1BQIA

Use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PAPAIN
total genus 62
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1998-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bqiA00
2R9OA 4N79A 3H8BA 3U8EA 1F29A 2FO5A 1CVZA 1MEMA 1BGOA 3BWKA 3GCBA 2YJ9A 1HUCB 4Q8HA 2Y6EA 1GECE 1U5IA 2ARYA 3WXGA 4YV8A 1FH0A 1SP4B 1NL6A 3MHSA 3RVXA 4W4UA 3V6CA 4HWYA 1EWLA 2NQGA 2XU4A 1ITOA 2JQGR 1AU4A 2VHSA 4PI3A 1CTEA 2DCAA 4X6HA 1VSNA 3N3KA 3QT4A 4YYQA 3IV2A 1K3BB 3TNXA 3USVA 4YYRA 1X9YA 4BS5A 1CS8A 2FTDA 1BQIA 2G7YA 3H7DA 1KHQA 1PE6A 3HHIA 3KFQA 2B1NA 3S3QA 2Y5BA 1PPOA 4Q8GA 2YJ8A 3P5XA 5EF4A 3KSEA 1YK7A 3RVWA 2R6NA 1PIPA 1GLOA 4XR7A 1PADA 3IUTA 3F75A 5CVOB 1GCBA 1MDWA 2O6XA 2GFOA 2WBFX 2PBHA 2NQIA 3RVVA 3O0UA 3IOQA 1EWPA 4YYWA 3KWBX 1AYVA 2F7DA 4W5CA 3O1GA 1MEGA 1GMYA 1MS6A 2FT2A 1QMYA 3IMAA 1O0EA 1U9XA 2DCCA 6PADA 3CBJA 2HD5A 1F2BA 3I3TA 4YVAA 2AUZA 3K8UA 3KW9A 1PPPA 1AU2A 2DZZA 2CB5A 3IEJA 2R9CA 2G8JA 1ME4A 4DMYA 2R9FA 4FK5A 4CDCB 1Y08A 2DC6A 2NQDB 4CZWA 3OVZA 2AIMA 2E00A 2YJ2A 1XKGA 3PBHA 1PXVA 5JH3A 4YYVA 3K24A 5A24A 2DCDA 4QBBA 2FRQA 1SNKA 3ERVA 2AYOA 2H7JA 4YYSA 3ZUAA 1U9VA 2AYNA 2CIOA 2PADA 1F2AA 1AYUA 2DC9A 4FJCA 2JQFR 1EWOA 3P5VA 1ICFA 2ACTA 2IBIA 2HH5A 3KKUA 2XU5A 1CJLA 4N4ZA 3OVXA 1QXPA 3AI8A 1YK8A 2P7UA 1KFXL 2FRAA 1S4VA 4BQVA 2B1MA 2P0RA 1AECA 3H89A 1DF0A 2AUXA 2P86A 4CDDB 1PCIA 1ZIVA 2AVWA 1U9WA 1VJVA 4FIPA 2HHNA 1CQDA 1ATKA 1CV8A 4QRGA 1TU6A 2IPPB 3KWZA 1AYWA 5F02A 4PP2E 3NHEA 2HXZA 3BPFA 2E03A 4OELA 3P5UA 2AS8A 3C9EA 1Y4HA 1POPA 3PDFA 8PCHA 1AIMA 4RY2A 4X6IA 3H6SA 4N8WA 1PPNA 2E02A 3HWNA 2BDZA 2G6DA 1ME3A 4OEMA 1QDQA 2PREA 4MZOA 3F5VA 2BDLA 3HHAA 2AU1A 4I07A 4YYUA 1THEA 9PAPA 5FPWA 2DJFB 3OF9A 2VHFA 2DC7A 3BCNA 1JQPA 3CH2X 2DZYA 4WA6A 4QH6A 4CDFB 4PADA 1ZCMA 5PADA 3OISA 4QRXA 4W5BA 4QRVA 3K9MA 2OP3A 3I06A 1MIRA 3N3GA 1CSBB 1KXRA 3OF8A 4I05A 3PNRA 1CB5A 1IWDA 3D6SA 5JA7A 2R9NA 4CDEB 3CBKA 1NPZA 1YT7A 2E01A 1Q6KA 1DEUA 1PPDA 1YALA 3MORA 3N4CA 2PNSA 1U9QX 5CHVA 2F1GA 3MTNA 4DMXA 4K7CA 3M99A 2XU1A 3MHHA 1NQCA 4MZSA 3LXSA 3LFYA 5CVNB 2XU3A 1KHPA 2ATOA 7PCKA 4P6GA 1EWMA 2FQ9A 3B79A 3BPMA 4XUIA 4G54A 1CPJA 4X6JA 3KX1A 3PW3A 5CVMA 1NLJA 4KLBA 4ZUXU 1A6RA 3DF0A 4AXLA 3HD3A 3E1ZB 1PBHA 1QOLA 2FYEA 3WXFA 4BS6A 1BP4A 2NQAA 2G8EA 1MHWA 1YVBA 2OZ2A 3QSDA 5J94A 1NB3A 2FUDA 4BSQA 4MSXA 3S3RA 1F2CA 4I04A 4BPVA 3V6EA 4PP1A 2DCBA 1NB5A 4AXMA 1TLOA 3BC3A 1STFE 2DJGB 2OULA 2YJBA 1KFUL 2R9MA 3CH3X 5CHTA 1BY8A 3IHPA 2GHUA 3H8CA 5EGWA 4P6EA 2YJCA 1EF7A 3P5WA 1TL9A 3WXEA 3BOWA 2C0YA 3QJ3A 1M6DA 1AU3A 5K16A 1AU0A 2DC8A
chains in the Genus database with same CATH superfamily
2R9OA 4N79A 3RNVA 3H8BA 3U8EA 1F29A 2FO5A 1CVZA 1MEMA 1BGOA 3BWKA 3GCBA 2YJ9A 1HUCB 4Q8HA 2Y6EA 1GECE 1U5IA 3MP2A 2ARYA 3WXGA 4YV8A 1FH0A 1PVJA 4PT5A 1SP4B 1NL6A 3MHSA 3RVXA 4W4UA 4IUMA 3V6CA 4HWYA 4RF1A 1EWLA 2NQGA 2XU4A 1ITOA 2JQGR 1AU4A 3E9SA 2VHSA 4PI3A 1CTEA 2DCAA 4X6HA 1VSNA 3N3KA 3QT4A 4YYQA 3IV2A 1K3BB 3TNXA 3USVA 4YYRA 1X9YA 4BS5A 1CS8A 2FTDA 4M0WA 1BQIA 2G7YA 4BOUA 3IFUA 3PHWA 3H7DA 1YZBA 3BY4A 1KHQA 1PE6A 3HHIA 3KFQA 2B1NA 3S3QA 3MTVA 2Y5BA 4REZA 1PPOA 4Q8GA 2YJ8A 3P5XA 5EF4A 3KSEA 3ZNHA 1YK7A 3RVWA 2R6NA 1PIPA 1GLOA 4XR7A 1PADA 3IUTA 3F75A 5CVOB 1GCBA 1MDWA 2O6XA 2GFOA 2WBFX 2PBHA 2NQIA 3RVVA 3O0UA 3IOQA 2J7QA 1EWPA 4YYWA 3KWBX 1AYVA 2F7DA 4W5CA 3O1GA 1MEGA 1GMYA 1MS6A 2FT2A 1QMYA 3IMAA 1O0EA 1U9XA 2DCCA 6PADA 3CBJA 2HD5A 1F2BA 3I3TA 4YVAA 2AUZA 3K8UA 4MM3B 3KW9A 3TMPA 1PPPA 1AU2A 2DZZA 2CB5A 3IEJA 3W30A 2R9CA 2G8JA 1ME4A 4D8IA 4DMYA 2R9FA 4FK5A 3B21A 4CDCB 1Y08A 2DC6A 4OW0A 4A5UA 2NQDB 4CZWA 3OVZA 2AIMA 2E00A 2YJ2A 1XKGA 3PBHA 1PXVA 2BTWB 5JH3A 4YYVA 3K24A 4GUAA 5A24A 5E6JA 2DCDA 4QBBA 1DKIA 2FRQA 1SNKA 3ERVA 2AYOA 2H7JA 4YYSA 3ZUAA 1U9VA 2AYNA 2CIOA 2PADA 1F2AA 4OVZA 1AYUA 5EZQA 2DC9A 4FJCA 2JQFR 1EWOA 3P5VA 2JTCA 1ICFA 2ACTA 2IBIA 2HH5A 3KKUA 2XU5A 1CJLA 4WURA 4N4ZA 3OVXA 1QXPA 3AI8A 3PHUA 1YK8A 2P7UA 1KFXL 2FRAA 1S4VA 4BQVA 2B1MA 2P0RA 1AECA 4RNAA 3C0RA 3H89A 1DF0A 2AUXA 2P86A 4CDDB 1PCIA 1ZIVA 2AVWA 1U9WA 1VJVA 4FIPA 2HHNA 1CQDA 1ATKA 1CV8A 4QRGA 1TU6A 2IPPB 3KWZA 4XZXA 1AYWA 5F02A 4PP2E 3NHEA 2HXZA 3BPFA 4ZTBA 2E03A 4OELA 3P5UA 2AS8A 3C9EA 1Y4HA 1POPA 3PDFA 8PCHA 4BOQA 1AIMA 4RY2A 4X6IA 3H6SA 4N8WA 1PPNA 2E02A 3HWNA 2BDZA 4MI7A 3W31A 2AGAA 2G6DA 1ME3A 4OEMA 1QDQA 2PREA 4MZOA 4BOSA 3F5VA 2BDLA 3HHAA 2AU1A 4I07A 3BB7A 1THEA 4YYUA 9PAPA 5FPWA 2DJFB 3OF9A 2VHFA 2DC7A 3BCNA 5KO3A 1JQPA 3CH2X 2DZYA 2BTWA 4WA6A 4QH6A 4CDFB 4PADA 3PT2A 1ZCMA 5PADA 3OISA 4QRXA 4W5BA 3PSEA 4QRVA 3K9MA 2OP3A 3I06A 1MIRA 3N3GA 1CSBB 1KXRA 3OF8A 4I05A 3PNRA 4HXDB 1CB5A 1IWDA 3D6SA 2HWKA 5JA7A 2R9NA 4CDEB 3CBKA 1NPZA 1YT7A 2FE8A 2E01A 1Q6KA 1DEUA 1PPDA 1YALA 3O65A 3MORA 3N4CA 2PNSA 1U9QX 5CHVA 2F1GA 3MTNA 4DMXA 4K7CA 3OQCA 3M99A 4RF0A 2XU1A 3MHHA 1NQCA 4MZSA 3LXSA 3LFYA 5CVNB 2XU3A 1KHPA 3PRMA 3TRKA 2ATOA 7PCKA 4P6GA 1EWMA 2Z84A 4IP3A 2FQ9A 3B79A 3BPMA 4XUIA 1UKFA 4G54A 1CPJA 4X6JA 4RKXA 3BBAA 3KX1A 4D8BA 3PW3A 5CVMA 1NLJA 4KLBA 5JZEA 4ZUXU 4R3DA 1A6RA 3DF0A 4AXLA 3HD3A 4D8EA 3E1ZB 1PBHA 1QOLA 2FYEA 3WXFA 4BS6A 1BP4A 2NQAA 2G8EA 1MHWA 1YVBA 2OZ2A 3QSDA 5J94A 1NB3A 2FUDA 4BSQA 4MSXA 3S3RA 1F2CA 4I04A 4BOPA 4BPVA 3PHXA 2JRIA 3V6EA 4PP1A 4P16A 2DCBA 1NB5A 4AXMA 1TLOA 3BC3A 3PRPA 1STFE 2DJGB 4BOZA 2OULA 2YJBA 1KFUL 2R9MA 3CH3X 5CHTA 1BY8A 3IHPA 2BU3A 2GHUA 3H8CA 2UZJA 4P6EA 2YJCA 5EGWA 1EF7A 3P5WA 1TL9A 3WXEA 3BOWA 2C0YA 3QJ3A 5EZSA 3MJ5A 1M6DA 1AU3A 5K16A 4OVZB 2J7QC 1AU0A 2DC8A 2DOSA
chains in the Genus database with same CATH topology
2R9OA 4N79A 3H8BA 3U8EA 1F29A 2FO5A 1CVZA 1MEMA 1BGOA 3BWKA 3GCBA 1GX3A 2YJ9A 1HUCB 4Q8HA 2Y6EA 1GECE 1U5IA 2ARYA 3WXGA 4YV8A 1FH0A 1SP4B 1NL6A 3MHSA 3RVXA 4W4UA 1W6FA 3V6CA 4HWYA 1EWLA 2NQGA 2XU4A 1ITOA 2JQGR 1AU4A 2VHSA 4PI3A 1CTEA 2DCAA 4X6HA 1VSNA 3N3KA 3QT4A 4YYQA 3IV2A 1K3BB 3TNXA 3USVA 4YYRA 1X9YA 4BS5A 1CS8A 2FTDA 1BQIA 2G7YA 3H7DA 4BGFA 1KHQA 1PE6A 3HHIA 3KFQA 2B1NA 3S3QA 2Y5BA 1PPOA 4Q8GA 2YJ8A 3P5XA 1E2TA 5EF4A 3KSEA 1YK7A 4C5PA 3RVWA 2R6NA 1PIPA 1GLOA 4XR7A 1PADA 3IUTA 3F75A 5CVOB 1W4TA 1GCBA 1MDWA 2O6XA 2GFOA 2WBFX 2PBHA 2NQIA 3RVVA 3O0UA 3IOQA 1EWPA 3D9WA 4YYWA 3KWBX 1AYVA 2F7DA 4W5CA 3O1GA 1MEGA 1GMYA 1MS6A 2FT2A 1QMYA 3IMAA 1O0EA 1U9XA 2DCCA 6PADA 3CBJA 2HD5A 1F2BA 3I3TA 4YVAA 2AUZA 3K8UA 3KW9A 1PPPA 1AU2A 2DZZA 2CB5A 3IEJA 2R9CA 2G8JA 1ME4A 4DMYA 2R9FA 4FK5A 4CDCB 1Y08A 2DC6A 2NQDB 4CZWA 3OVZA 3LTWA 2AIMA 2E00A 2YJ2A 1XKGA 3PBHA 1PXVA 5JH3A 4YYVA 3K24A 5A24A 2DCDA 4QBBA 2FRQA 1SNKA 3ERVA 2AYOA 2H7JA 4YYSA 3ZUAA 1U9VA 2AYNA 2CIOA 2PADA 1F2AA 1AYUA 2DC9A 4FJCA 2JQFR 4NV7A 1EWOA 3P5VA 1ICFA 2ACTA 2IBIA 2HH5A 3KKUA 2XU5A 1CJLA 4N4ZA 3OVXA 1QXPA 3AI8A 1YK8A 2P7UA 1KFXL 2FRAA 1S4VA 4BQVA 2B1MA 2P0RA 1AECA 3H89A 1DF0A 2AUXA 2P86A 4CDDB 1PCIA 1ZIVA 2AVWA 1U9WA 1VJVA 4FIPA 2HHNA 1CQDA 1ATKA 1CV8A 4QRGA 1TU6A 2IPPB 3KWZA 1AYWA 5F02A 4PP2E 3NHEA 2HXZA 3BPFA 2E03A 4OELA 3P5UA 2AS8A 3C9EA 1Y4HA 1POPA 3PDFA 8PCHA 2VFCA 1AIMA 4RY2A 4X6IA 3H6SA 4N8WA 1PPNA 2E02A 3HWNA 2BDZA 2G6DA 1ME3A 4OEMA 1QDQA 2PREA 4MZOA 3F5VA 2BDLA 3HHAA 2AU1A 4I07A 4YYUA 1THEA 9PAPA 5FPWA 2DJFB 3OF9A 2VHFA 2DC7A 3BCNA 1JQPA 3CH2X 2DZYA 4WA6A 4QH6A 4CDFB 4PADA 1ZCMA 5PADA 3OISA 4QRXA 4W5BA 4QRVA 3K9MA 2OP3A 3I06A 1MIRA 3N3GA 1CSBB 1KXRA 3OF8A 4I05A 3PNRA 1CB5A 1IWDA 3D6SA 5JA7A 2R9NA 4CDEB 3CBKA 1NPZA 1YT7A 2E01A 1Q6KA 1DEUA 1PPDA 1YALA 3MORA 1W5RA 3N4CA 2PNSA 1U9QX 5CHVA 2F1GA 3MTNA 4DMXA 4K7CA 3M99A 2XU1A 3MHHA 1NQCA 4MZSA 3LXSA 3LFYA 5CVNB 2XU3A 1KHPA 2ATOA 7PCKA 4P6GA 1EWMA 2FQ9A 3B79A 3BPMA 4XUIA 4G54A 1CPJA 4X6JA 3KX1A 3PW3A 5CVMA 1NLJA 4KLBA 4ZUXU 1A6RA 3DF0A 4AXLA 3HD3A 3E1ZB 1PBHA 1QOLA 2FYEA 3WXFA 4BS6A 1BP4A 2NQAA 4GUZA 2G8EA 1MHWA 1YVBA 2OZ2A 3QSDA 5J94A 1NB3A 2FUDA 4BSQA 4MSXA 3S3RA 1F2CA 4I04A 4BPVA 3V6EA 4B55A 4PP1A 2DCBA 1NB5A 2BSZA 4AXMA 1TLOA 3BC3A 1STFE 2DJGB 2OULA 2YJBA 1KFUL 2R9MA 3CH3X 5CHTA 1BY8A 3IHPA 2GHUA 3H8CA 5EGWA 4P6EA 2YJCA 1EF7A 3P5WA 1TL9A 2VFBA 3WXEA 3BOWA 2C0YA 4NV8A 3QJ3A 1M6DA 1AU3A 5K16A 1AU0A 2DC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9O A;  4N79 A;  3H8B A;  3U8E A;  1F29 A;  2FO5 A;  1CVZ A;  1MEM A;  1BGO A;  3BWK A;  3GCB A;  2YJ9 A;  1HUC B;  4Q8H A;  2Y6E A;  1GEC E;  1U5I A;  2ARY A;  3WXG A;  4YV8 A;  1FH0 A;  1SP4 B;  1NL6 A;  3MHS A;  3RVX A;  4W4U A;  3V6C A;  4HWY A;  1EWL A;  2NQG A;  2XU4 A;  1ITO A;  2JQG R;  1AU4 A;  2VHS A;  4PI3 A;  1CTE A;  2DCA A;  4X6H A;  1VSN A;  3N3K A;  3QT4 A;  4YYQ A;  3IV2 A;  1K3B B;  3TNX A;  3USV A;  4YYR A;  1X9Y A;  4BS5 A;  1CS8 A;  2FTD A;  1BQI A;  2G7Y A;  3H7D A;  1KHQ A;  1PE6 A;  3HHI A;  3KFQ A;  2B1N A;  3S3Q A;  2Y5B A;  1PPO A;  4Q8G A;  2YJ8 A;  3P5X A;  5EF4 A;  3KSE A;  1YK7 A;  3RVW A;  2R6N A;  1PIP A;  1GLO A;  4XR7 A;  1PAD A;  3IUT A;  3F75 A;  5CVO B;  1GCB A;  1MDW A;  2O6X A;  2GFO A;  2WBF X;  2PBH A;  2NQI A;  3RVV A;  3O0U A;  3IOQ A;  1EWP A;  4YYW A;  3KWB X;  1AYV A;  2F7D A;  4W5C A;  3O1G A;  1MEG A;  1GMY A;  1MS6 A;  2FT2 A;  1QMY A;  3IMA A;  1O0E A;  1U9X A;  2DCC A;  6PAD A;  3CBJ A;  2HD5 A;  1F2B A;  3I3T A;  4YVA A;  2AUZ A;  3K8U A;  3KW9 A;  1PPP A;  1AU2 A;  2DZZ A;  2CB5 A;  3IEJ A;  2R9C A;  2G8J A;  1ME4 A;  4DMY A;  2R9F A;  4FK5 A;  4CDC B;  1Y08 A;  2DC6 A;  2NQD B;  4CZW A;  3OVZ A;  2AIM A;  2E00 A;  2YJ2 A;  1XKG A;  3PBH A;  1PXV A;  5JH3 A;  4YYV A;  3K24 A;  5A24 A;  2DCD A;  4QBB A;  2FRQ A;  1SNK A;  3ERV A;  2AYO A;  2H7J A;  4YYS A;  3ZUA A;  1U9V A;  2AYN A;  2CIO A;  2PAD A;  1F2A A;  1AYU A;  2DC9 A;  4FJC A;  2JQF R;  1EWO A;  3P5V A;  1ICF A;  2ACT A;  2IBI A;  2HH5 A;  3KKU A;  2XU5 A;  1CJL A;  4N4Z A;  3OVX A;  1QXP A;  3AI8 A;  1YK8 A;  2P7U A;  1KFX L;  2FRA A;  1S4V A;  4BQV A;  2B1M A;  2P0R A;  1AEC A;  3H89 A;  1DF0 A;  2AUX A;  2P86 A;  4CDD B;  1PCI A;  1ZIV A;  2AVW A;  1U9W A;  1VJV A;  4FIP A;  2HHN A;  1CQD A;  1ATK A;  1CV8 A;  4QRG A;  1TU6 A;  2IPP B;  3KWZ A;  1AYW A;  5F02 A;  4PP2 E;  3NHE A;  2HXZ A;  3BPF A;  2E03 A;  4OEL A;  3P5U A;  2AS8 A;  3C9E A;  1Y4H A;  1POP A;  3PDF A;  8PCH A;  1AIM A;  4RY2 A;  4X6I A;  3H6S A;  4N8W A;  1PPN A;  2E02 A;  3HWN A;  2BDZ A;  2G6D A;  1ME3 A;  4OEM A;  1QDQ A;  2PRE A;  4MZO A;  3F5V A;  2BDL A;  3HHA A;  2AU1 A;  4I07 A;  4YYU A;  1THE A;  9PAP A;  5FPW A;  2DJF B;  3OF9 A;  2VHF A;  2DC7 A;  3BCN A;  1JQP A;  3CH2 X;  2DZY A;  4WA6 A;  4QH6 A;  4CDF B;  4PAD A;  1ZCM A;  5PAD A;  3OIS A;  4QRX A;  4W5B A;  4QRV A;  3K9M A;  2OP3 A;  3I06 A;  1MIR A;  3N3G A;  1CSB B;  1KXR A;  3OF8 A;  4I05 A;  3PNR A;  1CB5 A;  1IWD A;  3D6S A;  5JA7 A;  2R9N A;  4CDE B;  3CBK A;  1NPZ A;  1YT7 A;  2E01 A;  1Q6K A;  1DEU A;  1PPD A;  1YAL A;  3MOR A;  3N4C A;  2PNS A;  1U9Q X;  5CHV A;  2F1G A;  3MTN A;  4DMX A;  4K7C A;  3M99 A;  2XU1 A;  3MHH A;  1NQC A;  4MZS A;  3LXS A;  3LFY A;  5CVN B;  2XU3 A;  1KHP A;  2ATO A;  7PCK A;  4P6G A;  1EWM A;  2FQ9 A;  3B79 A;  3BPM A;  4XUI A;  4G54 A;  1CPJ A;  4X6J A;  3KX1 A;  3PW3 A;  5CVM A;  1NLJ A;  4KLB A;  4ZUX U;  1A6R A;  3DF0 A;  4AXL A;  3HD3 A;  3E1Z B;  1PBH A;  1QOL A;  2FYE A;  3WXF A;  4BS6 A;  1BP4 A;  2NQA A;  2G8E A;  1MHW A;  1YVB A;  2OZ2 A;  3QSD A;  5J94 A;  1NB3 A;  2FUD A;  4BSQ A;  4MSX A;  3S3R A;  1F2C A;  4I04 A;  4BPV A;  3V6E A;  4PP1 A;  2DCB A;  1NB5 A;  4AXM A;  1TLO A;  3BC3 A;  1STF E;  2DJG B;  2OUL A;  2YJB A;  1KFU L;  2R9M A;  3CH3 X;  5CHT A;  1BY8 A;  3IHP A;  2GHU A;  3H8C A;  5EGW A;  4P6E A;  2YJC A;  1EF7 A;  3P5W A;  1TL9 A;  3WXE A;  3BOW A;  2C0Y A;  3QJ3 A;  1M6D A;  1AU3 A;  5K16 A;  1AU0 A;  2DC8 A; 
#chains in the Genus database with same CATH topology
 2R9O A;  4N79 A;  3RNV A;  3H8B A;  3U8E A;  1F29 A;  2FO5 A;  1CVZ A;  1MEM A;  1BGO A;  3BWK A;  3GCB A;  2YJ9 A;  1HUC B;  4Q8H A;  2Y6E A;  1GEC E;  1U5I A;  3MP2 A;  2ARY A;  3WXG A;  4YV8 A;  1FH0 A;  1PVJ A;  4PT5 A;  1SP4 B;  1NL6 A;  3MHS A;  3RVX A;  4W4U A;  4IUM A;  3V6C A;  4HWY A;  4RF1 A;  1EWL A;  2NQG A;  2XU4 A;  1ITO A;  2JQG R;  1AU4 A;  3E9S A;  2VHS A;  4PI3 A;  1CTE A;  2DCA A;  4X6H A;  1VSN A;  3N3K A;  3QT4 A;  4YYQ A;  3IV2 A;  1K3B B;  3TNX A;  3USV A;  4YYR A;  1X9Y A;  4BS5 A;  1CS8 A;  2FTD A;  4M0W A;  1BQI A;  2G7Y A;  4BOU A;  3IFU A;  3PHW A;  3H7D A;  1YZB A;  3BY4 A;  1KHQ A;  1PE6 A;  3HHI A;  3KFQ A;  2B1N A;  3S3Q A;  3MTV A;  2Y5B A;  4REZ A;  1PPO A;  4Q8G A;  2YJ8 A;  3P5X A;  5EF4 A;  3KSE A;  3ZNH A;  1YK7 A;  3RVW A;  2R6N A;  1PIP A;  1GLO A;  4XR7 A;  1PAD A;  3IUT A;  3F75 A;  5CVO B;  1GCB A;  1MDW A;  2O6X A;  2GFO A;  2WBF X;  2PBH A;  2NQI A;  3RVV A;  3O0U A;  3IOQ A;  2J7Q A;  1EWP A;  4YYW A;  3KWB X;  1AYV A;  2F7D A;  4W5C A;  3O1G A;  1MEG A;  1GMY A;  1MS6 A;  2FT2 A;  1QMY A;  3IMA A;  1O0E A;  1U9X A;  2DCC A;  6PAD A;  3CBJ A;  2HD5 A;  1F2B A;  3I3T A;  4YVA A;  2AUZ A;  3K8U A;  4MM3 B;  3KW9 A;  3TMP A;  1PPP A;  1AU2 A;  2DZZ A;  2CB5 A;  3IEJ A;  3W30 A;  2R9C A;  2G8J A;  1ME4 A;  4D8I A;  4DMY A;  2R9F A;  4FK5 A;  3B21 A;  4CDC B;  1Y08 A;  2DC6 A;  4OW0 A;  4A5U A;  2NQD B;  4CZW A;  3OVZ A;  2AIM A;  2E00 A;  2YJ2 A;  1XKG A;  3PBH A;  1PXV A;  2BTW B;  5JH3 A;  4YYV A;  3K24 A;  4GUA A;  5A24 A;  5E6J A;  2DCD A;  4QBB A;  1DKI A;  2FRQ A;  1SNK A;  3ERV A;  2AYO A;  2H7J A;  4YYS A;  3ZUA A;  1U9V A;  2AYN A;  2CIO A;  2PAD A;  1F2A A;  4OVZ A;  1AYU A;  5EZQ A;  2DC9 A;  4FJC A;  2JQF R;  1EWO A;  3P5V A;  2JTC A;  1ICF A;  2ACT A;  2IBI A;  2HH5 A;  3KKU A;  2XU5 A;  1CJL A;  4WUR A;  4N4Z A;  3OVX A;  1QXP A;  3AI8 A;  3PHU A;  1YK8 A;  2P7U A;  1KFX L;  2FRA A;  1S4V A;  4BQV A;  2B1M A;  2P0R A;  1AEC A;  4RNA A;  3C0R A;  3H89 A;  1DF0 A;  2AUX A;  2P86 A;  4CDD B;  1PCI A;  1ZIV A;  2AVW A;  1U9W A;  1VJV A;  4FIP A;  2HHN A;  1CQD A;  1ATK A;  1CV8 A;  4QRG A;  1TU6 A;  2IPP B;  3KWZ A;  4XZX A;  1AYW A;  5F02 A;  4PP2 E;  3NHE A;  2HXZ A;  3BPF A;  4ZTB A;  2E03 A;  4OEL A;  3P5U A;  2AS8 A;  3C9E A;  1Y4H A;  1POP A;  3PDF A;  8PCH A;  4BOQ A;  1AIM A;  4RY2 A;  4X6I A;  3H6S A;  4N8W A;  1PPN A;  2E02 A;  3HWN A;  2BDZ A;  4MI7 A;  3W31 A;  2AGA A;  2G6D A;  1ME3 A;  4OEM A;  1QDQ A;  2PRE A;  4MZO A;  4BOS A;  3F5V A;  2BDL A;  3HHA A;  2AU1 A;  4I07 A;  3BB7 A;  1THE A;  4YYU A;  9PAP A;  5FPW A;  2DJF B;  3OF9 A;  2VHF A;  2DC7 A;  3BCN A;  5KO3 A;  1JQP A;  3CH2 X;  2DZY A;  2BTW A;  4WA6 A;  4QH6 A;  4CDF B;  4PAD A;  3PT2 A;  1ZCM A;  5PAD A;  3OIS A;  4QRX A;  4W5B A;  3PSE A;  4QRV A;  3K9M A;  2OP3 A;  3I06 A;  1MIR A;  3N3G A;  1CSB B;  1KXR A;  3OF8 A;  4I05 A;  3PNR A;  4HXD B;  1CB5 A;  1IWD A;  3D6S A;  2HWK A;  5JA7 A;  2R9N A;  4CDE B;  3CBK A;  1NPZ A;  1YT7 A;  2FE8 A;  2E01 A;  1Q6K A;  1DEU A;  1PPD A;  1YAL A;  3O65 A;  3MOR A;  3N4C A;  2PNS A;  1U9Q X;  5CHV A;  2F1G A;  3MTN A;  4DMX A;  4K7C A;  3OQC A;  3M99 A;  4RF0 A;  2XU1 A;  3MHH A;  1NQC A;  4MZS A;  3LXS A;  3LFY A;  5CVN B;  2XU3 A;  1KHP A;  3PRM A;  3TRK A;  2ATO A;  7PCK A;  4P6G A;  1EWM A;  2Z84 A;  4IP3 A;  2FQ9 A;  3B79 A;  3BPM A;  4XUI A;  1UKF A;  4G54 A;  1CPJ A;  4X6J A;  4RKX A;  3BBA A;  3KX1 A;  4D8B A;  3PW3 A;  5CVM A;  1NLJ A;  4KLB A;  5JZE A;  4ZUX U;  4R3D A;  1A6R A;  3DF0 A;  4AXL A;  3HD3 A;  4D8E A;  3E1Z B;  1PBH A;  1QOL A;  2FYE A;  3WXF A;  4BS6 A;  1BP4 A;  2NQA A;  2G8E A;  1MHW A;  1YVB A;  2OZ2 A;  3QSD A;  5J94 A;  1NB3 A;  2FUD A;  4BSQ A;  4MSX A;  3S3R A;  1F2C A;  4I04 A;  4BOP A;  4BPV A;  3PHX A;  2JRI A;  3V6E A;  4PP1 A;  4P16 A;  2DCB A;  1NB5 A;  4AXM A;  1TLO A;  3BC3 A;  3PRP A;  1STF E;  2DJG B;  4BOZ A;  2OUL A;  2YJB A;  1KFU L;  2R9M A;  3CH3 X;  5CHT A;  1BY8 A;  3IHP A;  2BU3 A;  2GHU A;  3H8C A;  2UZJ A;  4P6E A;  2YJC A;  5EGW A;  1EF7 A;  3P5W A;  1TL9 A;  3WXE A;  3BOW A;  2C0Y A;  3QJ3 A;  5EZS A;  3MJ5 A;  1M6D A;  1AU3 A;  5K16 A;  4OVZ B;  2J7Q C;  1AU0 A;  2DC8 A;  2DOS A; 
#chains in the Genus database with same CATH homology
 2R9O A;  4N79 A;  3H8B A;  3U8E A;  1F29 A;  2FO5 A;  1CVZ A;  1MEM A;  1BGO A;  3BWK A;  3GCB A;  1GX3 A;  2YJ9 A;  1HUC B;  4Q8H A;  2Y6E A;  1GEC E;  1U5I A;  2ARY A;  3WXG A;  4YV8 A;  1FH0 A;  1SP4 B;  1NL6 A;  3MHS A;  3RVX A;  4W4U A;  1W6F A;  3V6C A;  4HWY A;  1EWL A;  2NQG A;  2XU4 A;  1ITO A;  2JQG R;  1AU4 A;  2VHS A;  4PI3 A;  1CTE A;  2DCA A;  4X6H A;  1VSN A;  3N3K A;  3QT4 A;  4YYQ A;  3IV2 A;  1K3B B;  3TNX A;  3USV A;  4YYR A;  1X9Y A;  4BS5 A;  1CS8 A;  2FTD A;  1BQI A;  2G7Y A;  3H7D A;  4BGF A;  1KHQ A;  1PE6 A;  3HHI A;  3KFQ A;  2B1N A;  3S3Q A;  2Y5B A;  1PPO A;  4Q8G A;  2YJ8 A;  3P5X A;  1E2T A;  5EF4 A;  3KSE A;  1YK7 A;  4C5P A;  3RVW A;  2R6N A;  1PIP A;  1GLO A;  4XR7 A;  1PAD A;  3IUT A;  3F75 A;  5CVO B;  1W4T A;  1GCB A;  1MDW A;  2O6X A;  2GFO A;  2WBF X;  2PBH A;  2NQI A;  3RVV A;  3O0U A;  3IOQ A;  1EWP A;  3D9W A;  4YYW A;  3KWB X;  1AYV A;  2F7D A;  4W5C A;  3O1G A;  1MEG A;  1GMY A;  1MS6 A;  2FT2 A;  1QMY A;  3IMA A;  1O0E A;  1U9X A;  2DCC A;  6PAD A;  3CBJ A;  2HD5 A;  1F2B A;  3I3T A;  4YVA A;  2AUZ A;  3K8U A;  3KW9 A;  1PPP A;  1AU2 A;  2DZZ A;  2CB5 A;  3IEJ A;  2R9C A;  2G8J A;  1ME4 A;  4DMY A;  2R9F A;  4FK5 A;  4CDC B;  1Y08 A;  2DC6 A;  2NQD B;  4CZW A;  3OVZ A;  3LTW A;  2AIM A;  2E00 A;  2YJ2 A;  1XKG A;  3PBH A;  1PXV A;  5JH3 A;  4YYV A;  3K24 A;  5A24 A;  2DCD A;  4QBB A;  2FRQ A;  1SNK A;  3ERV A;  2AYO A;  2H7J A;  4YYS A;  3ZUA A;  1U9V A;  2AYN A;  2CIO A;  2PAD A;  1F2A A;  1AYU A;  2DC9 A;  4FJC A;  2JQF R;  4NV7 A;  1EWO A;  3P5V A;  1ICF A;  2ACT A;  2IBI A;  2HH5 A;  3KKU A;  2XU5 A;  1CJL A;  4N4Z A;  3OVX A;  1QXP A;  3AI8 A;  1YK8 A;  2P7U A;  1KFX L;  2FRA A;  1S4V A;  4BQV A;  2B1M A;  2P0R A;  1AEC A;  3H89 A;  1DF0 A;  2AUX A;  2P86 A;  4CDD B;  1PCI A;  1ZIV A;  2AVW A;  1U9W A;  1VJV A;  4FIP A;  2HHN A;  1CQD A;  1ATK A;  1CV8 A;  4QRG A;  1TU6 A;  2IPP B;  3KWZ A;  1AYW A;  5F02 A;  4PP2 E;  3NHE A;  2HXZ A;  3BPF A;  2E03 A;  4OEL A;  3P5U A;  2AS8 A;  3C9E A;  1Y4H A;  1POP A;  3PDF A;  8PCH A;  2VFC A;  1AIM A;  4RY2 A;  4X6I A;  3H6S A;  4N8W A;  1PPN A;  2E02 A;  3HWN A;  2BDZ A;  2G6D A;  1ME3 A;  4OEM A;  1QDQ A;  2PRE A;  4MZO A;  3F5V A;  2BDL A;  3HHA A;  2AU1 A;  4I07 A;  4YYU A;  1THE A;  9PAP A;  5FPW A;  2DJF B;  3OF9 A;  2VHF A;  2DC7 A;  3BCN A;  1JQP A;  3CH2 X;  2DZY A;  4WA6 A;  4QH6 A;  4CDF B;  4PAD A;  1ZCM A;  5PAD A;  3OIS A;  4QRX A;  4W5B A;  4QRV A;  3K9M A;  2OP3 A;  3I06 A;  1MIR A;  3N3G A;  1CSB B;  1KXR A;  3OF8 A;  4I05 A;  3PNR A;  1CB5 A;  1IWD A;  3D6S A;  5JA7 A;  2R9N A;  4CDE B;  3CBK A;  1NPZ A;  1YT7 A;  2E01 A;  1Q6K A;  1DEU A;  1PPD A;  1YAL A;  3MOR A;  1W5R A;  3N4C A;  2PNS A;  1U9Q X;  5CHV A;  2F1G A;  3MTN A;  4DMX A;  4K7C A;  3M99 A;  2XU1 A;  3MHH A;  1NQC A;  4MZS A;  3LXS A;  3LFY A;  5CVN B;  2XU3 A;  1KHP A;  2ATO A;  7PCK A;  4P6G A;  1EWM A;  2FQ9 A;  3B79 A;  3BPM A;  4XUI A;  4G54 A;  1CPJ A;  4X6J A;  3KX1 A;  3PW3 A;  5CVM A;  1NLJ A;  4KLB A;  4ZUX U;  1A6R A;  3DF0 A;  4AXL A;  3HD3 A;  3E1Z B;  1PBH A;  1QOL A;  2FYE A;  3WXF A;  4BS6 A;  1BP4 A;  2NQA A;  4GUZ A;  2G8E A;  1MHW A;  1YVB A;  2OZ2 A;  3QSD A;  5J94 A;  1NB3 A;  2FUD A;  4BSQ A;  4MSX A;  3S3R A;  1F2C A;  4I04 A;  4BPV A;  3V6E A;  4B55 A;  4PP1 A;  2DCB A;  1NB5 A;  2BSZ A;  4AXM A;  1TLO A;  3BC3 A;  1STF E;  2DJG B;  2OUL A;  2YJB A;  1KFU L;  2R9M A;  3CH3 X;  5CHT A;  1BY8 A;  3IHP A;  2GHU A;  3H8C A;  5EGW A;  4P6E A;  2YJC A;  1EF7 A;  3P5W A;  1TL9 A;  2VFB A;  3WXE A;  3BOW A;  2C0Y A;  4NV8 A;  3QJ3 A;  1M6D A;  1AU3 A;  5K16 A;  1AU0 A;  2DC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...