1BQIA

Use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites.
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1998-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bqiA00
4PI3A 4P6GA 5FPWA 3N3KA 3H6SA 2OP3A 1Q6KA 4PP2E 9PAPA 2AS8A 1F2AA 1QMYA 2CIOA 1PBHA 2B1MA 2PREA 3I06A 1A6RA 2C0YA 2ACTA 1YK8A 3WXFA 2O6XA 4I07A 2CB5A 3V6CA 2FO5A 1KHPA 5CVOB 1ME3A 4I05A 2WBFX 2FQ9A 1F2BA 5K16A 1VJVA 2PNSA 4QRGA 1PIPA 1U5IA 3I3TA 2B1NA 2PBHA 3N3GA 1S4VA 4N4ZA 4ZUXU 4X6IA 5CHVA 2YJ8A 1AU2A 4XUIA 5F02A 3S3RA 2HXZA 3QT4A 2XU1A 1YVBA 1HUCB 3OF9A 2YJBA 3KX1A 3LFYA 3MHSA 2ATOA 2VHFA 2DCCA 2AYNA 2GHUA 1AECA 1ME4A 2P86A 4MZOA 1PPDA 2FT2A 4YYSA 1CJLA 1GLOA 3B79A 2VHSA 1TLOA 3KWBX 4AXLA 3V6EA 1NB3A 1MIRA 3S3QA 1YK7A 4PADA 1U9WA 4BQVA 1CB5A 2Y6EA 3LXSA 3H8BA 3BPMA 5CVMA 1GMYA 4YV8A 1EF7A 2R6NA 1STFE 3MHHA 1POPA 1QXPA 4BSQA 2GFOA 3HHAA 4FIPA 1M6DA 7PCKA 1AU4A 3RVWA 3IMAA 2AIMA 2FRQA 2Y5BA 1SP4B 4K7CA 3RVXA 3PNRA 4HWYA 1ZCMA 5A24A 1AYWA 1CSBB 1KFXL 4FK5A 5J94A 4P6EA 1ATKA 3WXGA 1PPNA 5CHTA 2AU1A 1AU0A 1NPZA 2XU5A 2G6DA 3QSDA 1BQIA 1ZIVA 2AVWA 3OF8A 3WXEA 1IWDA 1PCIA 2JQFR 1U9VA 4QRVA 2DJFB 1GCBA 1SNKA 1MEGA 4Q8HA 2YJ2A 2NQAA 4YYRA 2AUXA 3BPFA 2AYOA 2NQGA 3HHIA 2R9NA 3QJ3A 4YVAA 2P0RA 3O0UA 4RY2A 1QDQA 5EF4A 1PE6A 1F29A 4BS6A 4BPVA 1ICFA 4XR7A 1BGOA 3O1GA 2FUDA 4FJCA 2OZ2A 2PADA 5JH3A 3USVA 1QOLA 3H8CA 3P5UA 4AXMA 1MS6A 1EWOA 1Y4HA 4DMXA 4CDDB 1O0EA 3HWNA 2E00A 1XKGA 5CVNB 4PP1A 3MTNA 1PXVA 2DCBA 8PCHA 1TL9A 4YYQA 3RVVA 3PDFA 3IUTA 2H7JA 4WA6A 1THEA 2G8JA 3K24A 4BS5A 2R9MA 1ITOA 2HH5A 4CDFB 2DC8A 1NL6A 2E01A 4CDCB 1AIMA 1MDWA 5PADA 1MEMA 1PPPA 3BCNA 2R9FA 1CV8A 4I04A 1YALA 1DF0A 3P5WA 5JA7A 3CBJA 4QH6A 4CDEB 3ERVA 1VSNA 2DCDA 2DCAA 3OVZA 2NQIA 3OISA 4YYVA 3D6SA 1NQCA 2G7YA 2R9OA 1NLJA 1K3BB 1PPOA 6PADA 3E1ZB 4W5CA 3BOWA 3KW9A 3IEJA 3BWKA 3C9EA 2DC6A 3H7DA 1AU3A 2HHNA 3DF0A 1DEUA 3H89A 2XU4A 1AYUA 3P5VA 1AYVA 3ZUAA 2F1GA 1PADA 1TU6A 1YT7A 2DZZA 3KFQA 4OELA 4KLBA 2BDZA 3CBKA 1CS8A 2YJCA 2FRAA 1U9XA 3BC3A 1EWLA 2DZYA 4N79A 1F2CA 2NQDB 1KXRA 4DMYA 4X6JA 4W5BA 3IV2A 3CH3X 1FH0A 4QRXA 3K9MA 2HD5A 3P5XA 4G54A 1KHQA 1CPJA 3AI8A 3MORA 3PBHA 1CVZA 2IPPB 3HD3A 2DJGB 3IHPA 2R9CA 3N4CA 2XU3A 4MSXA 4QBBA 2AUZA 3GCBA 4W4UA 3IOQA 3OVXA 1X9YA 2FTDA 3KWZA 2ARYA 4N8WA 4Q8GA 1EWMA 3K8UA 3M99A 2DC7A 4YYWA 4OEMA 2DC9A 3PW3A 1GECE 5EGWA 1CTEA 3KSEA 3F5VA 2F7DA 2YJ9A 2E03A 1MHWA 1U9QX 1KFUL 2IBIA 1JQPA 2FYEA 3KKUA 1NB5A 1Y08A 2P7UA 1CQDA 1EWPA 3NHEA 2BDLA 3F75A 2OULA 3CH2X 3TNXA 4CZWA 3U8EA 2E02A 1BP4A 4MZSA 4X6HA 2G8EA 4YYUA 1BY8A 2JQGR
chains in the Genus database with same CATH superfamily
4BOPA 4PI3A 4P6GA 5FPWA 3N3KA 3H6SA 2OP3A 4BOZA 1Q6KA 4PT5A 4PP2E 9PAPA 2AS8A 1F2AA 1QMYA 4OVZA 3PHXA 4RKXA 2CIOA 1PBHA 2B1MA 2PREA 3I06A 2JTCA 1A6RA 2C0YA 3BBAA 2ACTA 1YK8A 3WXFA 2O6XA 4I07A 2CB5A 4D8BA 3V6CA 2FO5A 1KHPA 5CVOB 1ME3A 4I05A 2WBFX 2FQ9A 2AGAA 1F2BA 5K16A 1VJVA 3MP2A 2PNSA 4QRGA 3C0RA 1PIPA 1U5IA 3I3TA 3RNVA 2B1NA 2PBHA 3N3GA 1S4VA 4N4ZA 4ZUXU 4X6IA 5CHVA 2YJ8A 1AU2A 4XUIA 5F02A 3S3RA 4BOUA 2HXZA 4OW0A 2XU1A 3QT4A 1YVBA 1HUCB 3OF9A 2YJBA 3KX1A 3LFYA 3MHSA 4IUMA 2ATOA 2VHFA 2DCCA 2AYNA 2GHUA 4MM3B 1AECA 4MI7A 1ME4A 2P86A 1PVJA 4MZOA 1PPDA 2FT2A 4YYSA 1CJLA 1GLOA 4M0WA 3B79A 2VHSA 1TLOA 4P16A 3KWBX 4AXLA 3PRMA 4D8IA 3V6EA 1NB3A 1MIRA 4BOSA 3S3QA 1YK7A 3PRPA 4IP3A 4PADA 1U9WA 4BQVA 1CB5A 2Y6EA 3LXSA 4REZA 3H8BA 3BPMA 2Z84A 5CVMA 1GMYA 4YV8A 5E6JA 1EF7A 2R6NA 1STFE 2DOSA 3MHHA 1POPA 3MJ5A 1QXPA 4BSQA 2GFOA 3HHAA 4FIPA 1M6DA 7PCKA 1AU4A 3RVWA 3IMAA 2AIMA 2FRQA 4RNAA 2Y5BA 1SP4B 4K7CA 3RVXA 3PNRA 3TMPA 5KO3A 4HWYA 1ZCMA 5A24A 1AYWA 3PT2A 1CSBB 1KFXL 4FK5A 3BY4A 5J94A 4P6EA 2J7QA 1ATKA 3WXGA 2UZJA 1PPNA 3E9SA 5CHTA 4RF1A 2AU1A 1AU0A 1DKIA 1NPZA 2XU5A 2G6DA 3QSDA 1BQIA 1ZIVA 2AVWA 3OF8A 3WXEA 1IWDA 1PCIA 2JQFR 1U9VA 4QRVA 2DJFB 1GCBA 1SNKA 1MEGA 4Q8HA 2YJ2A 2NQAA 4YYRA 2AUXA 3BPFA 2AYOA 2NQGA 3HHIA 2R9NA 3QJ3A 4YVAA 2P0RA 3O0UA 4RY2A 1QDQA 5EF4A 1PE6A 1F29A 4BS6A 4BPVA 1ICFA 4XR7A 1BGOA 3O1GA 2FUDA 4FJCA 2OZ2A 2PADA 5JH3A 2BU3A 3USVA 1QOLA 3H8CA 3P5UA 3TRKA 4AXMA 1MS6A 1EWOA 1Y4HA 4DMXA 4CDDB 1O0EA 3HWNA 2E00A 1XKGA 5CVNB 4ZTBA 4PP1A 3MTNA 1PXVA 3OQCA 5EZSA 2DCBA 8PCHA 1TL9A 4YYQA 3RVVA 3PDFA 3IUTA 2H7JA 4WA6A 1THEA 2G8JA 3K24A 4BS5A 2R9MA 1ITOA 2HH5A 3PHWA 4CDFB 2DC8A 1NL6A 2E01A 4CDCB 1AIMA 1MDWA 5PADA 1MEMA 1PPPA 3BCNA 5JZEA 2R9FA 1CV8A 4I04A 3W31A 1YALA 1DF0A 3P5WA 5JA7A 2FE8A 3CBJA 4QH6A 4CDEB 3ERVA 3B21A 1VSNA 4RF0A 2DCDA 2DCAA 3PSEA 2BTWB 3OVZA 2NQIA 3OISA 4YYVA 1YZBA 3D6SA 1NQCA 2G7YA 2R9OA 1NLJA 1K3BB 1PPOA 6PADA 3E1ZB 4W5CA 3BOWA 3KW9A 3IEJA 3BWKA 3C9EA 2DC6A 3H7DA 1AU3A 2HHNA 3W30A 3DF0A 1DEUA 4BOQA 3H89A 2XU4A 4XZXA 1AYUA 3P5VA 1AYVA 3ZUAA 2F1GA 1PADA 1TU6A 2HWKA 1YT7A 2DZZA 3KFQA 4OELA 4KLBA 2BDZA 3CBKA 1CS8A 2YJCA 5EZQA 2FRAA 1U9XA 3BC3A 4HXDB 1EWLA 3MTVA 2DZYA 4N79A 1F2CA 2NQDB 1KXRA 4DMYA 1UKFA 4X6JA 4W5BA 3IV2A 3CH3X 1FH0A 4QRXA 3K9MA 3ZNHA 2HD5A 3P5XA 4G54A 4OVZB 1KHQA 1CPJA 3BB7A 3AI8A 3MORA 3PBHA 1CVZA 2BTWA 2IPPB 3HD3A 2DJGB 3IHPA 2R9CA 3N4CA 2XU3A 4MSXA 4QBBA 2AUZA 3GCBA 4WURA 4W4UA 4R3DA 3IOQA 3OVXA 1X9YA 2FTDA 3KWZA 2ARYA 4N8WA 4Q8GA 1EWMA 3K8UA 3IFUA 3M99A 2DC7A 4YYWA 4OEMA 2DC9A 3PW3A 1GECE 5EGWA 1CTEA 4GUAA 4A5UA 3KSEA 3F5VA 2F7DA 2YJ9A 2E03A 1MHWA 1U9QX 1KFUL 2IBIA 4D8EA 1JQPA 2FYEA 3KKUA 1NB5A 1Y08A 2P7UA 1CQDA 1EWPA 3PHUA 3NHEA 2BDLA 3F75A 2J7QC 2OULA 3CH2X 3TNXA 3O65A 4CZWA 3U8EA 2E02A 1BP4A 4MZSA 4X6HA 2JRIA 2G8EA 4YYUA 1BY8A 2JQGR
chains in the Genus database with same CATH topology
4NV8A 4PI3A 4P6GA 5FPWA 3N3KA 3H6SA 2OP3A 1Q6KA 4PP2E 9PAPA 2AS8A 1F2AA 1QMYA 2CIOA 1PBHA 2B1MA 2PREA 3I06A 1A6RA 2C0YA 2ACTA 1YK8A 3WXFA 2O6XA 4I07A 2CB5A 3V6CA 2FO5A 1KHPA 5CVOB 1ME3A 4I05A 2WBFX 2FQ9A 1F2BA 5K16A 1VJVA 2PNSA 4QRGA 1PIPA 1U5IA 3I3TA 4C5PA 2B1NA 2PBHA 3N3GA 1S4VA 4N4ZA 1GX3A 4ZUXU 4X6IA 5CHVA 2YJ8A 1AU2A 4XUIA 5F02A 3S3RA 2HXZA 3QT4A 2XU1A 1YVBA 1HUCB 3OF9A 2YJBA 3KX1A 3LFYA 3MHSA 2ATOA 2VHFA 2DCCA 2AYNA 2GHUA 1AECA 1ME4A 2P86A 4MZOA 1PPDA 2FT2A 4YYSA 1CJLA 1GLOA 3B79A 2VHSA 1TLOA 3KWBX 4AXLA 1E2TA 3V6EA 1NB3A 1MIRA 3S3QA 1YK7A 4PADA 1U9WA 4BQVA 1CB5A 2Y6EA 3LXSA 3H8BA 3BPMA 5CVMA 1GMYA 4YV8A 1EF7A 2R6NA 1STFE 3MHHA 1POPA 1QXPA 4BSQA 1W5RA 2GFOA 3HHAA 4FIPA 1M6DA 2VFCA 1AU4A 7PCKA 3RVWA 3IMAA 2AIMA 2FRQA 3D9WA 2Y5BA 1SP4B 4K7CA 3RVXA 3PNRA 4HWYA 1ZCMA 5A24A 1AYWA 1CSBB 1KFXL 4FK5A 5J94A 4P6EA 1ATKA 3WXGA 4GUZA 1PPNA 5CHTA 2AU1A 1AU0A 1NPZA 2XU5A 2G6DA 3QSDA 1BQIA 1ZIVA 2AVWA 3OF8A 3WXEA 1IWDA 1PCIA 2JQFR 1U9VA 4QRVA 2DJFB 1GCBA 1SNKA 1W4TA 1MEGA 4Q8HA 2YJ2A 2NQAA 4YYRA 2AUXA 3BPFA 2AYOA 2NQGA 3HHIA 2R9NA 3QJ3A 4YVAA 2P0RA 3O0UA 4RY2A 1QDQA 5EF4A 1PE6A 1F29A 4BS6A 4BPVA 1ICFA 4XR7A 1BGOA 3O1GA 2FUDA 4FJCA 2OZ2A 2PADA 5JH3A 3USVA 1QOLA 3H8CA 3P5UA 4AXMA 1MS6A 1EWOA 1Y4HA 4DMXA 4CDDB 1O0EA 3HWNA 2E00A 1XKGA 5CVNB 4PP1A 3MTNA 1PXVA 2DCBA 8PCHA 1TL9A 4YYQA 3RVVA 3PDFA 3IUTA 2H7JA 4WA6A 1THEA 2G8JA 3K24A 4BS5A 2R9MA 1ITOA 2HH5A 4CDFB 2DC8A 1NL6A 2E01A 4CDCB 1AIMA 1MDWA 5PADA 1MEMA 1PPPA 3BCNA 2R9FA 1CV8A 4I04A 1YALA 1DF0A 3P5WA 5JA7A 3CBJA 4QH6A 4CDEB 3ERVA 1VSNA 2DCDA 2DCAA 4B55A 3OVZA 2NQIA 3OISA 4YYVA 3D6SA 1NQCA 2G7YA 2R9OA 1NLJA 1K3BB 1PPOA 6PADA 3E1ZB 4W5CA 3BOWA 3KW9A 3IEJA 3BWKA 3C9EA 2DC6A 2BSZA 3H7DA 1AU3A 3LTWA 2HHNA 3DF0A 1DEUA 3H89A 2XU4A 1AYUA 3P5VA 1AYVA 3ZUAA 2F1GA 1PADA 1TU6A 1YT7A 2DZZA 3KFQA 4OELA 4KLBA 2BDZA 3CBKA 1CS8A 2YJCA 2FRAA 1U9XA 3BC3A 4NV7A 1EWLA 2DZYA 4N79A 1F2CA 2NQDB 1KXRA 4DMYA 4X6JA 4W5BA 3IV2A 3CH3X 1FH0A 4QRXA 3K9MA 2HD5A 3P5XA 4G54A 1KHQA 1CPJA 3AI8A 3MORA 3PBHA 1CVZA 2IPPB 3HD3A 2DJGB 3IHPA 2R9CA 3N4CA 2XU3A 4MSXA 4QBBA 2AUZA 3GCBA 4W4UA 3IOQA 3OVXA 1X9YA 2FTDA 3KWZA 2ARYA 4N8WA 4Q8GA 1EWMA 3K8UA 3M99A 2DC7A 4YYWA 4OEMA 4BGFA 2VFBA 2DC9A 3PW3A 1GECE 5EGWA 1CTEA 3KSEA 3F5VA 2F7DA 1W6FA 2YJ9A 2E03A 1MHWA 1U9QX 1KFUL 2IBIA 1JQPA 2FYEA 3KKUA 1NB5A 1Y08A 2P7UA 1CQDA 1EWPA 3NHEA 2BDLA 3F75A 2OULA 3CH2X 3TNXA 4CZWA 3U8EA 2E02A 1BP4A 4MZSA 4X6HA 2G8EA 4YYUA 1BY8A 2JQGR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PI3 A;  4P6G A;  5FPW A;  3N3K A;  3H6S A;  2OP3 A;  1Q6K A;  4PP2 E;  9PAP A;  2AS8 A;  1F2A A;  1QMY A;  2CIO A;  1PBH A;  2B1M A;  2PRE A;  3I06 A;  1A6R A;  2C0Y A;  2ACT A;  1YK8 A;  3WXF A;  2O6X A;  4I07 A;  2CB5 A;  3V6C A;  2FO5 A;  1KHP A;  5CVO B;  1ME3 A;  4I05 A;  2WBF X;  2FQ9 A;  1F2B A;  5K16 A;  1VJV A;  2PNS A;  4QRG A;  1PIP A;  1U5I A;  3I3T A;  2B1N A;  2PBH A;  3N3G A;  1S4V A;  4N4Z A;  4ZUX U;  4X6I A;  5CHV A;  2YJ8 A;  1AU2 A;  4XUI A;  5F02 A;  3S3R A;  2HXZ A;  3QT4 A;  2XU1 A;  1YVB A;  1HUC B;  3OF9 A;  2YJB A;  3KX1 A;  3LFY A;  3MHS A;  2ATO A;  2VHF A;  2DCC A;  2AYN A;  2GHU A;  1AEC A;  1ME4 A;  2P86 A;  4MZO A;  1PPD A;  2FT2 A;  4YYS A;  1CJL A;  1GLO A;  3B79 A;  2VHS A;  1TLO A;  3KWB X;  4AXL A;  3V6E A;  1NB3 A;  1MIR A;  3S3Q A;  1YK7 A;  4PAD A;  1U9W A;  4BQV A;  1CB5 A;  2Y6E A;  3LXS A;  3H8B A;  3BPM A;  5CVM A;  1GMY A;  4YV8 A;  1EF7 A;  2R6N A;  1STF E;  3MHH A;  1POP A;  1QXP A;  4BSQ A;  2GFO A;  3HHA A;  4FIP A;  1M6D A;  7PCK A;  1AU4 A;  3RVW A;  3IMA A;  2AIM A;  2FRQ A;  2Y5B A;  1SP4 B;  4K7C A;  3RVX A;  3PNR A;  4HWY A;  1ZCM A;  5A24 A;  1AYW A;  1CSB B;  1KFX L;  4FK5 A;  5J94 A;  4P6E A;  1ATK A;  3WXG A;  1PPN A;  5CHT A;  2AU1 A;  1AU0 A;  1NPZ A;  2XU5 A;  2G6D A;  3QSD A;  1BQI A;  1ZIV A;  2AVW A;  3OF8 A;  3WXE A;  1IWD A;  1PCI A;  2JQF R;  1U9V A;  4QRV A;  2DJF B;  1GCB A;  1SNK A;  1MEG A;  4Q8H A;  2YJ2 A;  2NQA A;  4YYR A;  2AUX A;  3BPF A;  2AYO A;  2NQG A;  3HHI A;  2R9N A;  3QJ3 A;  4YVA A;  2P0R A;  3O0U A;  4RY2 A;  1QDQ A;  5EF4 A;  1PE6 A;  1F29 A;  4BS6 A;  4BPV A;  1ICF A;  4XR7 A;  1BGO A;  3O1G A;  2FUD A;  4FJC A;  2OZ2 A;  2PAD A;  5JH3 A;  3USV A;  1QOL A;  3H8C A;  3P5U A;  4AXM A;  1MS6 A;  1EWO A;  1Y4H A;  4DMX A;  4CDD B;  1O0E A;  3HWN A;  2E00 A;  1XKG A;  5CVN B;  4PP1 A;  3MTN A;  1PXV A;  2DCB A;  8PCH A;  1TL9 A;  4YYQ A;  3RVV A;  3PDF A;  3IUT A;  2H7J A;  4WA6 A;  1THE A;  2G8J A;  3K24 A;  4BS5 A;  2R9M A;  1ITO A;  2HH5 A;  4CDF B;  2DC8 A;  1NL6 A;  2E01 A;  4CDC B;  1AIM A;  1MDW A;  5PAD A;  1MEM A;  1PPP A;  3BCN A;  2R9F A;  1CV8 A;  4I04 A;  1YAL A;  1DF0 A;  3P5W A;  5JA7 A;  3CBJ A;  4QH6 A;  4CDE B;  3ERV A;  1VSN A;  2DCD A;  2DCA A;  3OVZ A;  2NQI A;  3OIS A;  4YYV A;  3D6S A;  1NQC A;  2G7Y A;  2R9O A;  1NLJ A;  1K3B B;  1PPO A;  6PAD A;  3E1Z B;  4W5C A;  3BOW A;  3KW9 A;  3IEJ A;  3BWK A;  3C9E A;  2DC6 A;  3H7D A;  1AU3 A;  2HHN A;  3DF0 A;  1DEU A;  3H89 A;  2XU4 A;  1AYU A;  3P5V A;  1AYV A;  3ZUA A;  2F1G A;  1PAD A;  1TU6 A;  1YT7 A;  2DZZ A;  3KFQ A;  4OEL A;  4KLB A;  2BDZ A;  3CBK A;  1CS8 A;  2YJC A;  2FRA A;  1U9X A;  3BC3 A;  1EWL A;  2DZY A;  4N79 A;  1F2C A;  2NQD B;  1KXR A;  4DMY A;  4X6J A;  4W5B A;  3IV2 A;  3CH3 X;  1FH0 A;  4QRX A;  3K9M A;  2HD5 A;  3P5X A;  4G54 A;  1KHQ A;  1CPJ A;  3AI8 A;  3MOR A;  3PBH A;  1CVZ A;  2IPP B;  3HD3 A;  2DJG B;  3IHP A;  2R9C A;  3N4C A;  2XU3 A;  4MSX A;  4QBB A;  2AUZ A;  3GCB A;  4W4U A;  3IOQ A;  3OVX A;  1X9Y A;  2FTD A;  3KWZ A;  2ARY A;  4N8W A;  4Q8G A;  1EWM A;  3K8U A;  3M99 A;  2DC7 A;  4YYW A;  4OEM A;  2DC9 A;  3PW3 A;  1GEC E;  5EGW A;  1CTE A;  3KSE A;  3F5V A;  2F7D A;  2YJ9 A;  2E03 A;  1MHW A;  1U9Q X;  1KFU L;  2IBI A;  1JQP A;  2FYE A;  3KKU A;  1NB5 A;  1Y08 A;  2P7U A;  1CQD A;  1EWP A;  3NHE A;  2BDL A;  3F75 A;  2OUL A;  3CH2 X;  3TNX A;  4CZW A;  3U8E A;  2E02 A;  1BP4 A;  4MZS A;  4X6H A;  2G8E A;  4YYU A;  1BY8 A;  2JQG R; 
#chains in the Genus database with same CATH topology
 4BOP A;  4PI3 A;  4P6G A;  5FPW A;  3N3K A;  3H6S A;  2OP3 A;  4BOZ A;  1Q6K A;  4PT5 A;  4PP2 E;  9PAP A;  2AS8 A;  1F2A A;  1QMY A;  4OVZ A;  3PHX A;  4RKX A;  2CIO A;  1PBH A;  2B1M A;  2PRE A;  3I06 A;  2JTC A;  1A6R A;  2C0Y A;  3BBA A;  2ACT A;  1YK8 A;  3WXF A;  2O6X A;  4I07 A;  2CB5 A;  4D8B A;  3V6C A;  2FO5 A;  1KHP A;  5CVO B;  1ME3 A;  4I05 A;  2WBF X;  2FQ9 A;  2AGA A;  1F2B A;  5K16 A;  1VJV A;  3MP2 A;  2PNS A;  4QRG A;  3C0R A;  1PIP A;  1U5I A;  3I3T A;  3RNV A;  2B1N A;  2PBH A;  3N3G A;  1S4V A;  4N4Z A;  4ZUX U;  4X6I A;  5CHV A;  2YJ8 A;  1AU2 A;  4XUI A;  5F02 A;  3S3R A;  4BOU A;  2HXZ A;  4OW0 A;  2XU1 A;  3QT4 A;  1YVB A;  1HUC B;  3OF9 A;  2YJB A;  3KX1 A;  3LFY A;  3MHS A;  4IUM A;  2ATO A;  2VHF A;  2DCC A;  2AYN A;  2GHU A;  4MM3 B;  1AEC A;  4MI7 A;  1ME4 A;  2P86 A;  1PVJ A;  4MZO A;  1PPD A;  2FT2 A;  4YYS A;  1CJL A;  1GLO A;  4M0W A;  3B79 A;  2VHS A;  1TLO A;  4P16 A;  3KWB X;  4AXL A;  3PRM A;  4D8I A;  3V6E A;  1NB3 A;  1MIR A;  4BOS A;  3S3Q A;  1YK7 A;  3PRP A;  4IP3 A;  4PAD A;  1U9W A;  4BQV A;  1CB5 A;  2Y6E A;  3LXS A;  4REZ A;  3H8B A;  3BPM A;  2Z84 A;  5CVM A;  1GMY A;  4YV8 A;  5E6J A;  1EF7 A;  2R6N A;  1STF E;  2DOS A;  3MHH A;  1POP A;  3MJ5 A;  1QXP A;  4BSQ A;  2GFO A;  3HHA A;  4FIP A;  1M6D A;  7PCK A;  1AU4 A;  3RVW A;  3IMA A;  2AIM A;  2FRQ A;  4RNA A;  2Y5B A;  1SP4 B;  4K7C A;  3RVX A;  3PNR A;  3TMP A;  5KO3 A;  4HWY A;  1ZCM A;  5A24 A;  1AYW A;  3PT2 A;  1CSB B;  1KFX L;  4FK5 A;  3BY4 A;  5J94 A;  4P6E A;  2J7Q A;  1ATK A;  3WXG A;  2UZJ A;  1PPN A;  3E9S A;  5CHT A;  4RF1 A;  2AU1 A;  1AU0 A;  1DKI A;  1NPZ A;  2XU5 A;  2G6D A;  3QSD A;  1BQI A;  1ZIV A;  2AVW A;  3OF8 A;  3WXE A;  1IWD A;  1PCI A;  2JQF R;  1U9V A;  4QRV A;  2DJF B;  1GCB A;  1SNK A;  1MEG A;  4Q8H A;  2YJ2 A;  2NQA A;  4YYR A;  2AUX A;  3BPF A;  2AYO A;  2NQG A;  3HHI A;  2R9N A;  3QJ3 A;  4YVA A;  2P0R A;  3O0U A;  4RY2 A;  1QDQ A;  5EF4 A;  1PE6 A;  1F29 A;  4BS6 A;  4BPV A;  1ICF A;  4XR7 A;  1BGO A;  3O1G A;  2FUD A;  4FJC A;  2OZ2 A;  2PAD A;  5JH3 A;  2BU3 A;  3USV A;  1QOL A;  3H8C A;  3P5U A;  3TRK A;  4AXM A;  1MS6 A;  1EWO A;  1Y4H A;  4DMX A;  4CDD B;  1O0E A;  3HWN A;  2E00 A;  1XKG A;  5CVN B;  4ZTB A;  4PP1 A;  3MTN A;  1PXV A;  3OQC A;  5EZS A;  2DCB A;  8PCH A;  1TL9 A;  4YYQ A;  3RVV A;  3PDF A;  3IUT A;  2H7J A;  4WA6 A;  1THE A;  2G8J A;  3K24 A;  4BS5 A;  2R9M A;  1ITO A;  2HH5 A;  3PHW A;  4CDF B;  2DC8 A;  1NL6 A;  2E01 A;  4CDC B;  1AIM A;  1MDW A;  5PAD A;  1MEM A;  1PPP A;  3BCN A;  5JZE A;  2R9F A;  1CV8 A;  4I04 A;  3W31 A;  1YAL A;  1DF0 A;  3P5W A;  5JA7 A;  2FE8 A;  3CBJ A;  4QH6 A;  4CDE B;  3ERV A;  3B21 A;  1VSN A;  4RF0 A;  2DCD A;  2DCA A;  3PSE A;  2BTW B;  3OVZ A;  2NQI A;  3OIS A;  4YYV A;  1YZB A;  3D6S A;  1NQC A;  2G7Y A;  2R9O A;  1NLJ A;  1K3B B;  1PPO A;  6PAD A;  3E1Z B;  4W5C A;  3BOW A;  3KW9 A;  3IEJ A;  3BWK A;  3C9E A;  2DC6 A;  3H7D A;  1AU3 A;  2HHN A;  3W30 A;  3DF0 A;  1DEU A;  4BOQ A;  3H89 A;  2XU4 A;  4XZX A;  1AYU A;  3P5V A;  1AYV A;  3ZUA A;  2F1G A;  1PAD A;  1TU6 A;  2HWK A;  1YT7 A;  2DZZ A;  3KFQ A;  4OEL A;  4KLB A;  2BDZ A;  3CBK A;  1CS8 A;  2YJC A;  5EZQ A;  2FRA A;  1U9X A;  3BC3 A;  4HXD B;  1EWL A;  3MTV A;  2DZY A;  4N79 A;  1F2C A;  2NQD B;  1KXR A;  4DMY A;  1UKF A;  4X6J A;  4W5B A;  3IV2 A;  3CH3 X;  1FH0 A;  4QRX A;  3K9M A;  3ZNH A;  2HD5 A;  3P5X A;  4G54 A;  4OVZ B;  1KHQ A;  1CPJ A;  3BB7 A;  3AI8 A;  3MOR A;  3PBH A;  1CVZ A;  2BTW A;  2IPP B;  3HD3 A;  2DJG B;  3IHP A;  2R9C A;  3N4C A;  2XU3 A;  4MSX A;  4QBB A;  2AUZ A;  3GCB A;  4WUR A;  4W4U A;  4R3D A;  3IOQ A;  3OVX A;  1X9Y A;  2FTD A;  3KWZ A;  2ARY A;  4N8W A;  4Q8G A;  1EWM A;  3K8U A;  3IFU A;  3M99 A;  2DC7 A;  4YYW A;  4OEM A;  2DC9 A;  3PW3 A;  1GEC E;  5EGW A;  1CTE A;  4GUA A;  4A5U A;  3KSE A;  3F5V A;  2F7D A;  2YJ9 A;  2E03 A;  1MHW A;  1U9Q X;  1KFU L;  2IBI A;  4D8E A;  1JQP A;  2FYE A;  3KKU A;  1NB5 A;  1Y08 A;  2P7U A;  1CQD A;  1EWP A;  3PHU A;  3NHE A;  2BDL A;  3F75 A;  2J7Q C;  2OUL A;  3CH2 X;  3TNX A;  3O65 A;  4CZW A;  3U8E A;  2E02 A;  1BP4 A;  4MZS A;  4X6H A;  2JRI A;  2G8E A;  4YYU A;  1BY8 A;  2JQG R; 
#chains in the Genus database with same CATH homology
 4NV8 A;  4PI3 A;  4P6G A;  5FPW A;  3N3K A;  3H6S A;  2OP3 A;  1Q6K A;  4PP2 E;  9PAP A;  2AS8 A;  1F2A A;  1QMY A;  2CIO A;  1PBH A;  2B1M A;  2PRE A;  3I06 A;  1A6R A;  2C0Y A;  2ACT A;  1YK8 A;  3WXF A;  2O6X A;  4I07 A;  2CB5 A;  3V6C A;  2FO5 A;  1KHP A;  5CVO B;  1ME3 A;  4I05 A;  2WBF X;  2FQ9 A;  1F2B A;  5K16 A;  1VJV A;  2PNS A;  4QRG A;  1PIP A;  1U5I A;  3I3T A;  4C5P A;  2B1N A;  2PBH A;  3N3G A;  1S4V A;  4N4Z A;  1GX3 A;  4ZUX U;  4X6I A;  5CHV A;  2YJ8 A;  1AU2 A;  4XUI A;  5F02 A;  3S3R A;  2HXZ A;  3QT4 A;  2XU1 A;  1YVB A;  1HUC B;  3OF9 A;  2YJB A;  3KX1 A;  3LFY A;  3MHS A;  2ATO A;  2VHF A;  2DCC A;  2AYN A;  2GHU A;  1AEC A;  1ME4 A;  2P86 A;  4MZO A;  1PPD A;  2FT2 A;  4YYS A;  1CJL A;  1GLO A;  3B79 A;  2VHS A;  1TLO A;  3KWB X;  4AXL A;  1E2T A;  3V6E A;  1NB3 A;  1MIR A;  3S3Q A;  1YK7 A;  4PAD A;  1U9W A;  4BQV A;  1CB5 A;  2Y6E A;  3LXS A;  3H8B A;  3BPM A;  5CVM A;  1GMY A;  4YV8 A;  1EF7 A;  2R6N A;  1STF E;  3MHH A;  1POP A;  1QXP A;  4BSQ A;  1W5R A;  2GFO A;  3HHA A;  4FIP A;  1M6D A;  2VFC A;  1AU4 A;  7PCK A;  3RVW A;  3IMA A;  2AIM A;  2FRQ A;  3D9W A;  2Y5B A;  1SP4 B;  4K7C A;  3RVX A;  3PNR A;  4HWY A;  1ZCM A;  5A24 A;  1AYW A;  1CSB B;  1KFX L;  4FK5 A;  5J94 A;  4P6E A;  1ATK A;  3WXG A;  4GUZ A;  1PPN A;  5CHT A;  2AU1 A;  1AU0 A;  1NPZ A;  2XU5 A;  2G6D A;  3QSD A;  1BQI A;  1ZIV A;  2AVW A;  3OF8 A;  3WXE A;  1IWD A;  1PCI A;  2JQF R;  1U9V A;  4QRV A;  2DJF B;  1GCB A;  1SNK A;  1W4T A;  1MEG A;  4Q8H A;  2YJ2 A;  2NQA A;  4YYR A;  2AUX A;  3BPF A;  2AYO A;  2NQG A;  3HHI A;  2R9N A;  3QJ3 A;  4YVA A;  2P0R A;  3O0U A;  4RY2 A;  1QDQ A;  5EF4 A;  1PE6 A;  1F29 A;  4BS6 A;  4BPV A;  1ICF A;  4XR7 A;  1BGO A;  3O1G A;  2FUD A;  4FJC A;  2OZ2 A;  2PAD A;  5JH3 A;  3USV A;  1QOL A;  3H8C A;  3P5U A;  4AXM A;  1MS6 A;  1EWO A;  1Y4H A;  4DMX A;  4CDD B;  1O0E A;  3HWN A;  2E00 A;  1XKG A;  5CVN B;  4PP1 A;  3MTN A;  1PXV A;  2DCB A;  8PCH A;  1TL9 A;  4YYQ A;  3RVV A;  3PDF A;  3IUT A;  2H7J A;  4WA6 A;  1THE A;  2G8J A;  3K24 A;  4BS5 A;  2R9M A;  1ITO A;  2HH5 A;  4CDF B;  2DC8 A;  1NL6 A;  2E01 A;  4CDC B;  1AIM A;  1MDW A;  5PAD A;  1MEM A;  1PPP A;  3BCN A;  2R9F A;  1CV8 A;  4I04 A;  1YAL A;  1DF0 A;  3P5W A;  5JA7 A;  3CBJ A;  4QH6 A;  4CDE B;  3ERV A;  1VSN A;  2DCD A;  2DCA A;  4B55 A;  3OVZ A;  2NQI A;  3OIS A;  4YYV A;  3D6S A;  1NQC A;  2G7Y A;  2R9O A;  1NLJ A;  1K3B B;  1PPO A;  6PAD A;  3E1Z B;  4W5C A;  3BOW A;  3KW9 A;  3IEJ A;  3BWK A;  3C9E A;  2DC6 A;  2BSZ A;  3H7D A;  1AU3 A;  3LTW A;  2HHN A;  3DF0 A;  1DEU A;  3H89 A;  2XU4 A;  1AYU A;  3P5V A;  1AYV A;  3ZUA A;  2F1G A;  1PAD A;  1TU6 A;  1YT7 A;  2DZZ A;  3KFQ A;  4OEL A;  4KLB A;  2BDZ A;  3CBK A;  1CS8 A;  2YJC A;  2FRA A;  1U9X A;  3BC3 A;  4NV7 A;  1EWL A;  2DZY A;  4N79 A;  1F2C A;  2NQD B;  1KXR A;  4DMY A;  4X6J A;  4W5B A;  3IV2 A;  3CH3 X;  1FH0 A;  4QRX A;  3K9M A;  2HD5 A;  3P5X A;  4G54 A;  1KHQ A;  1CPJ A;  3AI8 A;  3MOR A;  3PBH A;  1CVZ A;  2IPP B;  3HD3 A;  2DJG B;  3IHP A;  2R9C A;  3N4C A;  2XU3 A;  4MSX A;  4QBB A;  2AUZ A;  3GCB A;  4W4U A;  3IOQ A;  3OVX A;  1X9Y A;  2FTD A;  3KWZ A;  2ARY A;  4N8W A;  4Q8G A;  1EWM A;  3K8U A;  3M99 A;  2DC7 A;  4YYW A;  4OEM A;  4BGF A;  2VFB A;  2DC9 A;  3PW3 A;  1GEC E;  5EGW A;  1CTE A;  3KSE A;  3F5V A;  2F7D A;  1W6F A;  2YJ9 A;  2E03 A;  1MHW A;  1U9Q X;  1KFU L;  2IBI A;  1JQP A;  2FYE A;  3KKU A;  1NB5 A;  1Y08 A;  2P7U A;  1CQD A;  1EWP A;  3NHE A;  2BDL A;  3F75 A;  2OUL A;  3CH2 X;  3TNX A;  4CZW A;  3U8E A;  2E02 A;  1BP4 A;  4MZS A;  4X6H A;  2G8E A;  4YYU A;  1BY8 A;  2JQG R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...