1BQIA

Use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites.
pubmed doi rcsb
molecule keywords PAPAIN
molecule tags Hydrolase
total genus 62
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1998-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bqiA00
3KKUA 4BS5A 4P6GA 1CB5A 1Y4HA 2P0RA 3N3KA 2P7UA 1CJLA 3D6SA 4ZUXU 1F2BA 3USVA 2O6XA 2FYEA 2JQFR 2VHFA 3CBKA 1AU3A 4OEMA 2FO5A 4QRVA 4N4ZA 1BQIA 3PBHA 3HHIA 3S3RA 1ZCMA 1CSBB 3C9EA 1CV8A 3LXSA 2DC9A 3MHHA 3WXFA 1AU0A 4CDDB 5CHVA 1M6DA 2OULA 3H6SA 4OELA 5PADA 2GFOA 1NB3A 4YV8A 1QOLA 1PE6A 3AI8A 4HWYA 1EWPA 4N8WA 1AIMA 3E1ZB 2NQAA 4G54A 2PBHA 5CVNB 5F02A 5A24A 4DMXA 4DMYA 1O0EA 4AXMA 1ICFA 2AVWA 4MZOA 1CPJA 2DZZA 1GLOA 2P86A 1MEGA 2YJ2A 1JQPA 2F1GA 2WBFX 3S3QA 3P5WA 2AU1A 3N4CA 1PXVA 2HHNA 3KWZA 1AU2A 6PADA 2E02A 1ATKA 4XUIA 3O0UA 3P5UA 3WXGA 1NL6A 2IBIA 4CZWA 4CDCB 2PNSA 3N3GA 4N79A 4K7CA 5JA7A 3WXEA 2NQIA 1QDQA 2Y6EA 3BPFA 4W5BA 3BCNA 1DF0A 1NLJA 3IMAA 1QMYA 3B79A 3H8CA 5FPWA 2JQGR 1STFE 2XU4A 3IHPA 3RVVA 1GMYA 1ITOA 3H8BA 5JH3A 8PCHA 1PADA 2AUXA 2BDLA 2XU3A 1U9VA 1PPOA 4MSXA 2XU1A 3QJ3A 2E03A 1F2CA 3P5VA 3RVXA 2XU5A 4BQVA 2HD5A 1EF7A 4KLBA 1IWDA 3TNXA 4YYWA 1BGOA 1SP4B 3BOWA 1AYUA 3QSDA 2FRAA 1AYVA 4YYRA 1YALA 1MHWA 3KW9A 2PADA 1THEA 3BPMA 4X6JA 2NQDB 3MHSA 1BY8A 4QRXA 2DCAA 3KFQA 3GCBA 2FQ9A 1AU4A 2AS8A 5CVOB 1AECA 1YK8A 2B1MA 3I06A 3ERVA 4QBBA 1CQDA 2YJCA 2FTDA 4Q8GA 1GCBA 4QH6A 1QXPA 4I07A 4BS6A 1CTEA 5CHTA 3OF8A 3OF9A 3O1GA 3OVXA 2AYNA 3HD3A 2DCCA 4QRGA 2R9CA 3IOQA 3K8UA 1ME4A 2DZYA 3ZUAA 1MS6A 1A6RA 2IPPB 1AYWA 1K3BB 2ARYA 2OP3A 2CIOA 3F5VA 1VJVA 1DEUA 3H89A 3CH2X 4PADA 5J94A 4MZSA 2FUDA 3I3TA 1S4VA 2H7JA 3OVZA 3KX1A 3V6EA 1MEMA 3F75A 1KHPA 1VSNA 4CDEB 2G7YA 1CS8A 1TU6A 2GHUA 1U9XA 2VHSA 1YVBA 2PREA 2FT2A 2DC6A 1XKGA 4YYVA 1PIPA 4XR7A 3IV2A 2R9OA 4FJCA 4FK5A 4WA6A 2E01A 2G8JA 1NQCA 1EWMA 2HXZA 7PCKA 3BC3A 1PBHA 1KHQA 1CVZA 3RVWA 4CDFB 3V6CA 2NQGA 2YJ8A 3DF0A 3HWNA 9PAPA 1PPNA 2FRQA 1POPA 1NB5A 4PP1A 3KWBX 5EGWA 2E00A 4PP2E 2G8EA 2B1NA 2DC8A 2Y5BA 3K9MA 4PI3A 4YVAA 1F2AA 2DJGB 5CVMA 3OISA 1Q6KA 4FIPA 2YJ9A 3PNRA 2BDZA 3MTNA 3IEJA 5K16A 2DCBA 1PPPA 4W4UA 1FH0A 4AXLA 1EWOA 3H7DA 1BP4A 4RY2A 3NHEA 1PCIA 2R9MA 1EWLA 2AYOA 1U9QX 4I04A 3P5XA 1KFXL 1TL9A 2R9FA 2AIMA 1X9YA 3KSEA 3CBJA 1KXRA 4W5CA 3IUTA 1KFUL 2R9NA 4P6EA 2ACTA 4YYUA 2YJBA 2DCDA 1PPDA 2CB5A 2ATOA 3MORA 1ME3A 1F29A 3HHAA 4Q8HA 3LFYA 3PW3A 1SNKA 3QT4A 1U9WA 3BWKA 5EF4A 1MIRA 2DC7A 4X6IA 2R6NA 4I05A 1ZIVA 4BPVA 4BSQA 2AUZA 1YK7A 3U8EA 4YYSA 2F7DA 1Y08A 1U5IA 4YYQA 2G6DA 2HH5A 1YT7A 2DJFB 4X6HA 3M99A 1MDWA 3CH3X 2C0YA 1GECE 1NPZA 3K24A 1HUCB 3PDFA 2OZ2A 1TLOA
chains in the Genus database with same CATH superfamily
3KKUA 4BS5A 5KO3A 4P6GA 1CB5A 1Y4HA 2P0RA 3N3KA 3BY4A 2P7UA 4OVZA 1CJLA 3D6SA 4ZUXU 1F2BA 5JZEA 3USVA 2J7QA 2O6XA 2FYEA 2JQFR 2VHFA 3CBKA 1AU3A 3PSEA 4OEMA 2FO5A 4QRVA 4N4ZA 1BQIA 3PBHA 3HHIA 3S3RA 1ZCMA 1CSBB 3C9EA 1CV8A 3LXSA 2DC9A 3PRPA 3MHHA 3WXFA 1AU0A 4CDDB 5CHVA 1M6DA 1YZBA 2OULA 3H6SA 4OELA 2HWKA 2GFOA 5PADA 1NB3A 4YV8A 1QOLA 1PE6A 3AI8A 4BOUA 4HWYA 1EWPA 4N8WA 1AIMA 3E1ZB 2NQAA 4G54A 2PBHA 5CVNB 5F02A 5A24A 4DMXA 4DMYA 1O0EA 2UZJA 4D8EA 4AXMA 3PRMA 1ICFA 2AVWA 4MZOA 1CPJA 2DZZA 4IP3A 1GLOA 2P86A 1MEGA 2YJ2A 1JQPA 2F1GA 2WBFX 3S3QA 3P5WA 2AU1A 3N4CA 1PXVA 2HHNA 3E9SA 3KWZA 1AU2A 3W31A 6PADA 4PT5A 2E02A 1ATKA 4XUIA 3O0UA 3P5UA 3WXGA 1NL6A 2IBIA 4CZWA 4CDCB 2PNSA 3N3GA 4HXDB 4N79A 4K7CA 5E6JA 5JA7A 4RF1A 3WXEA 2NQIA 3TRKA 1QDQA 2Y6EA 3BPFA 4W5BA 3BCNA 1DF0A 1NLJA 3IMAA 2J7QC 1QMYA 3B79A 3H8CA 5FPWA 2JQGR 1STFE 2XU4A 3IHPA 3RVVA 1GMYA 1ITOA 3H8BA 5JH3A 4ZTBA 8PCHA 1PADA 2AUXA 2BDLA 2XU3A 1U9VA 4RNAA 1PPOA 4MSXA 2BTWA 2XU1A 4A5UA 3QJ3A 2E03A 1F2CA 3P5VA 3RVXA 2XU5A 4BQVA 2HD5A 1EF7A 4KLBA 1IWDA 3TNXA 4YYWA 1BGOA 1SP4B 1UKFA 4XZXA 3BOWA 1AYUA 3QSDA 2FRAA 1AYVA 4YYRA 1YALA 4OW0A 1MHWA 3KW9A 2PADA 1THEA 3BPMA 4X6JA 4BOZA 2NQDB 3MHSA 1BY8A 4QRXA 2DCAA 3KFQA 3GCBA 2FQ9A 1AU4A 2AS8A 5CVOB 1AECA 1YK8A 2B1MA 3I06A 1PVJA 3ERVA 4QBBA 1CQDA 2YJCA 2FTDA 4Q8GA 1GCBA 4QH6A 3TMPA 1QXPA 3MP2A 4I07A 4BS6A 1CTEA 5CHTA 3OF8A 3OF9A 3O1GA 3OVXA 2AYNA 3HD3A 2DCCA 4QRGA 2R9CA 3IOQA 3K8UA 1ME4A 2DZYA 3ZUAA 1MS6A 1A6RA 2IPPB 1AYWA 1K3BB 2ARYA 2OP3A 2CIOA 3F5VA 1VJVA 1DEUA 3H89A 3CH2X 3C0RA 4PADA 3W30A 5J94A 4MZSA 4M0WA 2FUDA 4REZA 4MI7A 3I3TA 1S4VA 2H7JA 3OVZA 3KX1A 5EZSA 3V6EA 1MEMA 3F75A 1KHPA 1VSNA 4CDEB 2G7YA 1CS8A 1TU6A 2GHUA 1U9XA 2VHSA 4D8IA 1YVBA 2PREA 2FT2A 4OVZB 2DC6A 1XKGA 4YYVA 1PIPA 4XR7A 3BB7A 4WURA 3IV2A 2R9OA 4FJCA 4FK5A 4WA6A 2E01A 2G8JA 1NQCA 1EWMA 2HXZA 7PCKA 3BC3A 1PBHA 1KHQA 1CVZA 3RVWA 4CDFB 3V6CA 2NQGA 2YJ8A 3PT2A 3ZNHA 3DF0A 3HWNA 9PAPA 1PPNA 4IUMA 4D8BA 2FRQA 1POPA 1NB5A 4PP1A 3KWBX 5EGWA 1DKIA 2AGAA 2E00A 4RF0A 4PP2E 2G8EA 2JTCA 2B1NA 2DC8A 2Y5BA 4RKXA 4MM3B 3K9MA 3MJ5A 4PI3A 3B21A 4YVAA 1F2AA 2DJGB 5CVMA 3OISA 3MTVA 3O65A 1Q6KA 4FIPA 2YJ9A 4R3DA 3PNRA 2BDZA 3MTNA 3OQCA 4GUAA 3IEJA 5K16A 2DCBA 1PPPA 4W4UA 1FH0A 4AXLA 1EWOA 3H7DA 1BP4A 4RY2A 3PHXA 3NHEA 1PCIA 2R9MA 1EWLA 2AYOA 1U9QX 3BBAA 4I04A 3P5XA 1KFXL 1TL9A 2R9FA 2AIMA 1X9YA 2JRIA 3KSEA 3CBJA 1KXRA 4W5CA 3IUTA 3PHUA 2Z84A 1KFUL 2R9NA 4P6EA 2ACTA 4BOSA 4YYUA 2YJBA 2DCDA 1PPDA 2CB5A 2ATOA 3MORA 1ME3A 1F29A 3HHAA 4Q8HA 3PHWA 3LFYA 3PW3A 1SNKA 3QT4A 1U9WA 3BWKA 5EF4A 4P16A 1MIRA 2DC7A 2FE8A 5EZQA 3RNVA 4X6IA 2R6NA 4I05A 1ZIVA 4BPVA 4BSQA 2AUZA 1YK7A 2DOSA 3U8EA 3IFUA 4YYSA 4BOPA 2F7DA 1Y08A 1U5IA 2BTWB 4YYQA 2G6DA 2HH5A 1YT7A 2DJFB 4X6HA 3M99A 2BU3A 1MDWA 3CH3X 2C0YA 1GECE 1NPZA 3K24A 1HUCB 4BOQA 3PDFA 2OZ2A 1TLOA
chains in the Genus database with same CATH topology
3KKUA 4BS5A 4P6GA 1CB5A 1Y4HA 2P0RA 3N3KA 2P7UA 1CJLA 3D6SA 4ZUXU 1F2BA 3USVA 2O6XA 2FYEA 2JQFR 2VHFA 3CBKA 1AU3A 4OEMA 2FO5A 4QRVA 4N4ZA 1BQIA 3PBHA 3HHIA 3S3RA 1ZCMA 1CSBB 3C9EA 1CV8A 3LXSA 2DC9A 3MHHA 3WXFA 1AU0A 4CDDB 5CHVA 1M6DA 2OULA 3H6SA 4OELA 5PADA 2GFOA 1NB3A 4YV8A 1QOLA 4NV8A 1PE6A 3AI8A 4HWYA 1EWPA 4N8WA 1AIMA 3E1ZB 2NQAA 4G54A 2PBHA 5CVNB 5F02A 5A24A 4DMXA 4DMYA 1O0EA 4AXMA 1ICFA 2AVWA 4MZOA 1CPJA 2DZZA 1GLOA 2P86A 1MEGA 2YJ2A 1JQPA 2F1GA 2WBFX 3S3QA 3P5WA 2AU1A 3N4CA 1PXVA 2HHNA 3KWZA 1AU2A 6PADA 2E02A 1ATKA 1W6FA 4XUIA 3O0UA 3P5UA 3WXGA 1NL6A 2IBIA 4CZWA 4GUZA 4CDCB 2PNSA 3N3GA 4N79A 4K7CA 5JA7A 3WXEA 2NQIA 1QDQA 2Y6EA 3BPFA 4W5BA 3BCNA 1DF0A 1NLJA 3IMAA 1QMYA 3B79A 3H8CA 5FPWA 2JQGR 1STFE 2XU4A 3IHPA 3RVVA 1GMYA 1ITOA 3H8BA 5JH3A 8PCHA 1PADA 2AUXA 1GX3A 2BDLA 2XU3A 1U9VA 1PPOA 4MSXA 2XU1A 3QJ3A 2E03A 1F2CA 3P5VA 3RVXA 2BSZA 2XU5A 4BQVA 2HD5A 1EF7A 4KLBA 1W5RA 1IWDA 3TNXA 4YYWA 1BGOA 1SP4B 3BOWA 1AYUA 3QSDA 2FRAA 1AYVA 4YYRA 1YALA 1MHWA 1E2TA 3KW9A 2PADA 1THEA 3BPMA 4X6JA 2NQDB 3MHSA 1BY8A 4QRXA 2DCAA 4B55A 3KFQA 3GCBA 2FQ9A 1AU4A 2AS8A 5CVOB 1AECA 1YK8A 2B1MA 3I06A 3ERVA 4QBBA 4C5PA 1CQDA 2YJCA 2FTDA 4Q8GA 1GCBA 4QH6A 1QXPA 4I07A 4BS6A 1CTEA 5CHTA 3OF8A 3OF9A 3O1GA 3OVXA 2AYNA 3HD3A 2DCCA 4QRGA 2R9CA 3IOQA 3K8UA 1ME4A 2DZYA 3ZUAA 1MS6A 1A6RA 2IPPB 1AYWA 1K3BB 2ARYA 2OP3A 2CIOA 3F5VA 1VJVA 1DEUA 3H89A 3CH2X 4PADA 5J94A 4MZSA 2FUDA 3I3TA 1S4VA 2H7JA 3OVZA 3KX1A 3V6EA 1MEMA 3F75A 4BGFA 1KHPA 1VSNA 4CDEB 2G7YA 1CS8A 1TU6A 2GHUA 1U9XA 2VHSA 1YVBA 2PREA 2FT2A 2DC6A 1XKGA 4YYVA 1PIPA 4XR7A 3IV2A 2R9OA 4FJCA 4FK5A 4WA6A 2E01A 2G8JA 1NQCA 1EWMA 2HXZA 7PCKA 3BC3A 3D9WA 1PBHA 1KHQA 1CVZA 3RVWA 4CDFB 3V6CA 2NQGA 2YJ8A 3DF0A 3HWNA 9PAPA 1PPNA 2FRQA 1POPA 1NB5A 4PP1A 3KWBX 5EGWA 2E00A 4PP2E 2G8EA 2B1NA 2DC8A 2Y5BA 3K9MA 4PI3A 4YVAA 1F2AA 2DJGB 5CVMA 3OISA 1Q6KA 4FIPA 2YJ9A 3PNRA 2BDZA 3MTNA 3IEJA 5K16A 2DCBA 1PPPA 4W4UA 1FH0A 4AXLA 1EWOA 3H7DA 1BP4A 4RY2A 3NHEA 1PCIA 2R9MA 1EWLA 2AYOA 1U9QX 4I04A 3P5XA 1KFXL 1TL9A 2R9FA 2AIMA 1X9YA 3KSEA 3CBJA 1KXRA 4W5CA 3IUTA 1KFUL 2R9NA 4P6EA 2ACTA 4YYUA 2YJBA 2DCDA 1PPDA 2CB5A 4NV7A 2ATOA 3LTWA 3MORA 1ME3A 1F29A 3HHAA 2VFBA 4Q8HA 3LFYA 3PW3A 1SNKA 3QT4A 1U9WA 3BWKA 5EF4A 1MIRA 2DC7A 4X6IA 2R6NA 4I05A 1ZIVA 4BPVA 4BSQA 2AUZA 1YK7A 3U8EA 4YYSA 2F7DA 1Y08A 1U5IA 4YYQA 2G6DA 2HH5A 1YT7A 2DJFB 1W4TA 2VFCA 4X6HA 3M99A 1MDWA 3CH3X 2C0YA 1GECE 1NPZA 3K24A 1HUCB 3PDFA 2OZ2A 1TLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKU A;  4BS5 A;  4P6G A;  1CB5 A;  1Y4H A;  2P0R A;  3N3K A;  2P7U A;  1CJL A;  3D6S A;  4ZUX U;  1F2B A;  3USV A;  2O6X A;  2FYE A;  2JQF R;  2VHF A;  3CBK A;  1AU3 A;  4OEM A;  2FO5 A;  4QRV A;  4N4Z A;  1BQI A;  3PBH A;  3HHI A;  3S3R A;  1ZCM A;  1CSB B;  3C9E A;  1CV8 A;  3LXS A;  2DC9 A;  3MHH A;  3WXF A;  1AU0 A;  4CDD B;  5CHV A;  1M6D A;  2OUL A;  3H6S A;  4OEL A;  5PAD A;  2GFO A;  1NB3 A;  4YV8 A;  1QOL A;  1PE6 A;  3AI8 A;  4HWY A;  1EWP A;  4N8W A;  1AIM A;  3E1Z B;  2NQA A;  4G54 A;  2PBH A;  5CVN B;  5F02 A;  5A24 A;  4DMX A;  4DMY A;  1O0E A;  4AXM A;  1ICF A;  2AVW A;  4MZO A;  1CPJ A;  2DZZ A;  1GLO A;  2P86 A;  1MEG A;  2YJ2 A;  1JQP A;  2F1G A;  2WBF X;  3S3Q A;  3P5W A;  2AU1 A;  3N4C A;  1PXV A;  2HHN A;  3KWZ A;  1AU2 A;  6PAD A;  2E02 A;  1ATK A;  4XUI A;  3O0U A;  3P5U A;  3WXG A;  1NL6 A;  2IBI A;  4CZW A;  4CDC B;  2PNS A;  3N3G A;  4N79 A;  4K7C A;  5JA7 A;  3WXE A;  2NQI A;  1QDQ A;  2Y6E A;  3BPF A;  4W5B A;  3BCN A;  1DF0 A;  1NLJ A;  3IMA A;  1QMY A;  3B79 A;  3H8C A;  5FPW A;  2JQG R;  1STF E;  2XU4 A;  3IHP A;  3RVV A;  1GMY A;  1ITO A;  3H8B A;  5JH3 A;  8PCH A;  1PAD A;  2AUX A;  2BDL A;  2XU3 A;  1U9V A;  1PPO A;  4MSX A;  2XU1 A;  3QJ3 A;  2E03 A;  1F2C A;  3P5V A;  3RVX A;  2XU5 A;  4BQV A;  2HD5 A;  1EF7 A;  4KLB A;  1IWD A;  3TNX A;  4YYW A;  1BGO A;  1SP4 B;  3BOW A;  1AYU A;  3QSD A;  2FRA A;  1AYV A;  4YYR A;  1YAL A;  1MHW A;  3KW9 A;  2PAD A;  1THE A;  3BPM A;  4X6J A;  2NQD B;  3MHS A;  1BY8 A;  4QRX A;  2DCA A;  3KFQ A;  3GCB A;  2FQ9 A;  1AU4 A;  2AS8 A;  5CVO B;  1AEC A;  1YK8 A;  2B1M A;  3I06 A;  3ERV A;  4QBB A;  1CQD A;  2YJC A;  2FTD A;  4Q8G A;  1GCB A;  4QH6 A;  1QXP A;  4I07 A;  4BS6 A;  1CTE A;  5CHT A;  3OF8 A;  3OF9 A;  3O1G A;  3OVX A;  2AYN A;  3HD3 A;  2DCC A;  4QRG A;  2R9C A;  3IOQ A;  3K8U A;  1ME4 A;  2DZY A;  3ZUA A;  1MS6 A;  1A6R A;  2IPP B;  1AYW A;  1K3B B;  2ARY A;  2OP3 A;  2CIO A;  3F5V A;  1VJV A;  1DEU A;  3H89 A;  3CH2 X;  4PAD A;  5J94 A;  4MZS A;  2FUD A;  3I3T A;  1S4V A;  2H7J A;  3OVZ A;  3KX1 A;  3V6E A;  1MEM A;  3F75 A;  1KHP A;  1VSN A;  4CDE B;  2G7Y A;  1CS8 A;  1TU6 A;  2GHU A;  1U9X A;  2VHS A;  1YVB A;  2PRE A;  2FT2 A;  2DC6 A;  1XKG A;  4YYV A;  1PIP A;  4XR7 A;  3IV2 A;  2R9O A;  4FJC A;  4FK5 A;  4WA6 A;  2E01 A;  2G8J A;  1NQC A;  1EWM A;  2HXZ A;  7PCK A;  3BC3 A;  1PBH A;  1KHQ A;  1CVZ A;  3RVW A;  4CDF B;  3V6C A;  2NQG A;  2YJ8 A;  3DF0 A;  3HWN A;  9PAP A;  1PPN A;  2FRQ A;  1POP A;  1NB5 A;  4PP1 A;  3KWB X;  5EGW A;  2E00 A;  4PP2 E;  2G8E A;  2B1N A;  2DC8 A;  2Y5B A;  3K9M A;  4PI3 A;  4YVA A;  1F2A A;  2DJG B;  5CVM A;  3OIS A;  1Q6K A;  4FIP A;  2YJ9 A;  3PNR A;  2BDZ A;  3MTN A;  3IEJ A;  5K16 A;  2DCB A;  1PPP A;  4W4U A;  1FH0 A;  4AXL A;  1EWO A;  3H7D A;  1BP4 A;  4RY2 A;  3NHE A;  1PCI A;  2R9M A;  1EWL A;  2AYO A;  1U9Q X;  4I04 A;  3P5X A;  1KFX L;  1TL9 A;  2R9F A;  2AIM A;  1X9Y A;  3KSE A;  3CBJ A;  1KXR A;  4W5C A;  3IUT A;  1KFU L;  2R9N A;  4P6E A;  2ACT A;  4YYU A;  2YJB A;  2DCD A;  1PPD A;  2CB5 A;  2ATO A;  3MOR A;  1ME3 A;  1F29 A;  3HHA A;  4Q8H A;  3LFY A;  3PW3 A;  1SNK A;  3QT4 A;  1U9W A;  3BWK A;  5EF4 A;  1MIR A;  2DC7 A;  4X6I A;  2R6N A;  4I05 A;  1ZIV A;  4BPV A;  4BSQ A;  2AUZ A;  1YK7 A;  3U8E A;  4YYS A;  2F7D A;  1Y08 A;  1U5I A;  4YYQ A;  2G6D A;  2HH5 A;  1YT7 A;  2DJF B;  4X6H A;  3M99 A;  1MDW A;  3CH3 X;  2C0Y A;  1GEC E;  1NPZ A;  3K24 A;  1HUC B;  3PDF A;  2OZ2 A;  1TLO A; 
#chains in the Genus database with same CATH topology
 3KKU A;  4BS5 A;  5KO3 A;  4P6G A;  1CB5 A;  1Y4H A;  2P0R A;  3N3K A;  3BY4 A;  2P7U A;  4OVZ A;  1CJL A;  3D6S A;  4ZUX U;  1F2B A;  5JZE A;  3USV A;  2J7Q A;  2O6X A;  2FYE A;  2JQF R;  2VHF A;  3CBK A;  1AU3 A;  3PSE A;  4OEM A;  2FO5 A;  4QRV A;  4N4Z A;  1BQI A;  3PBH A;  3HHI A;  3S3R A;  1ZCM A;  1CSB B;  3C9E A;  1CV8 A;  3LXS A;  2DC9 A;  3PRP A;  3MHH A;  3WXF A;  1AU0 A;  4CDD B;  5CHV A;  1M6D A;  1YZB A;  2OUL A;  3H6S A;  4OEL A;  2HWK A;  2GFO A;  5PAD A;  1NB3 A;  4YV8 A;  1QOL A;  1PE6 A;  3AI8 A;  4BOU A;  4HWY A;  1EWP A;  4N8W A;  1AIM A;  3E1Z B;  2NQA A;  4G54 A;  2PBH A;  5CVN B;  5F02 A;  5A24 A;  4DMX A;  4DMY A;  1O0E A;  2UZJ A;  4D8E A;  4AXM A;  3PRM A;  1ICF A;  2AVW A;  4MZO A;  1CPJ A;  2DZZ A;  4IP3 A;  1GLO A;  2P86 A;  1MEG A;  2YJ2 A;  1JQP A;  2F1G A;  2WBF X;  3S3Q A;  3P5W A;  2AU1 A;  3N4C A;  1PXV A;  2HHN A;  3E9S A;  3KWZ A;  1AU2 A;  3W31 A;  6PAD A;  4PT5 A;  2E02 A;  1ATK A;  4XUI A;  3O0U A;  3P5U A;  3WXG A;  1NL6 A;  2IBI A;  4CZW A;  4CDC B;  2PNS A;  3N3G A;  4HXD B;  4N79 A;  4K7C A;  5E6J A;  5JA7 A;  4RF1 A;  3WXE A;  2NQI A;  3TRK A;  1QDQ A;  2Y6E A;  3BPF A;  4W5B A;  3BCN A;  1DF0 A;  1NLJ A;  3IMA A;  2J7Q C;  1QMY A;  3B79 A;  3H8C A;  5FPW A;  2JQG R;  1STF E;  2XU4 A;  3IHP A;  3RVV A;  1GMY A;  1ITO A;  3H8B A;  5JH3 A;  4ZTB A;  8PCH A;  1PAD A;  2AUX A;  2BDL A;  2XU3 A;  1U9V A;  4RNA A;  1PPO A;  4MSX A;  2BTW A;  2XU1 A;  4A5U A;  3QJ3 A;  2E03 A;  1F2C A;  3P5V A;  3RVX A;  2XU5 A;  4BQV A;  2HD5 A;  1EF7 A;  4KLB A;  1IWD A;  3TNX A;  4YYW A;  1BGO A;  1SP4 B;  1UKF A;  4XZX A;  3BOW A;  1AYU A;  3QSD A;  2FRA A;  1AYV A;  4YYR A;  1YAL A;  4OW0 A;  1MHW A;  3KW9 A;  2PAD A;  1THE A;  3BPM A;  4X6J A;  4BOZ A;  2NQD B;  3MHS A;  1BY8 A;  4QRX A;  2DCA A;  3KFQ A;  3GCB A;  2FQ9 A;  1AU4 A;  2AS8 A;  5CVO B;  1AEC A;  1YK8 A;  2B1M A;  3I06 A;  1PVJ A;  3ERV A;  4QBB A;  1CQD A;  2YJC A;  2FTD A;  4Q8G A;  1GCB A;  4QH6 A;  3TMP A;  1QXP A;  3MP2 A;  4I07 A;  4BS6 A;  1CTE A;  5CHT A;  3OF8 A;  3OF9 A;  3O1G A;  3OVX A;  2AYN A;  3HD3 A;  2DCC A;  4QRG A;  2R9C A;  3IOQ A;  3K8U A;  1ME4 A;  2DZY A;  3ZUA A;  1MS6 A;  1A6R A;  2IPP B;  1AYW A;  1K3B B;  2ARY A;  2OP3 A;  2CIO A;  3F5V A;  1VJV A;  1DEU A;  3H89 A;  3CH2 X;  3C0R A;  4PAD A;  3W30 A;  5J94 A;  4MZS A;  4M0W A;  2FUD A;  4REZ A;  4MI7 A;  3I3T A;  1S4V A;  2H7J A;  3OVZ A;  3KX1 A;  5EZS A;  3V6E A;  1MEM A;  3F75 A;  1KHP A;  1VSN A;  4CDE B;  2G7Y A;  1CS8 A;  1TU6 A;  2GHU A;  1U9X A;  2VHS A;  4D8I A;  1YVB A;  2PRE A;  2FT2 A;  4OVZ B;  2DC6 A;  1XKG A;  4YYV A;  1PIP A;  4XR7 A;  3BB7 A;  4WUR A;  3IV2 A;  2R9O A;  4FJC A;  4FK5 A;  4WA6 A;  2E01 A;  2G8J A;  1NQC A;  1EWM A;  2HXZ A;  7PCK A;  3BC3 A;  1PBH A;  1KHQ A;  1CVZ A;  3RVW A;  4CDF B;  3V6C A;  2NQG A;  2YJ8 A;  3PT2 A;  3ZNH A;  3DF0 A;  3HWN A;  9PAP A;  1PPN A;  4IUM A;  4D8B A;  2FRQ A;  1POP A;  1NB5 A;  4PP1 A;  3KWB X;  5EGW A;  1DKI A;  2AGA A;  2E00 A;  4RF0 A;  4PP2 E;  2G8E A;  2JTC A;  2B1N A;  2DC8 A;  2Y5B A;  4RKX A;  4MM3 B;  3K9M A;  3MJ5 A;  4PI3 A;  3B21 A;  4YVA A;  1F2A A;  2DJG B;  5CVM A;  3OIS A;  3MTV A;  3O65 A;  1Q6K A;  4FIP A;  2YJ9 A;  4R3D A;  3PNR A;  2BDZ A;  3MTN A;  3OQC A;  4GUA A;  3IEJ A;  5K16 A;  2DCB A;  1PPP A;  4W4U A;  1FH0 A;  4AXL A;  1EWO A;  3H7D A;  1BP4 A;  4RY2 A;  3PHX A;  3NHE A;  1PCI A;  2R9M A;  1EWL A;  2AYO A;  1U9Q X;  3BBA A;  4I04 A;  3P5X A;  1KFX L;  1TL9 A;  2R9F A;  2AIM A;  1X9Y A;  2JRI A;  3KSE A;  3CBJ A;  1KXR A;  4W5C A;  3IUT A;  3PHU A;  2Z84 A;  1KFU L;  2R9N A;  4P6E A;  2ACT A;  4BOS A;  4YYU A;  2YJB A;  2DCD A;  1PPD A;  2CB5 A;  2ATO A;  3MOR A;  1ME3 A;  1F29 A;  3HHA A;  4Q8H A;  3PHW A;  3LFY A;  3PW3 A;  1SNK A;  3QT4 A;  1U9W A;  3BWK A;  5EF4 A;  4P16 A;  1MIR A;  2DC7 A;  2FE8 A;  5EZQ A;  3RNV A;  4X6I A;  2R6N A;  4I05 A;  1ZIV A;  4BPV A;  4BSQ A;  2AUZ A;  1YK7 A;  2DOS A;  3U8E A;  3IFU A;  4YYS A;  4BOP A;  2F7D A;  1Y08 A;  1U5I A;  2BTW B;  4YYQ A;  2G6D A;  2HH5 A;  1YT7 A;  2DJF B;  4X6H A;  3M99 A;  2BU3 A;  1MDW A;  3CH3 X;  2C0Y A;  1GEC E;  1NPZ A;  3K24 A;  1HUC B;  4BOQ A;  3PDF A;  2OZ2 A;  1TLO A; 
#chains in the Genus database with same CATH homology
 3KKU A;  4BS5 A;  4P6G A;  1CB5 A;  1Y4H A;  2P0R A;  3N3K A;  2P7U A;  1CJL A;  3D6S A;  4ZUX U;  1F2B A;  3USV A;  2O6X A;  2FYE A;  2JQF R;  2VHF A;  3CBK A;  1AU3 A;  4OEM A;  2FO5 A;  4QRV A;  4N4Z A;  1BQI A;  3PBH A;  3HHI A;  3S3R A;  1ZCM A;  1CSB B;  3C9E A;  1CV8 A;  3LXS A;  2DC9 A;  3MHH A;  3WXF A;  1AU0 A;  4CDD B;  5CHV A;  1M6D A;  2OUL A;  3H6S A;  4OEL A;  5PAD A;  2GFO A;  1NB3 A;  4YV8 A;  1QOL A;  4NV8 A;  1PE6 A;  3AI8 A;  4HWY A;  1EWP A;  4N8W A;  1AIM A;  3E1Z B;  2NQA A;  4G54 A;  2PBH A;  5CVN B;  5F02 A;  5A24 A;  4DMX A;  4DMY A;  1O0E A;  4AXM A;  1ICF A;  2AVW A;  4MZO A;  1CPJ A;  2DZZ A;  1GLO A;  2P86 A;  1MEG A;  2YJ2 A;  1JQP A;  2F1G A;  2WBF X;  3S3Q A;  3P5W A;  2AU1 A;  3N4C A;  1PXV A;  2HHN A;  3KWZ A;  1AU2 A;  6PAD A;  2E02 A;  1ATK A;  1W6F A;  4XUI A;  3O0U A;  3P5U A;  3WXG A;  1NL6 A;  2IBI A;  4CZW A;  4GUZ A;  4CDC B;  2PNS A;  3N3G A;  4N79 A;  4K7C A;  5JA7 A;  3WXE A;  2NQI A;  1QDQ A;  2Y6E A;  3BPF A;  4W5B A;  3BCN A;  1DF0 A;  1NLJ A;  3IMA A;  1QMY A;  3B79 A;  3H8C A;  5FPW A;  2JQG R;  1STF E;  2XU4 A;  3IHP A;  3RVV A;  1GMY A;  1ITO A;  3H8B A;  5JH3 A;  8PCH A;  1PAD A;  2AUX A;  1GX3 A;  2BDL A;  2XU3 A;  1U9V A;  1PPO A;  4MSX A;  2XU1 A;  3QJ3 A;  2E03 A;  1F2C A;  3P5V A;  3RVX A;  2BSZ A;  2XU5 A;  4BQV A;  2HD5 A;  1EF7 A;  4KLB A;  1W5R A;  1IWD A;  3TNX A;  4YYW A;  1BGO A;  1SP4 B;  3BOW A;  1AYU A;  3QSD A;  2FRA A;  1AYV A;  4YYR A;  1YAL A;  1MHW A;  1E2T A;  3KW9 A;  2PAD A;  1THE A;  3BPM A;  4X6J A;  2NQD B;  3MHS A;  1BY8 A;  4QRX A;  2DCA A;  4B55 A;  3KFQ A;  3GCB A;  2FQ9 A;  1AU4 A;  2AS8 A;  5CVO B;  1AEC A;  1YK8 A;  2B1M A;  3I06 A;  3ERV A;  4QBB A;  4C5P A;  1CQD A;  2YJC A;  2FTD A;  4Q8G A;  1GCB A;  4QH6 A;  1QXP A;  4I07 A;  4BS6 A;  1CTE A;  5CHT A;  3OF8 A;  3OF9 A;  3O1G A;  3OVX A;  2AYN A;  3HD3 A;  2DCC A;  4QRG A;  2R9C A;  3IOQ A;  3K8U A;  1ME4 A;  2DZY A;  3ZUA A;  1MS6 A;  1A6R A;  2IPP B;  1AYW A;  1K3B B;  2ARY A;  2OP3 A;  2CIO A;  3F5V A;  1VJV A;  1DEU A;  3H89 A;  3CH2 X;  4PAD A;  5J94 A;  4MZS A;  2FUD A;  3I3T A;  1S4V A;  2H7J A;  3OVZ A;  3KX1 A;  3V6E A;  1MEM A;  3F75 A;  4BGF A;  1KHP A;  1VSN A;  4CDE B;  2G7Y A;  1CS8 A;  1TU6 A;  2GHU A;  1U9X A;  2VHS A;  1YVB A;  2PRE A;  2FT2 A;  2DC6 A;  1XKG A;  4YYV A;  1PIP A;  4XR7 A;  3IV2 A;  2R9O A;  4FJC A;  4FK5 A;  4WA6 A;  2E01 A;  2G8J A;  1NQC A;  1EWM A;  2HXZ A;  7PCK A;  3BC3 A;  3D9W A;  1PBH A;  1KHQ A;  1CVZ A;  3RVW A;  4CDF B;  3V6C A;  2NQG A;  2YJ8 A;  3DF0 A;  3HWN A;  9PAP A;  1PPN A;  2FRQ A;  1POP A;  1NB5 A;  4PP1 A;  3KWB X;  5EGW A;  2E00 A;  4PP2 E;  2G8E A;  2B1N A;  2DC8 A;  2Y5B A;  3K9M A;  4PI3 A;  4YVA A;  1F2A A;  2DJG B;  5CVM A;  3OIS A;  1Q6K A;  4FIP A;  2YJ9 A;  3PNR A;  2BDZ A;  3MTN A;  3IEJ A;  5K16 A;  2DCB A;  1PPP A;  4W4U A;  1FH0 A;  4AXL A;  1EWO A;  3H7D A;  1BP4 A;  4RY2 A;  3NHE A;  1PCI A;  2R9M A;  1EWL A;  2AYO A;  1U9Q X;  4I04 A;  3P5X A;  1KFX L;  1TL9 A;  2R9F A;  2AIM A;  1X9Y A;  3KSE A;  3CBJ A;  1KXR A;  4W5C A;  3IUT A;  1KFU L;  2R9N A;  4P6E A;  2ACT A;  4YYU A;  2YJB A;  2DCD A;  1PPD A;  2CB5 A;  4NV7 A;  2ATO A;  3LTW A;  3MOR A;  1ME3 A;  1F29 A;  3HHA A;  2VFB A;  4Q8H A;  3LFY A;  3PW3 A;  1SNK A;  3QT4 A;  1U9W A;  3BWK A;  5EF4 A;  1MIR A;  2DC7 A;  4X6I A;  2R6N A;  4I05 A;  1ZIV A;  4BPV A;  4BSQ A;  2AUZ A;  1YK7 A;  3U8E A;  4YYS A;  2F7D A;  1Y08 A;  1U5I A;  4YYQ A;  2G6D A;  2HH5 A;  1YT7 A;  2DJF B;  1W4T A;  2VFC A;  4X6H A;  3M99 A;  1MDW A;  3CH3 X;  2C0Y A;  1GEC E;  1NPZ A;  3K24 A;  1HUC B;  3PDF A;  2OZ2 A;  1TLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...