 3USVA 3ERVA 1AIMA 2PREA 2DZZA 1YT7A 2PNSA 1HUCB 1AU2A 1CV8A 1U9QX 1ICFA 1MIRA 2CB5A 3N4CA 2VHFA 1GECE 2XU4A 3QSDA 1F29A 4X6HA 2CIOA 1PPDA 1X9YA 2DCCA 1EWMA 4N8WA 1VSNA 2P86A 3OVZA 1QXPA 4X6IA 2PBHA 2P7UA 1DEUA 1GLOA 2YJ8A 4YYRA 1AYVA 1F2AA 4BS6A 4YYSA 1U5IA 2JQFR 1BY8A 1YK7A 4YV8A 1U9VA 5CVMA 1AECA 1AYWA 2NQAA 1ZCMA 1AU4A 3F5VA 3NHEA 2DC6A 1NL6A 2GFOA 3AI8A 4CDDB 1YK8A 1CB5A 5J94A 3BCNA 2AYNA 1TLOA 1F2BA 2AS8A 2H7JA 2NQDB 2FT2A 5CVNB 3HHIA 4QRXA 1CSBB 2R9MA 5CHTA 2R9NA 3OF8A 1EWLA 2IPPB 1NLJA 1XKGA 1PPNA 2IBIA 2YJBA 3D6SA 1NB5A 1NB3A 2FRAA 4QRVA 3RVVA 2F7DA 1ATKA 4RY2A 4CDEB 4P6GA 3QJ3A 4QBBA 1CVZA 2O6XA 3IEJA 4PP2E 1U9XA 3KWZA 1JQPA 3MHHA 3BC3A 2AIMA 2DJFB 2DJGB 2XU3A 1ME3A 3P5UA 2JQGR 2OP3A 1M6DA 4DMYA 2BDLA 1THEA 1YVBA 3DF0A 2F1GA 4I07A 4Q8HA 1AYUA 3CBJA 1PPOA 1SNKA 2AYOA 5FPWA 2ACTA 1AU3A 3K8UA 1STFE 3GCBA 4N79A 2Y6EA 2B1MA 1PADA 1A6RA 3S3RA 2VHSA 4BQVA 2NQIA 3P5VA 4YYWA 1QDQA 2HXZA 2G8EA 3LFYA 3WXEA 2GHUA 3O1GA 4XUIA 4WA6A 3MTNA 1BGOA 3RVXA 1GMYA 4I05A 3B79A 4DMXA 4I04A 1PE6A 2HHNA 2B1NA 1KFXL
chains in the Genus database with same CATH superfamily
1Y4HA 1MDWA 3H6SA 4HXDB 4BPVA 1BP4A 3BOWA 3PW3A 4W5CA 2DC8A 2DC7A 4YYQA 2E03A 3KSEA 4PI3A 3H8BA 3KFQA 4BOQA 1U9WA 4W4UA 3K24A 3K9MA 2E01A 3PT2A 3H7DA 3KW9A 4YYVA 1EF7A 2DZYA 4X6JA 1CQDA 2AVWA 3KKUA 4P16A 4BS5A 3E9SA 2BTWB 3IOQA 4IUMA 4HWYA 2FYEA 3KWBX 5K16A 4CZWA 1QMYA 1PBHA 1GCBA 9PAPA 3TNXA 3HD3A 1MHWA 1S4VA 2OULA 4MSXA 4FJCA 2DCBA 4AXMA 2BDZA 2G8JA 4Q8GA 2ARYA 5EZQA 4CDCB 3N3KA 4MZSA 2R6NA 3MHSA 4BOUA 4G54A 3W31A 5EGWA 1KXRA 2FE8A 2R9OA 4QRGA 1EWOA 3OVXA 1DKIA 3V6CA 2NQGA 4PP1A 2PADA 5CHVA 1PPPA 1DF0A 2FRQA 4BOPA 3HWNA 3BB7A 1TL9A 2FTDA 3QT4A 1BQIA 1POPA 3ZUAA 2E02A 3H8CA 1EWPA 4MZOA 2HH5A 2HD5A 3O0UA 3TMPA 1MEMA 4FIPA 3H89A 2WBFX 1O0EA 2P0RA 2FUDA 1QOLA 3BPMA 4XR7A 4ZUXU 3N3GA 3S3QA 1MS6A 4PADA 2YJ9A 3P5WA 1KHQA 1Y08A 1PIPA 3I06A 2E00A 4YVAA 2JRIA 3IMAA 2J7QA 3BBAA 2UZJA 1YZBA 3PRPA 1NPZA 3LXSA 1Q6KA 2AUXA 3IV2A 2FQ9A 4REZA 2YJ2A 2AUZA 3C9EA 1ITOA 3F75A 1AU0A 6PADA 1PVJA 2R9FA 4QH6A 1VJVA 1PXVA 4OW0A 3IUTA 2FO5A 1IWDA 3CBKA 3WXFA 2DCDA 2YJCA 1KHPA 3BWKA 4YYUA 5EF4A 2XU1A 3KX1A 4AXLA 5EZSA 3IHPA 2HWKA 4W5BA 4D8BA 3WXGA 1YALA 4BSQA 4CDFB 2R9CA 4OELA 1MEGA 1PCIA 4BOZA 1CJLA 2G6DA 1SP4B 4RF0A 3CH3X 3PNRA 1CS8A 2BU3A 3O65A 4N4ZA 1ZIVA 3PHWA 4K7CA 5CVOB 4BOSA 8PCHA 1NQCA 2Y5BA 3RNVA 4OEMA 3BY4A 2G7YA 4KLBA 1TU6A 4MI7A 3OF9A 3BPFA 4XZXA 2DC9A 3V6EA 5JH3A 3M99A 3PBHA 2XU5A 4M0WA 2C0YA 3U8EA 3CH2X 3P5XA 4FK5A 7PCKA 1UKFA 3I3TA 5A24A 2AU1A 4RKXA 1CTEA 1KFUL 2Z84A 1K3BB 5JA7A 3B21A 4IP3A 5F02A 3RVWA 1F2CA 5PADA 3OQCA 3HHAA 2ATOA 2OZ2A 3PDFA 3TRKA 1CPJA 2JTCA 3OISA 2DCAA 4P6EA 3E1ZB 1ME4A 1FH0A 3MORA 3USVA 3ERVA 1AIMA 2PREA 2DZZA 1YT7A 2PNSA 1HUCB 1AU2A 1CV8A 1U9QX 1ICFA 1MIRA 2CB5A 3N4CA 2VHFA 1GECE 2XU4A 4OVZA 3QSDA 1F29A 4X6HA 2DOSA 4R3DA 2CIOA 1PPDA 1X9YA 2DCCA 1EWMA 4N8WA 1VSNA 2P86A 3OVZA 4ZTBA 3PHXA 1QXPA 4X6IA 4PT5A 2PBHA 2P7UA 3ZNHA 4RF1A 1DEUA 1GLOA 2YJ8A 4YYRA 1AYVA 1F2AA 4BS6A 4YYSA 1U5IA 2JQFR 1BY8A 2AGAA 1YK7A 4YV8A 1U9VA 5CVMA 1AECA 1AYWA 2NQAA 1ZCMA 1AU4A 3F5VA 5JZEA 3NHEA 2DC6A 1NL6A 2GFOA 3AI8A 4CDDB 1YK8A 1CB5A 5J94A 3BCNA 2AYNA 1TLOA 1F2BA 2AS8A 2H7JA 4MM3B 2NQDB 2FT2A 5CVNB 3HHIA 4QRXA 1CSBB 2R9MA 5CHTA 2R9NA 3OF8A 1EWLA 2BTWA 3W30A 3IFUA 2IPPB 1NLJA 1XKGA 3PRMA 1PPNA 2IBIA 2YJBA 3MJ5A 4GUAA 3D6SA 1NB5A 1NB3A 2FRAA 4QRVA 3RVVA 2F7DA 1ATKA 4RY2A 4CDEB 4P6GA 3QJ3A 4QBBA 1CVZA 2O6XA 3IEJA 4PP2E 1U9XA 3KWZA 1JQPA 3MHHA 3PSEA 3BC3A 2AIMA 4D8IA 2DJFB 2DJGB 2XU3A 1ME3A 3P5UA 4A5UA 2JQGR 2OP3A 1M6DA 4DMYA 2BDLA 2J7QC 1THEA 1YVBA 3DF0A 2F1GA 4I07A 4Q8HA 1AYUA 3CBJA 1PPOA 3MTVA 1SNKA 5KO3A 3C0RA 2AYOA 5FPWA 2ACTA 1AU3A 3K8UA 1STFE 4OVZB 4RNAA 3GCBA 4N79A 5E6JA 2Y6EA 2B1MA 4D8EA 1PADA 1A6RA 3S3RA 2VHSA 4BQVA 2NQIA 3P5VA 4YYWA 1QDQA 2HXZA 2G8EA 3LFYA 3WXEA 2GHUA 3O1GA 4XUIA 4WA6A 3MTNA 3PHUA 1BGOA 3RVXA 1GMYA 4I05A 4WURA 3MP2A 3B79A 4DMXA 1PE6A 2HHNA 4I04A 2B1NA 1KFXL
chains in the Genus database with same CATH topology
1Y4HA 1MDWA 3H6SA 4BPVA 1BP4A 3BOWA 3PW3A 4W5CA 2DC8A 2DC7A 4YYQA 2E03A 3KSEA 4PI3A 3H8BA 3KFQA 2VFBA 1U9WA 4W4UA 3K24A 3K9MA 2E01A 3H7DA 3KW9A 4YYVA 1EF7A 2DZYA 4X6JA 1CQDA 2AVWA 3KKUA 4BS5A 3IOQA 4HWYA 2FYEA 3KWBX 5K16A 4CZWA 1QMYA 1PBHA 1GCBA 9PAPA 3TNXA 3HD3A 1MHWA 1S4VA 2OULA 4MSXA 4FJCA 2DCBA 4AXMA 1E2TA 2BDZA 2G8JA 4Q8GA 3D9WA 2ARYA 4CDCB 3N3KA 4MZSA 2R6NA 3MHSA 4G54A 5EGWA 1KXRA 2R9OA 4QRGA 1EWOA 3OVXA 3V6CA 2NQGA 4PP1A 2PADA 5CHVA 1PPPA 1DF0A 2FRQA 3HWNA 1TL9A 2FTDA 3QT4A 1BQIA 1POPA 3ZUAA 2E02A 3H8CA 1EWPA 4MZOA 2HH5A 2HD5A 3O0UA 1MEMA 4FIPA 3H89A 2WBFX 1O0EA 2P0RA 2FUDA 1QOLA 3BPMA 4XR7A 4ZUXU 3N3GA 3S3QA 1GX3A 1MS6A 4PADA 2YJ9A 3P5WA 1KHQA 1W6FA 1Y08A 1PIPA 3I06A 2E00A 4YVAA 3IMAA 1W4TA 1NPZA 3LXSA 1Q6KA 2AUXA 3IV2A 2FQ9A 2YJ2A 2AUZA 3C9EA 1ITOA 3F75A 1AU0A 6PADA 2R9FA 4QH6A 1VJVA 1PXVA 3IUTA 2FO5A 1IWDA 3CBKA 3WXFA 2DCDA 2YJCA 1KHPA 3BWKA 4YYUA 5EF4A 2XU1A 3KX1A 4AXLA 3IHPA 4W5BA 3WXGA 1YALA 4BSQA 4CDFB 4GUZA 2R9CA 4OELA 1MEGA 1PCIA 1CJLA 2G6DA 1SP4B 1W5RA 3CH3X 3PNRA 1CS8A 4N4ZA 1ZIVA 4K7CA 5CVOB 4C5PA 4B55A 8PCHA 1NQCA 2Y5BA 4OEMA 2G7YA 4KLBA 1TU6A 3OF9A 3BPFA 2DC9A 3V6EA 5JH3A 3M99A 3PBHA 2XU5A 2C0YA 3U8EA 3CH2X 3P5XA 4FK5A 7PCKA 3I3TA 5A24A 2AU1A 1CTEA 1KFUL 1K3BB 5JA7A 5F02A 3RVWA 1F2CA 5PADA 3HHAA 2ATOA 2OZ2A 3PDFA 1CPJA 3OISA 2DCAA 4P6EA 3E1ZB 1ME4A 1FH0A 3MORA 3USVA 3ERVA 1AIMA 2PREA 2DZZA 1YT7A 2PNSA 1HUCB 1AU2A 1CV8A 1U9QX 4NV7A 1ICFA 1MIRA 2CB5A 3N4CA 2VHFA 1GECE 2XU4A 3QSDA 1F29A 4X6HA 2CIOA 1PPDA 1X9YA 2DCCA 1EWMA 4N8WA 1VSNA 2P86A 3OVZA 1QXPA 4X6IA 2PBHA 2P7UA 1DEUA 1GLOA 2YJ8A 4YYRA 1AYVA 1F2AA 4BS6A 4YYSA 1U5IA 2JQFR 1BY8A 1YK7A 4YV8A 1U9VA 5CVMA 1AECA 1AYWA 2NQAA 1ZCMA 1AU4A 3F5VA 3NHEA 2DC6A 1NL6A 2GFOA 3AI8A 4CDDB 1YK8A 1CB5A 5J94A 3BCNA 2AYNA 1TLOA 1F2BA 2AS8A 2H7JA 2NQDB 2FT2A 5CVNB 3HHIA 4QRXA 1CSBB 2R9MA 5CHTA 2R9NA 3OF8A 1EWLA 4NV8A 2IPPB 1NLJA 1XKGA 1PPNA 2IBIA 2YJBA 2BSZA 3D6SA 1NB5A 1NB3A 2FRAA 4QRVA 3RVVA 2F7DA 1ATKA 4RY2A 4CDEB 4P6GA 3QJ3A 4QBBA 1CVZA 2O6XA 3IEJA 4PP2E 1U9XA 3KWZA 1JQPA 3MHHA 3BC3A 2AIMA 2DJFB 2DJGB 2XU3A 1ME3A 4BGFA 3P5UA 2JQGR 2OP3A 1M6DA 4DMYA 2BDLA 1THEA 1YVBA 3DF0A 2VFCA 2F1GA 4I07A 4Q8HA 1AYUA 3CBJA 1PPOA 1SNKA 2AYOA 5FPWA 2ACTA 1AU3A 3K8UA 1STFE 3GCBA 4N79A 2Y6EA 2B1MA 1PADA 1A6RA 3S3RA 2VHSA 4BQVA 2NQIA 3P5VA 3LTWA 4YYWA 1QDQA 2HXZA 2G8EA 3LFYA 3WXEA 2GHUA 3O1GA 4XUIA 4WA6A 3MTNA 1BGOA 3RVXA 1GMYA 4I05A 3B79A 4DMXA 4I04A 1PE6A 2HHNA 2B1NA 1KFXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4H A;  1MDW A;  3H6S A;  4BPV A;  1BP4 A;  3BOW A;  3PW3 A;  4W5C A;  2DC8 A;  2DC7 A;  4YYQ A;  2E03 A;  3KSE A;  4PI3 A;  3H8B A;  3KFQ A;  1U9W A;  4W4U A;  3K24 A;  3K9M A;  2E01 A;  3H7D A;  3KW9 A;  4YYV A;  1EF7 A;  2DZY A;  4X6J A;  1CQD A;  2AVW A;  3KKU A;  4BS5 A;  3IOQ A;  4HWY A;  2FYE A;  3KWB X;  5K16 A;  4CZW A;  1QMY A;  1PBH A;  1GCB A;  9PAP A;  3TNX A;  3HD3 A;  1MHW A;  1S4V A;  2OUL A;  4MSX A;  4FJC A;  2DCB A;  4AXM A;  2BDZ A;  2G8J A;  4Q8G A;  2ARY A;  4CDC B;  3N3K A;  4MZS A;  2R6N A;  3MHS A;  4G54 A;  5EGW A;  1KXR A;  2R9O A;  4QRG A;  1EWO A;  3OVX A;  3V6C A;  2NQG A;  4PP1 A;  2PAD A;  5CHV A;  1PPP A;  1DF0 A;  2FRQ A;  3HWN A;  1TL9 A;  2FTD A;  3QT4 A;  1BQI A;  1POP A;  3ZUA A;  2E02 A;  3H8C A;  1EWP A;  4MZO A;  2HH5 A;  2HD5 A;  3O0U A;  1MEM A;  4FIP A;  3H89 A;  2WBF X;  1O0E A;  2P0R A;  2FUD A;  1QOL A;  3BPM A;  4XR7 A;  4ZUX U;  3N3G A;  3S3Q A;  1MS6 A;  4PAD A;  2YJ9 A;  3P5W A;  1KHQ A;  1Y08 A;  1PIP A;  3I06 A;  2E00 A;  4YVA A;  3IMA A;  1NPZ A;  3LXS A;  1Q6K A;  2AUX A;  3IV2 A;  2FQ9 A;  2YJ2 A;  2AUZ A;  3C9E A;  1ITO A;  3F75 A;  1AU0 A;  6PAD A;  2R9F A;  4QH6 A;  1VJV A;  1PXV A;  3IUT A;  2FO5 A;  1IWD A;  3CBK A;  3WXF A;  2DCD A;  2YJC A;  1KHP A;  3BWK A;  4YYU A;  5EF4 A;  2XU1 A;  3KX1 A;  4AXL A;  3IHP A;  4W5B A;  3WXG A;  1YAL A;  4BSQ A;  4CDF B;  2R9C A;  4OEL A;  1MEG A;  1PCI A;  1CJL A;  2G6D A;  1SP4 B;  3CH3 X;  3PNR A;  1CS8 A;  4N4Z A;  1ZIV A;  4K7C A;  5CVO B;  8PCH A;  1NQC A;  2Y5B A;  4OEM A;  2G7Y A;  4KLB A;  1TU6 A;  3OF9 A;  3BPF A;  2DC9 A;  3V6E A;  5JH3 A;  3M99 A;  3PBH A;  2XU5 A;  2C0Y A;  3U8E A;  3CH2 X;  3P5X A;  4FK5 A;  7PCK A;  3I3T A;  5A24 A;  2AU1 A;  1CTE A;  1KFU L;  1K3B B;  5JA7 A;  5F02 A;  3RVW A;  1F2C A;  5PAD A;  3HHA A;  2ATO A;  2OZ2 A;  3PDF A;  1CPJ A;  3OIS A;  2DCA A;  4P6E A;  3E1Z B;  1ME4 A;  1FH0 A;  3MOR A;  3USV A;  3ERV A;  1AIM A;  2PRE A;  2DZZ A;  1YT7 A;  2PNS A;  1HUC B;  1AU2 A;  1CV8 A;  1U9Q X;  1ICF A;  1MIR A;  2CB5 A;  3N4C A;  2VHF A;  1GEC E;  2XU4 A;  3QSD A;  1F29 A;  4X6H A;  2CIO A;  1PPD A;  1X9Y A;  2DCC A;  1EWM A;  4N8W A;  1VSN A;  2P86 A;  3OVZ A;  1QXP A;  4X6I A;  2PBH A;  2P7U A;  1DEU A;  1GLO A;  2YJ8 A;  4YYR A;  1AYV A;  1F2A A;  4BS6 A;  4YYS A;  1U5I A;  2JQF R;  1BY8 A;  1YK7 A;  4YV8 A;  1U9V A;  5CVM A;  1AEC A;  1AYW A;  2NQA A;  1ZCM A;  1AU4 A;  3F5V A;  3NHE A;  2DC6 A;  1NL6 A;  2GFO A;  3AI8 A;  4CDD B;  1YK8 A;  1CB5 A;  5J94 A;  3BCN A;  2AYN A;  1TLO A;  1F2B A;  2AS8 A;  2H7J A;  2NQD B;  2FT2 A;  5CVN B;  3HHI A;  4QRX A;  1CSB B;  2R9M A;  5CHT A;  2R9N A;  3OF8 A;  1EWL A;  2IPP B;  1NLJ A;  1XKG A;  1PPN A;  2IBI A;  2YJB A;  3D6S A;  1NB5 A;  1NB3 A;  2FRA A;  4QRV A;  3RVV A;  2F7D A;  1ATK A;  4RY2 A;  4CDE B;  4P6G A;  3QJ3 A;  4QBB A;  1CVZ A;  2O6X A;  3IEJ A;  4PP2 E;  1U9X A;  3KWZ A;  1JQP A;  3MHH A;  3BC3 A;  2AIM A;  2DJF B;  2DJG B;  2XU3 A;  1ME3 A;  3P5U A;  2JQG R;  2OP3 A;  1M6D A;  4DMY A;  2BDL A;  1THE A;  1YVB A;  3DF0 A;  2F1G A;  4I07 A;  4Q8H A;  1AYU A;  3CBJ A;  1PPO A;  1SNK A;  2AYO A;  5FPW A;  2ACT A;  1AU3 A;  3K8U A;  1STF E;  3GCB A;  4N79 A;  2Y6E A;  2B1M A;  1PAD A;  1A6R A;  3S3R A;  2VHS A;  4BQV A;  2NQI A;  3P5V A;  4YYW A;  1QDQ A;  2HXZ A;  2G8E A;  3LFY A;  3WXE A;  2GHU A;  3O1G A;  4XUI A;  4WA6 A;  3MTN A;  1BGO A;  3RVX A;  1GMY A;  4I05 A;  3B79 A;  4DMX A;  4I04 A;  1PE6 A;  2HHN A;  2B1N A;  1KFX L; 
#chains in the Genus database with same CATH topology
 1Y4H A;  1MDW A;  3H6S A;  4HXD B;  4BPV A;  1BP4 A;  3BOW A;  3PW3 A;  4W5C A;  2DC8 A;  2DC7 A;  4YYQ A;  2E03 A;  3KSE A;  4PI3 A;  3H8B A;  3KFQ A;  4BOQ A;  1U9W A;  4W4U A;  3K24 A;  3K9M A;  2E01 A;  3PT2 A;  3H7D A;  3KW9 A;  4YYV A;  1EF7 A;  2DZY A;  4X6J A;  1CQD A;  2AVW A;  3KKU A;  4P16 A;  4BS5 A;  3E9S A;  2BTW B;  3IOQ A;  4IUM A;  4HWY A;  2FYE A;  3KWB X;  5K16 A;  4CZW A;  1QMY A;  1PBH A;  1GCB A;  9PAP A;  3TNX A;  3HD3 A;  1MHW A;  1S4V A;  2OUL A;  4MSX A;  4FJC A;  2DCB A;  4AXM A;  2BDZ A;  2G8J A;  4Q8G A;  2ARY A;  5EZQ A;  4CDC B;  3N3K A;  4MZS A;  2R6N A;  3MHS A;  4BOU A;  4G54 A;  3W31 A;  5EGW A;  1KXR A;  2FE8 A;  2R9O A;  4QRG A;  1EWO A;  3OVX A;  1DKI A;  3V6C A;  2NQG A;  4PP1 A;  2PAD A;  5CHV A;  1PPP A;  1DF0 A;  2FRQ A;  4BOP A;  3HWN A;  3BB7 A;  1TL9 A;  2FTD A;  3QT4 A;  1BQI A;  1POP A;  3ZUA A;  2E02 A;  3H8C A;  1EWP A;  4MZO A;  2HH5 A;  2HD5 A;  3O0U A;  3TMP A;  1MEM A;  4FIP A;  3H89 A;  2WBF X;  1O0E A;  2P0R A;  2FUD A;  1QOL A;  3BPM A;  4XR7 A;  4ZUX U;  3N3G A;  3S3Q A;  1MS6 A;  4PAD A;  2YJ9 A;  3P5W A;  1KHQ A;  1Y08 A;  1PIP A;  3I06 A;  2E00 A;  4YVA A;  2JRI A;  3IMA A;  2J7Q A;  3BBA A;  2UZJ A;  1YZB A;  3PRP A;  1NPZ A;  3LXS A;  1Q6K A;  2AUX A;  3IV2 A;  2FQ9 A;  4REZ A;  2YJ2 A;  2AUZ A;  3C9E A;  1ITO A;  3F75 A;  1AU0 A;  6PAD A;  1PVJ A;  2R9F A;  4QH6 A;  1VJV A;  1PXV A;  4OW0 A;  3IUT A;  2FO5 A;  1IWD A;  3CBK A;  3WXF A;  2DCD A;  2YJC A;  1KHP A;  3BWK A;  4YYU A;  5EF4 A;  2XU1 A;  3KX1 A;  4AXL A;  5EZS A;  3IHP A;  2HWK A;  4W5B A;  4D8B A;  3WXG A;  1YAL A;  4BSQ A;  4CDF B;  2R9C A;  4OEL A;  1MEG A;  1PCI A;  4BOZ A;  1CJL A;  2G6D A;  1SP4 B;  4RF0 A;  3CH3 X;  3PNR A;  1CS8 A;  2BU3 A;  3O65 A;  4N4Z A;  1ZIV A;  3PHW A;  4K7C A;  5CVO B;  4BOS A;  8PCH A;  1NQC A;  2Y5B A;  3RNV A;  4OEM A;  3BY4 A;  2G7Y A;  4KLB A;  1TU6 A;  4MI7 A;  3OF9 A;  3BPF A;  4XZX A;  2DC9 A;  3V6E A;  5JH3 A;  3M99 A;  3PBH A;  2XU5 A;  4M0W A;  2C0Y A;  3U8E A;  3CH2 X;  3P5X A;  4FK5 A;  7PCK A;  1UKF A;  3I3T A;  5A24 A;  2AU1 A;  4RKX A;  1CTE A;  1KFU L;  2Z84 A;  1K3B B;  5JA7 A;  3B21 A;  4IP3 A;  5F02 A;  3RVW A;  1F2C A;  5PAD A;  3OQC A;  3HHA A;  2ATO A;  2OZ2 A;  3PDF A;  3TRK A;  1CPJ A;  2JTC A;  3OIS A;  2DCA A;  4P6E A;  3E1Z B;  1ME4 A;  1FH0 A;  3MOR A;  3USV A;  3ERV A;  1AIM A;  2PRE A;  2DZZ A;  1YT7 A;  2PNS A;  1HUC B;  1AU2 A;  1CV8 A;  1U9Q X;  1ICF A;  1MIR A;  2CB5 A;  3N4C A;  2VHF A;  1GEC E;  2XU4 A;  4OVZ A;  3QSD A;  1F29 A;  4X6H A;  2DOS A;  4R3D A;  2CIO A;  1PPD A;  1X9Y A;  2DCC A;  1EWM A;  4N8W A;  1VSN A;  2P86 A;  3OVZ A;  4ZTB A;  3PHX A;  1QXP A;  4X6I A;  4PT5 A;  2PBH A;  2P7U A;  3ZNH A;  4RF1 A;  1DEU A;  1GLO A;  2YJ8 A;  4YYR A;  1AYV A;  1F2A A;  4BS6 A;  4YYS A;  1U5I A;  2JQF R;  1BY8 A;  2AGA A;  1YK7 A;  4YV8 A;  1U9V A;  5CVM A;  1AEC A;  1AYW A;  2NQA A;  1ZCM A;  1AU4 A;  3F5V A;  5JZE A;  3NHE A;  2DC6 A;  1NL6 A;  2GFO A;  3AI8 A;  4CDD B;  1YK8 A;  1CB5 A;  5J94 A;  3BCN A;  2AYN A;  1TLO A;  1F2B A;  2AS8 A;  2H7J A;  4MM3 B;  2NQD B;  2FT2 A;  5CVN B;  3HHI A;  4QRX A;  1CSB B;  2R9M A;  5CHT A;  2R9N A;  3OF8 A;  1EWL A;  2BTW A;  3W30 A;  3IFU A;  2IPP B;  1NLJ A;  1XKG A;  3PRM A;  1PPN A;  2IBI A;  2YJB A;  3MJ5 A;  4GUA A;  3D6S A;  1NB5 A;  1NB3 A;  2FRA A;  4QRV A;  3RVV A;  2F7D A;  1ATK A;  4RY2 A;  4CDE B;  4P6G A;  3QJ3 A;  4QBB A;  1CVZ A;  2O6X A;  3IEJ A;  4PP2 E;  1U9X A;  3KWZ A;  1JQP A;  3MHH A;  3PSE A;  3BC3 A;  2AIM A;  4D8I A;  2DJF B;  2DJG B;  2XU3 A;  1ME3 A;  3P5U A;  4A5U A;  2JQG R;  2OP3 A;  1M6D A;  4DMY A;  2BDL A;  2J7Q C;  1THE A;  1YVB A;  3DF0 A;  2F1G A;  4I07 A;  4Q8H A;  1AYU A;  3CBJ A;  1PPO A;  3MTV A;  1SNK A;  5KO3 A;  3C0R A;  2AYO A;  5FPW A;  2ACT A;  1AU3 A;  3K8U A;  1STF E;  4OVZ B;  4RNA A;  3GCB A;  4N79 A;  5E6J A;  2Y6E A;  2B1M A;  4D8E A;  1PAD A;  1A6R A;  3S3R A;  2VHS A;  4BQV A;  2NQI A;  3P5V A;  4YYW A;  1QDQ A;  2HXZ A;  2G8E A;  3LFY A;  3WXE A;  2GHU A;  3O1G A;  4XUI A;  4WA6 A;  3MTN A;  3PHU A;  1BGO A;  3RVX A;  1GMY A;  4I05 A;  4WUR A;  3MP2 A;  3B79 A;  4DMX A;  1PE6 A;  2HHN A;  4I04 A;  2B1N A;  1KFX L; 
#chains in the Genus database with same CATH homology
 1Y4H A;  1MDW A;  3H6S A;  4BPV A;  1BP4 A;  3BOW A;  3PW3 A;  4W5C A;  2DC8 A;  2DC7 A;  4YYQ A;  2E03 A;  3KSE A;  4PI3 A;  3H8B A;  3KFQ A;  2VFB A;  1U9W A;  4W4U A;  3K24 A;  3K9M A;  2E01 A;  3H7D A;  3KW9 A;  4YYV A;  1EF7 A;  2DZY A;  4X6J A;  1CQD A;  2AVW A;  3KKU A;  4BS5 A;  3IOQ A;  4HWY A;  2FYE A;  3KWB X;  5K16 A;  4CZW A;  1QMY A;  1PBH A;  1GCB A;  9PAP A;  3TNX A;  3HD3 A;  1MHW A;  1S4V A;  2OUL A;  4MSX A;  4FJC A;  2DCB A;  4AXM A;  1E2T A;  2BDZ A;  2G8J A;  4Q8G A;  3D9W A;  2ARY A;  4CDC B;  3N3K A;  4MZS A;  2R6N A;  3MHS A;  4G54 A;  5EGW A;  1KXR A;  2R9O A;  4QRG A;  1EWO A;  3OVX A;  3V6C A;  2NQG A;  4PP1 A;  2PAD A;  5CHV A;  1PPP A;  1DF0 A;  2FRQ A;  3HWN A;  1TL9 A;  2FTD A;  3QT4 A;  1BQI A;  1POP A;  3ZUA A;  2E02 A;  3H8C A;  1EWP A;  4MZO A;  2HH5 A;  2HD5 A;  3O0U A;  1MEM A;  4FIP A;  3H89 A;  2WBF X;  1O0E A;  2P0R A;  2FUD A;  1QOL A;  3BPM A;  4XR7 A;  4ZUX U;  3N3G A;  3S3Q A;  1GX3 A;  1MS6 A;  4PAD A;  2YJ9 A;  3P5W A;  1KHQ A;  1W6F A;  1Y08 A;  1PIP A;  3I06 A;  2E00 A;  4YVA A;  3IMA A;  1W4T A;  1NPZ A;  3LXS A;  1Q6K A;  2AUX A;  3IV2 A;  2FQ9 A;  2YJ2 A;  2AUZ A;  3C9E A;  1ITO A;  3F75 A;  1AU0 A;  6PAD A;  2R9F A;  4QH6 A;  1VJV A;  1PXV A;  3IUT A;  2FO5 A;  1IWD A;  3CBK A;  3WXF A;  2DCD A;  2YJC A;  1KHP A;  3BWK A;  4YYU A;  5EF4 A;  2XU1 A;  3KX1 A;  4AXL A;  3IHP A;  4W5B A;  3WXG A;  1YAL A;  4BSQ A;  4CDF B;  4GUZ A;  2R9C A;  4OEL A;  1MEG A;  1PCI A;  1CJL A;  2G6D A;  1SP4 B;  1W5R A;  3CH3 X;  3PNR A;  1CS8 A;  4N4Z A;  1ZIV A;  4K7C A;  5CVO B;  4C5P A;  4B55 A;  8PCH A;  1NQC A;  2Y5B A;  4OEM A;  2G7Y A;  4KLB A;  1TU6 A;  3OF9 A;  3BPF A;  2DC9 A;  3V6E A;  5JH3 A;  3M99 A;  3PBH A;  2XU5 A;  2C0Y A;  3U8E A;  3CH2 X;  3P5X A;  4FK5 A;  7PCK A;  3I3T A;  5A24 A;  2AU1 A;  1CTE A;  1KFU L;  1K3B B;  5JA7 A;  5F02 A;  3RVW A;  1F2C A;  5PAD A;  3HHA A;  2ATO A;  2OZ2 A;  3PDF A;  1CPJ A;  3OIS A;  2DCA A;  4P6E A;  3E1Z B;  1ME4 A;  1FH0 A;  3MOR A;  3USV A;  3ERV A;  1AIM A;  2PRE A;  2DZZ A;  1YT7 A;  2PNS A;  1HUC B;  1AU2 A;  1CV8 A;  1U9Q X;  4NV7 A;  1ICF A;  1MIR A;  2CB5 A;  3N4C A;  2VHF A;  1GEC E;  2XU4 A;  3QSD A;  1F29 A;  4X6H A;  2CIO A;  1PPD A;  1X9Y A;  2DCC A;  1EWM A;  4N8W A;  1VSN A;  2P86 A;  3OVZ A;  1QXP A;  4X6I A;  2PBH A;  2P7U A;  1DEU A;  1GLO A;  2YJ8 A;  4YYR A;  1AYV A;  1F2A A;  4BS6 A;  4YYS A;  1U5I A;  2JQF R;  1BY8 A;  1YK7 A;  4YV8 A;  1U9V A;  5CVM A;  1AEC A;  1AYW A;  2NQA A;  1ZCM A;  1AU4 A;  3F5V A;  3NHE A;  2DC6 A;  1NL6 A;  2GFO A;  3AI8 A;  4CDD B;  1YK8 A;  1CB5 A;  5J94 A;  3BCN A;  2AYN A;  1TLO A;  1F2B A;  2AS8 A;  2H7J A;  2NQD B;  2FT2 A;  5CVN B;  3HHI A;  4QRX A;  1CSB B;  2R9M A;  5CHT A;  2R9N A;  3OF8 A;  1EWL A;  4NV8 A;  2IPP B;  1NLJ A;  1XKG A;  1PPN A;  2IBI A;  2YJB A;  2BSZ A;  3D6S A;  1NB5 A;  1NB3 A;  2FRA A;  4QRV A;  3RVV A;  2F7D A;  1ATK A;  4RY2 A;  4CDE B;  4P6G A;  3QJ3 A;  4QBB A;  1CVZ A;  2O6X A;  3IEJ A;  4PP2 E;  1U9X A;  3KWZ A;  1JQP A;  3MHH A;  3BC3 A;  2AIM A;  2DJF B;  2DJG B;  2XU3 A;  1ME3 A;  4BGF A;  3P5U A;  2JQG R;  2OP3 A;  1M6D A;  4DMY A;  2BDL A;  1THE A;  1YVB A;  3DF0 A;  2VFC A;  2F1G A;  4I07 A;  4Q8H A;  1AYU A;  3CBJ A;  1PPO A;  1SNK A;  2AYO A;  5FPW A;  2ACT A;  1AU3 A;  3K8U A;  1STF E;  3GCB A;  4N79 A;  2Y6E A;  2B1M A;  1PAD A;  1A6R A;  3S3R A;  2VHS A;  4BQV A;  2NQI A;  3P5V A;  3LTW A;  4YYW A;  1QDQ A;  2HXZ A;  2G8E A;  3LFY A;  3WXE A;  2GHU A;  3O1G A;  4XUI A;  4WA6 A;  3MTN A;  1BGO A;  3RVX A;  1GMY A;  4I05 A;  3B79 A;  4DMX A;  4I04 A;  1PE6 A;  2HHN A;  2B1N A;  1KFX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...