1BQIA

Use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PAPAIN
total genus 62
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1998-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bqiA00
2CB5A 1O0EA 2WBFX 3CH3X 2R9OA 1ME4A 1CJLA 2IPPB 2HXZA 1POPA 1ZCMA 3O1GA 2HH5A 4N4ZA 2HHNA 4I04A 4PADA 1AU2A 3HWNA 1AYUA 1BP4A 2YJBA 1MEMA 1Q6KA 2DC7A 2F1GA 3ERVA 1SP4B 2ATOA 3MORA 2AYNA 3M99A 3MTNA 1PPNA 2H7JA 1THEA 1YK7A 3V6CA 3KKUA 5CVOB 3K24A 2XU5A 1GLOA 1X9YA 1U5IA 2E03A 5CVMA 1F2AA 1QMYA 3F75A 3LXSA 1AIMA 3BCNA 4ZUXU 2Y6EA 3KFQA 3USVA 4XR7A 1HUCB 1PE6A 2VHSA 2IBIA 1K3BB 3K9MA 1AYVA 2YJCA 3HD3A 3TNXA 4YYUA 2NQIA 5CHTA 2PREA 3I06A 4CDDB 2Y5BA 1CVZA 1QXPA 4YYSA 5EF4A 1MIRA 4FJCA 4Q8GA 2OULA 1M6DA 7PCKA 3NHEA 4YVAA 2DJFB 3QSDA 2DC6A 1A6RA 3ZUAA 1BQIA 2ACTA 4AXLA 3B79A 4CZWA 5JA7A 1KFUL 1NLJA 2ARYA 1DEUA 4X6IA 4X6JA 1CSBB 2P7UA 2G6DA 4PP1A 3PNRA 5EGWA 2AU1A 4K7CA 1MEGA 3N4CA 4I05A 1NQCA 4XUIA 1PCIA 4QRXA 2HD5A 4FIPA 3MHSA 2NQAA 2YJ8A 1AECA 1YVBA 3WXGA 1MHWA 1CPJA 1NL6A 4P6GA 3OF8A 4QRVA 1KHPA 3CBKA 1YALA 1PBHA 2AVWA 1EWPA 2BDZA 2AIMA 1F29A 2R9FA 6PADA 1XKGA 2R9MA 1NB5A 3O0UA 1AU0A 1AU3A 3H7DA 3IOQA 1Y4HA 4G54A 3PDFA 2PBHA 1VSNA 3KSEA 1DF0A 4KLBA 1KXRA 2PNSA 1PXVA 3H8CA 1ICFA 1YT7A 1QOLA 1NPZA 4PP2E 3H89A 4N79A 1GMYA 1VJVA 3P5VA 2XU1A 1KFXL 3WXEA 3DF0A 4QRGA 1Y08A 5JH3A 1TU6A 1F2CA 5FPWA 3PW3A 4FK5A 2DC9A 2AYOA 2DCBA 2G8JA 4QBBA 1U9WA 3D6SA 3E1ZB 3BC3A 3LFYA 3AI8A 4YYWA 4YYRA 2B1NA 3CBJA 4DMYA 4CDFB 4YYQA 3BOWA 1ZIVA 4W4UA 1TLOA 3HHIA 4QH6A 3QJ3A 2R9CA 1U9VA 4CDEB 4Q8HA 1NB3A 2OZ2A 2E00A 4MZOA 9PAPA 4I07A 1JQPA 4DMXA 4BS6A 2AS8A 2NQDB 2DCDA 3IEJA 1CQDA 2E01A 2O6XA 1TL9A 2AUXA 3HHAA 1QDQA 2GFOA 4MZSA 1EF7A 2JQFR 5PADA 4BSQA 2OP3A 2DC8A 2B1MA 4YV8A 1ME3A 2FRAA 1PPDA 3IUTA 2G8EA 4YYVA 2AUZA 2F7DA 3H8BA 1CB5A 3K8UA 1U9XA 2FRQA 3S3RA 1GCBA 3IMAA 1KHQA 3P5UA 1BY8A 1EWLA 3C9EA 4WA6A 3RVVA 4OELA 1EWMA 3S3QA 4W5CA 1ITOA 1CV8A 3F5VA 3OISA 3OVXA 3CH2X 4BQVA 4X6HA 3KWZA 4CDCB 4MSXA 5F02A 3P5XA 1EWOA 2FO5A 2VHFA 2DCCA 4RY2A 2YJ9A 2C0YA 4W5BA 1SNKA 1YK8A 1STFE 3RVXA 1U9QX 3OVZA 2NQGA 2XU4A 3U8EA 1ATKA 2YJ2A 3KWBX 2GHUA 2JQGR 3BPMA 3KX1A 4P6EA 1MS6A 2E02A 4HWYA 3I3TA 2XU3A 2FUDA 2R6NA 1PPPA 1CTEA 3IV2A 2P86A 3N3GA 2DCAA 4PI3A 5A24A 2BDLA 2DZZA 2FQ9A 1FH0A 3BWKA 2FT2A 5J94A 2G7YA 1AU4A 4BPVA 1PADA 5CVNB 3V6EA 1AYWA 2CIOA 1CS8A 2PADA 2DZYA 2R9NA 1IWDA 2FYEA 3RVWA 5K16A 3PBHA 1F2BA 2FTDA 3P5WA 5CHVA 1BGOA 3OF9A 3KW9A 2P0RA 8PCHA 4BS5A 1GECE 1S4VA 3GCBA 1PPOA 3MHHA 3WXFA 4OEMA 1PIPA 3IHPA 3QT4A 4N8WA 3N3KA 3H6SA 2DJGB 1MDWA 3BPFA 4AXMA
chains in the Genus database with same CATH superfamily
2CB5A 1O0EA 2WBFX 2BTWB 3ZNHA 3CH3X 2R9OA 1ME4A 1CJLA 2IPPB 2HXZA 1POPA 1ZCMA 3O1GA 2HH5A 4N4ZA 2HHNA 4I04A 4PADA 1AU2A 3HWNA 3B21A 1AYUA 1BP4A 2YJBA 1MEMA 3OQCA 1Q6KA 2DC7A 2F1GA 3ERVA 1SP4B 2ATOA 3MORA 1YZBA 2AYNA 3M99A 3MTNA 4RF0A 1PPNA 2H7JA 1THEA 1YK7A 2JTCA 3V6CA 3KKUA 5CVOB 3K24A 2XU5A 1GLOA 1X9YA 1U5IA 4HXDB 2E03A 5CVMA 1F2AA 1QMYA 3F75A 3LXSA 1AIMA 3BCNA 4ZUXU 2Y6EA 3KFQA 2Z84A 3USVA 2UZJA 4XR7A 1HUCB 1PE6A 2VHSA 2IBIA 1K3BB 3K9MA 1AYVA 2YJCA 3HD3A 3TNXA 4YYUA 2NQIA 5CHTA 2PREA 3I06A 4CDDB 2Y5BA 1CVZA 4IP3A 1QXPA 4YYSA 4PT5A 4D8IA 5EF4A 1MIRA 4FJCA 4Q8GA 2OULA 1M6DA 7PCKA 4MM3B 3NHEA 4YVAA 2DJFB 3PHWA 3QSDA 2DC6A 1A6RA 3ZUAA 1BQIA 2ACTA 2BTWA 4AXLA 3B79A 4CZWA 5JA7A 1KFUL 3RNVA 1NLJA 3C0RA 2ARYA 1DEUA 4X6IA 4X6JA 4A5UA 1CSBB 2P7UA 2G6DA 4PP1A 3PNRA 5EGWA 2AU1A 4K7CA 1MEGA 3N4CA 4I05A 1NQCA 4XUIA 1PCIA 4QRXA 2HD5A 3W30A 4WURA 4FIPA 3MHSA 2NQAA 2YJ8A 3PHXA 1AECA 1YVBA 3WXGA 1MHWA 4RF1A 1CPJA 3E9SA 1NL6A 4P6GA 3OF8A 4QRVA 2FE8A 1KHPA 3CBKA 1YALA 1PBHA 2AVWA 1EWPA 2BDZA 2DOSA 2AIMA 1F29A 4BOSA 2AGAA 3BB7A 2R9FA 6PADA 1XKGA 4BOZA 2R9MA 3PT2A 1NB5A 3PSEA 3O0UA 1AU0A 1AU3A 3H7DA 3IOQA 1Y4HA 4G54A 3PDFA 2PBHA 1VSNA 3KSEA 1DF0A 4KLBA 1KXRA 2PNSA 2J7QC 1PXVA 3H8CA 3W31A 1ICFA 1YT7A 1QOLA 1NPZA 4PP2E 3H89A 3IFUA 4N79A 1GMYA 1VJVA 3P5VA 2XU1A 1KFXL 3WXEA 3DF0A 4QRGA 4ZTBA 1Y08A 5JH3A 1TU6A 3BY4A 1F2CA 5FPWA 3PW3A 4IUMA 4FK5A 2DC9A 2AYOA 4MI7A 2DCBA 2G8JA 4QBBA 1U9WA 3D6SA 3E1ZB 1UKFA 3BC3A 3LFYA 3AI8A 4RNAA 4YYWA 4YYRA 2B1NA 3CBJA 4DMYA 4CDFB 4YYQA 3BOWA 1ZIVA 4W4UA 1TLOA 3HHIA 4QH6A 3QJ3A 2R9CA 4BOUA 1U9VA 4CDEB 4Q8HA 1NB3A 5JZEA 3MJ5A 2OZ2A 2E00A 4MZOA 3PRPA 9PAPA 4D8BA 4I07A 3MTVA 1JQPA 4DMXA 3O65A 4BS6A 2AS8A 2NQDB 2DCDA 3IEJA 4OVZB 1CQDA 5EZSA 2E01A 2O6XA 3TRKA 1TL9A 2AUXA 3HHAA 1QDQA 2GFOA 4MZSA 1EF7A 2JQFR 4R3DA 5PADA 4BSQA 2OP3A 2DC8A 2B1MA 4YV8A 1ME3A 2FRAA 1PPDA 3IUTA 2G8EA 4YYVA 2AUZA 2F7DA 3H8BA 1CB5A 3K8UA 1U9XA 2FRQA 3S3RA 3PRMA 1GCBA 3IMAA 1KHQA 3P5UA 1BY8A 1EWLA 3C9EA 4WA6A 3RVVA 2HWKA 4OELA 4M0WA 1EWMA 3S3QA 4W5CA 1ITOA 1CV8A 3F5VA 3OISA 3OVXA 3CH2X 4BQVA 4X6HA 3KWZA 4CDCB 4MSXA 5F02A 3P5XA 1EWOA 2FO5A 2VHFA 2DCCA 4RY2A 2YJ9A 2C0YA 4W5BA 1SNKA 2JRIA 1YK8A 1STFE 3RVXA 1U9QX 4REZA 3OVZA 3PHUA 2NQGA 4OVZA 2XU4A 3U8EA 1ATKA 2YJ2A 2BU3A 3TMPA 3KWBX 2GHUA 2JQGR 3BPMA 3KX1A 4P6EA 1MS6A 2E02A 4HWYA 3I3TA 2XU3A 2FUDA 2R6NA 1PPPA 1CTEA 3IV2A 2P86A 1DKIA 2DCAA 3N3GA 4PI3A 2BDLA 2DZZA 2FQ9A 5A24A 1FH0A 3BWKA 2FT2A 5J94A 2G7YA 5EZQA 4RKXA 2J7QA 1AU4A 1PVJA 4BPVA 4BOQA 1PADA 5CVNB 3V6EA 1AYWA 2CIOA 1CS8A 2PADA 2DZYA 2R9NA 1IWDA 2FYEA 3RVWA 5K16A 3PBHA 4GUAA 5KO3A 1F2BA 2FTDA 3P5WA 5CHVA 1BGOA 3OF9A 3KW9A 3MP2A 2P0RA 8PCHA 4BS5A 3BBAA 1GECE 1S4VA 4BOPA 3GCBA 1PPOA 3MHHA 3WXFA 4OEMA 1PIPA 3IHPA 4XZXA 5E6JA 3QT4A 4N8WA 3N3KA 4P16A 3H6SA 2DJGB 4OW0A 1MDWA 3BPFA 4D8EA 4AXMA
chains in the Genus database with same CATH topology
2CB5A 1O0EA 2WBFX 3CH3X 2R9OA 1ME4A 1CJLA 2IPPB 2HXZA 1POPA 1ZCMA 3O1GA 2HH5A 4N4ZA 2HHNA 4I04A 4PADA 1AU2A 3HWNA 1AYUA 1BP4A 1GX3A 2YJBA 1MEMA 1Q6KA 2DC7A 2F1GA 3ERVA 1SP4B 2ATOA 3MORA 2AYNA 3M99A 3MTNA 1PPNA 2H7JA 1THEA 1YK7A 3V6CA 3KKUA 5CVOB 3K24A 2XU5A 4NV7A 1GLOA 1X9YA 4BGFA 1U5IA 2E03A 5CVMA 1F2AA 1QMYA 3F75A 3LXSA 1AIMA 3BCNA 4ZUXU 2Y6EA 3KFQA 3USVA 4XR7A 1HUCB 1PE6A 2VHSA 2IBIA 2VFBA 3D9WA 1K3BB 3K9MA 1AYVA 2YJCA 3HD3A 3TNXA 4YYUA 2NQIA 5CHTA 2PREA 3I06A 4CDDB 2Y5BA 1CVZA 1QXPA 4YYSA 5EF4A 1MIRA 4FJCA 4Q8GA 2OULA 1M6DA 7PCKA 3NHEA 4YVAA 2DJFB 3QSDA 2DC6A 1A6RA 3ZUAA 1BQIA 2ACTA 4AXLA 2BSZA 3B79A 4CZWA 5JA7A 1KFUL 1NLJA 2ARYA 1DEUA 4X6IA 4X6JA 1CSBB 2P7UA 2G6DA 4PP1A 2VFCA 3PNRA 5EGWA 2AU1A 4K7CA 1MEGA 3N4CA 4I05A 1NQCA 4XUIA 1PCIA 4QRXA 2HD5A 4FIPA 3MHSA 2NQAA 2YJ8A 1AECA 1YVBA 3WXGA 1MHWA 1CPJA 1NL6A 4P6GA 3OF8A 4QRVA 1KHPA 3CBKA 1YALA 1PBHA 2AVWA 1EWPA 2BDZA 2AIMA 1F29A 2R9FA 6PADA 1XKGA 2R9MA 1NB5A 3O0UA 1AU0A 1AU3A 3H7DA 3IOQA 1Y4HA 4G54A 3PDFA 2PBHA 1VSNA 3KSEA 1DF0A 4KLBA 1KXRA 2PNSA 1PXVA 3H8CA 1ICFA 1YT7A 1QOLA 1NPZA 4PP2E 3H89A 4N79A 1GMYA 1VJVA 3P5VA 2XU1A 1KFXL 3WXEA 3DF0A 4QRGA 1Y08A 5JH3A 1TU6A 1F2CA 5FPWA 3PW3A 4FK5A 2DC9A 2AYOA 2DCBA 2G8JA 4QBBA 1U9WA 3D6SA 3E1ZB 3BC3A 3LFYA 3AI8A 4YYWA 4YYRA 2B1NA 3CBJA 4DMYA 4CDFB 4YYQA 3BOWA 1ZIVA 4W4UA 1TLOA 3HHIA 4QH6A 3QJ3A 2R9CA 4B55A 1U9VA 4CDEB 4Q8HA 1NB3A 2OZ2A 2E00A 4MZOA 9PAPA 4I07A 3LTWA 1JQPA 4DMXA 4BS6A 2AS8A 2NQDB 2DCDA 3IEJA 4NV8A 1CQDA 1W6FA 2E01A 2O6XA 1TL9A 2AUXA 3HHAA 1QDQA 2GFOA 4MZSA 1EF7A 2JQFR 5PADA 4BSQA 2OP3A 2DC8A 2B1MA 4YV8A 1ME3A 2FRAA 1PPDA 3IUTA 2G8EA 1W4TA 4YYVA 2AUZA 2F7DA 3H8BA 1CB5A 3K8UA 1U9XA 2FRQA 3S3RA 1GCBA 3IMAA 1KHQA 3P5UA 1BY8A 1EWLA 3C9EA 4WA6A 3RVVA 4OELA 1EWMA 3S3QA 4W5CA 1ITOA 4GUZA 1CV8A 3F5VA 3OISA 3OVXA 3CH2X 4BQVA 4X6HA 3KWZA 4CDCB 4MSXA 5F02A 3P5XA 1EWOA 2FO5A 2VHFA 2DCCA 4RY2A 2YJ9A 2C0YA 4W5BA 4C5PA 1SNKA 1YK8A 1STFE 3RVXA 1U9QX 3OVZA 2NQGA 2XU4A 3U8EA 1ATKA 2YJ2A 3KWBX 2GHUA 2JQGR 3BPMA 3KX1A 4P6EA 1MS6A 2E02A 4HWYA 3I3TA 2XU3A 2FUDA 2R6NA 1PPPA 1CTEA 3IV2A 2P86A 3N3GA 2DCAA 4PI3A 5A24A 2BDLA 2DZZA 2FQ9A 1FH0A 3BWKA 2FT2A 5J94A 2G7YA 1E2TA 1AU4A 4BPVA 1PADA 5CVNB 3V6EA 1AYWA 2CIOA 1CS8A 2PADA 2DZYA 2R9NA 1IWDA 2FYEA 3RVWA 5K16A 3PBHA 1F2BA 2FTDA 3P5WA 5CHVA 1BGOA 3OF9A 1W5RA 3KW9A 2P0RA 8PCHA 4BS5A 1GECE 1S4VA 3GCBA 1PPOA 3MHHA 3WXFA 4OEMA 1PIPA 3IHPA 3QT4A 4N8WA 3N3KA 3H6SA 2DJGB 1MDWA 3BPFA 4AXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CB5 A;  1O0E A;  2WBF X;  3CH3 X;  2R9O A;  1ME4 A;  1CJL A;  2IPP B;  2HXZ A;  1POP A;  1ZCM A;  3O1G A;  2HH5 A;  4N4Z A;  2HHN A;  4I04 A;  4PAD A;  1AU2 A;  3HWN A;  1AYU A;  1BP4 A;  2YJB A;  1MEM A;  1Q6K A;  2DC7 A;  2F1G A;  3ERV A;  1SP4 B;  2ATO A;  3MOR A;  2AYN A;  3M99 A;  3MTN A;  1PPN A;  2H7J A;  1THE A;  1YK7 A;  3V6C A;  3KKU A;  5CVO B;  3K24 A;  2XU5 A;  1GLO A;  1X9Y A;  1U5I A;  2E03 A;  5CVM A;  1F2A A;  1QMY A;  3F75 A;  3LXS A;  1AIM A;  3BCN A;  4ZUX U;  2Y6E A;  3KFQ A;  3USV A;  4XR7 A;  1HUC B;  1PE6 A;  2VHS A;  2IBI A;  1K3B B;  3K9M A;  1AYV A;  2YJC A;  3HD3 A;  3TNX A;  4YYU A;  2NQI A;  5CHT A;  2PRE A;  3I06 A;  4CDD B;  2Y5B A;  1CVZ A;  1QXP A;  4YYS A;  5EF4 A;  1MIR A;  4FJC A;  4Q8G A;  2OUL A;  1M6D A;  7PCK A;  3NHE A;  4YVA A;  2DJF B;  3QSD A;  2DC6 A;  1A6R A;  3ZUA A;  1BQI A;  2ACT A;  4AXL A;  3B79 A;  4CZW A;  5JA7 A;  1KFU L;  1NLJ A;  2ARY A;  1DEU A;  4X6I A;  4X6J A;  1CSB B;  2P7U A;  2G6D A;  4PP1 A;  3PNR A;  5EGW A;  2AU1 A;  4K7C A;  1MEG A;  3N4C A;  4I05 A;  1NQC A;  4XUI A;  1PCI A;  4QRX A;  2HD5 A;  4FIP A;  3MHS A;  2NQA A;  2YJ8 A;  1AEC A;  1YVB A;  3WXG A;  1MHW A;  1CPJ A;  1NL6 A;  4P6G A;  3OF8 A;  4QRV A;  1KHP A;  3CBK A;  1YAL A;  1PBH A;  2AVW A;  1EWP A;  2BDZ A;  2AIM A;  1F29 A;  2R9F A;  6PAD A;  1XKG A;  2R9M A;  1NB5 A;  3O0U A;  1AU0 A;  1AU3 A;  3H7D A;  3IOQ A;  1Y4H A;  4G54 A;  3PDF A;  2PBH A;  1VSN A;  3KSE A;  1DF0 A;  4KLB A;  1KXR A;  2PNS A;  1PXV A;  3H8C A;  1ICF A;  1YT7 A;  1QOL A;  1NPZ A;  4PP2 E;  3H89 A;  4N79 A;  1GMY A;  1VJV A;  3P5V A;  2XU1 A;  1KFX L;  3WXE A;  3DF0 A;  4QRG A;  1Y08 A;  5JH3 A;  1TU6 A;  1F2C A;  5FPW A;  3PW3 A;  4FK5 A;  2DC9 A;  2AYO A;  2DCB A;  2G8J A;  4QBB A;  1U9W A;  3D6S A;  3E1Z B;  3BC3 A;  3LFY A;  3AI8 A;  4YYW A;  4YYR A;  2B1N A;  3CBJ A;  4DMY A;  4CDF B;  4YYQ A;  3BOW A;  1ZIV A;  4W4U A;  1TLO A;  3HHI A;  4QH6 A;  3QJ3 A;  2R9C A;  1U9V A;  4CDE B;  4Q8H A;  1NB3 A;  2OZ2 A;  2E00 A;  4MZO A;  9PAP A;  4I07 A;  1JQP A;  4DMX A;  4BS6 A;  2AS8 A;  2NQD B;  2DCD A;  3IEJ A;  1CQD A;  2E01 A;  2O6X A;  1TL9 A;  2AUX A;  3HHA A;  1QDQ A;  2GFO A;  4MZS A;  1EF7 A;  2JQF R;  5PAD A;  4BSQ A;  2OP3 A;  2DC8 A;  2B1M A;  4YV8 A;  1ME3 A;  2FRA A;  1PPD A;  3IUT A;  2G8E A;  4YYV A;  2AUZ A;  2F7D A;  3H8B A;  1CB5 A;  3K8U A;  1U9X A;  2FRQ A;  3S3R A;  1GCB A;  3IMA A;  1KHQ A;  3P5U A;  1BY8 A;  1EWL A;  3C9E A;  4WA6 A;  3RVV A;  4OEL A;  1EWM A;  3S3Q A;  4W5C A;  1ITO A;  1CV8 A;  3F5V A;  3OIS A;  3OVX A;  3CH2 X;  4BQV A;  4X6H A;  3KWZ A;  4CDC B;  4MSX A;  5F02 A;  3P5X A;  1EWO A;  2FO5 A;  2VHF A;  2DCC A;  4RY2 A;  2YJ9 A;  2C0Y A;  4W5B A;  1SNK A;  1YK8 A;  1STF E;  3RVX A;  1U9Q X;  3OVZ A;  2NQG A;  2XU4 A;  3U8E A;  1ATK A;  2YJ2 A;  3KWB X;  2GHU A;  2JQG R;  3BPM A;  3KX1 A;  4P6E A;  1MS6 A;  2E02 A;  4HWY A;  3I3T A;  2XU3 A;  2FUD A;  2R6N A;  1PPP A;  1CTE A;  3IV2 A;  2P86 A;  3N3G A;  2DCA A;  4PI3 A;  5A24 A;  2BDL A;  2DZZ A;  2FQ9 A;  1FH0 A;  3BWK A;  2FT2 A;  5J94 A;  2G7Y A;  1AU4 A;  4BPV A;  1PAD A;  5CVN B;  3V6E A;  1AYW A;  2CIO A;  1CS8 A;  2PAD A;  2DZY A;  2R9N A;  1IWD A;  2FYE A;  3RVW A;  5K16 A;  3PBH A;  1F2B A;  2FTD A;  3P5W A;  5CHV A;  1BGO A;  3OF9 A;  3KW9 A;  2P0R A;  8PCH A;  4BS5 A;  1GEC E;  1S4V A;  3GCB A;  1PPO A;  3MHH A;  3WXF A;  4OEM A;  1PIP A;  3IHP A;  3QT4 A;  4N8W A;  3N3K A;  3H6S A;  2DJG B;  1MDW A;  3BPF A;  4AXM A; 
#chains in the Genus database with same CATH topology
 2CB5 A;  1O0E A;  2WBF X;  2BTW B;  3ZNH A;  3CH3 X;  2R9O A;  1ME4 A;  1CJL A;  2IPP B;  2HXZ A;  1POP A;  1ZCM A;  3O1G A;  2HH5 A;  4N4Z A;  2HHN A;  4I04 A;  4PAD A;  1AU2 A;  3HWN A;  3B21 A;  1AYU A;  1BP4 A;  2YJB A;  1MEM A;  3OQC A;  1Q6K A;  2DC7 A;  2F1G A;  3ERV A;  1SP4 B;  2ATO A;  3MOR A;  1YZB A;  2AYN A;  3M99 A;  3MTN A;  4RF0 A;  1PPN A;  2H7J A;  1THE A;  1YK7 A;  2JTC A;  3V6C A;  3KKU A;  5CVO B;  3K24 A;  2XU5 A;  1GLO A;  1X9Y A;  1U5I A;  4HXD B;  2E03 A;  5CVM A;  1F2A A;  1QMY A;  3F75 A;  3LXS A;  1AIM A;  3BCN A;  4ZUX U;  2Y6E A;  3KFQ A;  2Z84 A;  3USV A;  2UZJ A;  4XR7 A;  1HUC B;  1PE6 A;  2VHS A;  2IBI A;  1K3B B;  3K9M A;  1AYV A;  2YJC A;  3HD3 A;  3TNX A;  4YYU A;  2NQI A;  5CHT A;  2PRE A;  3I06 A;  4CDD B;  2Y5B A;  1CVZ A;  4IP3 A;  1QXP A;  4YYS A;  4PT5 A;  4D8I A;  5EF4 A;  1MIR A;  4FJC A;  4Q8G A;  2OUL A;  1M6D A;  7PCK A;  4MM3 B;  3NHE A;  4YVA A;  2DJF B;  3PHW A;  3QSD A;  2DC6 A;  1A6R A;  3ZUA A;  1BQI A;  2ACT A;  2BTW A;  4AXL A;  3B79 A;  4CZW A;  5JA7 A;  1KFU L;  3RNV A;  1NLJ A;  3C0R A;  2ARY A;  1DEU A;  4X6I A;  4X6J A;  4A5U A;  1CSB B;  2P7U A;  2G6D A;  4PP1 A;  3PNR A;  5EGW A;  2AU1 A;  4K7C A;  1MEG A;  3N4C A;  4I05 A;  1NQC A;  4XUI A;  1PCI A;  4QRX A;  2HD5 A;  3W30 A;  4WUR A;  4FIP A;  3MHS A;  2NQA A;  2YJ8 A;  3PHX A;  1AEC A;  1YVB A;  3WXG A;  1MHW A;  4RF1 A;  1CPJ A;  3E9S A;  1NL6 A;  4P6G A;  3OF8 A;  4QRV A;  2FE8 A;  1KHP A;  3CBK A;  1YAL A;  1PBH A;  2AVW A;  1EWP A;  2BDZ A;  2DOS A;  2AIM A;  1F29 A;  4BOS A;  2AGA A;  3BB7 A;  2R9F A;  6PAD A;  1XKG A;  4BOZ A;  2R9M A;  3PT2 A;  1NB5 A;  3PSE A;  3O0U A;  1AU0 A;  1AU3 A;  3H7D A;  3IOQ A;  1Y4H A;  4G54 A;  3PDF A;  2PBH A;  1VSN A;  3KSE A;  1DF0 A;  4KLB A;  1KXR A;  2PNS A;  2J7Q C;  1PXV A;  3H8C A;  3W31 A;  1ICF A;  1YT7 A;  1QOL A;  1NPZ A;  4PP2 E;  3H89 A;  3IFU A;  4N79 A;  1GMY A;  1VJV A;  3P5V A;  2XU1 A;  1KFX L;  3WXE A;  3DF0 A;  4QRG A;  4ZTB A;  1Y08 A;  5JH3 A;  1TU6 A;  3BY4 A;  1F2C A;  5FPW A;  3PW3 A;  4IUM A;  4FK5 A;  2DC9 A;  2AYO A;  4MI7 A;  2DCB A;  2G8J A;  4QBB A;  1U9W A;  3D6S A;  3E1Z B;  1UKF A;  3BC3 A;  3LFY A;  3AI8 A;  4RNA A;  4YYW A;  4YYR A;  2B1N A;  3CBJ A;  4DMY A;  4CDF B;  4YYQ A;  3BOW A;  1ZIV A;  4W4U A;  1TLO A;  3HHI A;  4QH6 A;  3QJ3 A;  2R9C A;  4BOU A;  1U9V A;  4CDE B;  4Q8H A;  1NB3 A;  5JZE A;  3MJ5 A;  2OZ2 A;  2E00 A;  4MZO A;  3PRP A;  9PAP A;  4D8B A;  4I07 A;  3MTV A;  1JQP A;  4DMX A;  3O65 A;  4BS6 A;  2AS8 A;  2NQD B;  2DCD A;  3IEJ A;  4OVZ B;  1CQD A;  5EZS A;  2E01 A;  2O6X A;  3TRK A;  1TL9 A;  2AUX A;  3HHA A;  1QDQ A;  2GFO A;  4MZS A;  1EF7 A;  2JQF R;  4R3D A;  5PAD A;  4BSQ A;  2OP3 A;  2DC8 A;  2B1M A;  4YV8 A;  1ME3 A;  2FRA A;  1PPD A;  3IUT A;  2G8E A;  4YYV A;  2AUZ A;  2F7D A;  3H8B A;  1CB5 A;  3K8U A;  1U9X A;  2FRQ A;  3S3R A;  3PRM A;  1GCB A;  3IMA A;  1KHQ A;  3P5U A;  1BY8 A;  1EWL A;  3C9E A;  4WA6 A;  3RVV A;  2HWK A;  4OEL A;  4M0W A;  1EWM A;  3S3Q A;  4W5C A;  1ITO A;  1CV8 A;  3F5V A;  3OIS A;  3OVX A;  3CH2 X;  4BQV A;  4X6H A;  3KWZ A;  4CDC B;  4MSX A;  5F02 A;  3P5X A;  1EWO A;  2FO5 A;  2VHF A;  2DCC A;  4RY2 A;  2YJ9 A;  2C0Y A;  4W5B A;  1SNK A;  2JRI A;  1YK8 A;  1STF E;  3RVX A;  1U9Q X;  4REZ A;  3OVZ A;  3PHU A;  2NQG A;  4OVZ A;  2XU4 A;  3U8E A;  1ATK A;  2YJ2 A;  2BU3 A;  3TMP A;  3KWB X;  2GHU A;  2JQG R;  3BPM A;  3KX1 A;  4P6E A;  1MS6 A;  2E02 A;  4HWY A;  3I3T A;  2XU3 A;  2FUD A;  2R6N A;  1PPP A;  1CTE A;  3IV2 A;  2P86 A;  1DKI A;  2DCA A;  3N3G A;  4PI3 A;  2BDL A;  2DZZ A;  2FQ9 A;  5A24 A;  1FH0 A;  3BWK A;  2FT2 A;  5J94 A;  2G7Y A;  5EZQ A;  4RKX A;  2J7Q A;  1AU4 A;  1PVJ A;  4BPV A;  4BOQ A;  1PAD A;  5CVN B;  3V6E A;  1AYW A;  2CIO A;  1CS8 A;  2PAD A;  2DZY A;  2R9N A;  1IWD A;  2FYE A;  3RVW A;  5K16 A;  3PBH A;  4GUA A;  5KO3 A;  1F2B A;  2FTD A;  3P5W A;  5CHV A;  1BGO A;  3OF9 A;  3KW9 A;  3MP2 A;  2P0R A;  8PCH A;  4BS5 A;  3BBA A;  1GEC E;  1S4V A;  4BOP A;  3GCB A;  1PPO A;  3MHH A;  3WXF A;  4OEM A;  1PIP A;  3IHP A;  4XZX A;  5E6J A;  3QT4 A;  4N8W A;  3N3K A;  4P16 A;  3H6S A;  2DJG B;  4OW0 A;  1MDW A;  3BPF A;  4D8E A;  4AXM A; 
#chains in the Genus database with same CATH homology
 2CB5 A;  1O0E A;  2WBF X;  3CH3 X;  2R9O A;  1ME4 A;  1CJL A;  2IPP B;  2HXZ A;  1POP A;  1ZCM A;  3O1G A;  2HH5 A;  4N4Z A;  2HHN A;  4I04 A;  4PAD A;  1AU2 A;  3HWN A;  1AYU A;  1BP4 A;  1GX3 A;  2YJB A;  1MEM A;  1Q6K A;  2DC7 A;  2F1G A;  3ERV A;  1SP4 B;  2ATO A;  3MOR A;  2AYN A;  3M99 A;  3MTN A;  1PPN A;  2H7J A;  1THE A;  1YK7 A;  3V6C A;  3KKU A;  5CVO B;  3K24 A;  2XU5 A;  4NV7 A;  1GLO A;  1X9Y A;  4BGF A;  1U5I A;  2E03 A;  5CVM A;  1F2A A;  1QMY A;  3F75 A;  3LXS A;  1AIM A;  3BCN A;  4ZUX U;  2Y6E A;  3KFQ A;  3USV A;  4XR7 A;  1HUC B;  1PE6 A;  2VHS A;  2IBI A;  2VFB A;  3D9W A;  1K3B B;  3K9M A;  1AYV A;  2YJC A;  3HD3 A;  3TNX A;  4YYU A;  2NQI A;  5CHT A;  2PRE A;  3I06 A;  4CDD B;  2Y5B A;  1CVZ A;  1QXP A;  4YYS A;  5EF4 A;  1MIR A;  4FJC A;  4Q8G A;  2OUL A;  1M6D A;  7PCK A;  3NHE A;  4YVA A;  2DJF B;  3QSD A;  2DC6 A;  1A6R A;  3ZUA A;  1BQI A;  2ACT A;  4AXL A;  2BSZ A;  3B79 A;  4CZW A;  5JA7 A;  1KFU L;  1NLJ A;  2ARY A;  1DEU A;  4X6I A;  4X6J A;  1CSB B;  2P7U A;  2G6D A;  4PP1 A;  2VFC A;  3PNR A;  5EGW A;  2AU1 A;  4K7C A;  1MEG A;  3N4C A;  4I05 A;  1NQC A;  4XUI A;  1PCI A;  4QRX A;  2HD5 A;  4FIP A;  3MHS A;  2NQA A;  2YJ8 A;  1AEC A;  1YVB A;  3WXG A;  1MHW A;  1CPJ A;  1NL6 A;  4P6G A;  3OF8 A;  4QRV A;  1KHP A;  3CBK A;  1YAL A;  1PBH A;  2AVW A;  1EWP A;  2BDZ A;  2AIM A;  1F29 A;  2R9F A;  6PAD A;  1XKG A;  2R9M A;  1NB5 A;  3O0U A;  1AU0 A;  1AU3 A;  3H7D A;  3IOQ A;  1Y4H A;  4G54 A;  3PDF A;  2PBH A;  1VSN A;  3KSE A;  1DF0 A;  4KLB A;  1KXR A;  2PNS A;  1PXV A;  3H8C A;  1ICF A;  1YT7 A;  1QOL A;  1NPZ A;  4PP2 E;  3H89 A;  4N79 A;  1GMY A;  1VJV A;  3P5V A;  2XU1 A;  1KFX L;  3WXE A;  3DF0 A;  4QRG A;  1Y08 A;  5JH3 A;  1TU6 A;  1F2C A;  5FPW A;  3PW3 A;  4FK5 A;  2DC9 A;  2AYO A;  2DCB A;  2G8J A;  4QBB A;  1U9W A;  3D6S A;  3E1Z B;  3BC3 A;  3LFY A;  3AI8 A;  4YYW A;  4YYR A;  2B1N A;  3CBJ A;  4DMY A;  4CDF B;  4YYQ A;  3BOW A;  1ZIV A;  4W4U A;  1TLO A;  3HHI A;  4QH6 A;  3QJ3 A;  2R9C A;  4B55 A;  1U9V A;  4CDE B;  4Q8H A;  1NB3 A;  2OZ2 A;  2E00 A;  4MZO A;  9PAP A;  4I07 A;  3LTW A;  1JQP A;  4DMX A;  4BS6 A;  2AS8 A;  2NQD B;  2DCD A;  3IEJ A;  4NV8 A;  1CQD A;  1W6F A;  2E01 A;  2O6X A;  1TL9 A;  2AUX A;  3HHA A;  1QDQ A;  2GFO A;  4MZS A;  1EF7 A;  2JQF R;  5PAD A;  4BSQ A;  2OP3 A;  2DC8 A;  2B1M A;  4YV8 A;  1ME3 A;  2FRA A;  1PPD A;  3IUT A;  2G8E A;  1W4T A;  4YYV A;  2AUZ A;  2F7D A;  3H8B A;  1CB5 A;  3K8U A;  1U9X A;  2FRQ A;  3S3R A;  1GCB A;  3IMA A;  1KHQ A;  3P5U A;  1BY8 A;  1EWL A;  3C9E A;  4WA6 A;  3RVV A;  4OEL A;  1EWM A;  3S3Q A;  4W5C A;  1ITO A;  4GUZ A;  1CV8 A;  3F5V A;  3OIS A;  3OVX A;  3CH2 X;  4BQV A;  4X6H A;  3KWZ A;  4CDC B;  4MSX A;  5F02 A;  3P5X A;  1EWO A;  2FO5 A;  2VHF A;  2DCC A;  4RY2 A;  2YJ9 A;  2C0Y A;  4W5B A;  4C5P A;  1SNK A;  1YK8 A;  1STF E;  3RVX A;  1U9Q X;  3OVZ A;  2NQG A;  2XU4 A;  3U8E A;  1ATK A;  2YJ2 A;  3KWB X;  2GHU A;  2JQG R;  3BPM A;  3KX1 A;  4P6E A;  1MS6 A;  2E02 A;  4HWY A;  3I3T A;  2XU3 A;  2FUD A;  2R6N A;  1PPP A;  1CTE A;  3IV2 A;  2P86 A;  3N3G A;  2DCA A;  4PI3 A;  5A24 A;  2BDL A;  2DZZ A;  2FQ9 A;  1FH0 A;  3BWK A;  2FT2 A;  5J94 A;  2G7Y A;  1E2T A;  1AU4 A;  4BPV A;  1PAD A;  5CVN B;  3V6E A;  1AYW A;  2CIO A;  1CS8 A;  2PAD A;  2DZY A;  2R9N A;  1IWD A;  2FYE A;  3RVW A;  5K16 A;  3PBH A;  1F2B A;  2FTD A;  3P5W A;  5CHV A;  1BGO A;  3OF9 A;  1W5R A;  3KW9 A;  2P0R A;  8PCH A;  4BS5 A;  1GEC E;  1S4V A;  3GCB A;  1PPO A;  3MHH A;  3WXF A;  4OEM A;  1PIP A;  3IHP A;  3QT4 A;  4N8W A;  3N3K A;  3H6S A;  2DJG B;  1MDW A;  3BPF A;  4AXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...