2BTWB

Crystal structure of alr0975
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
b'LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAPETAQYSPYRVFTQDNFFSNEKTKAVIAPEVVAKQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALR0975 PROTEIN
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Transferase
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2btwB00
2BTWB 2BTWA 2BU3A
chains in the Genus database with same CATH superfamily
3BWKA 1SP4B 3DF0A 9PAPA 1NPZA 4W4UA 1GECE 1UKFA 2E01A 4YYWA 3QT4A 2JQFR 3TMPA 1YK8A 2R9NA 5CVNB 2C0YA 1PVJA 3PHWA 2XU3A 1U9VA 1QXPA 4AXLA 2YJ2A 3LXSA 1FH0A 1MEGA 3CH2X 5A24A 3RVVA 1U5IA 2DCAA 4X6JA 1AU3A 1BQIA 2CIOA 4M0WA 1ZIVA 1S4VA 3AI8A 2AIMA 3H8BA 3IFUA 4OVZB 4BQVA 3S3RA 3E9SA 4A5UA 2P86A 3B79A 2DZYA 3CBKA 2BDZA 2Y5BA 1YALA 1SNKA 3K24A 4BOPA 4I07A 2FYEA 1CSBB 4BSQA 3PBHA 1NB3A 1PPPA 2AVWA 1KFXL 3I06A 4D8IA 4P6EA 1PPDA 1Q6KA 3HHAA 1NB5A 1ME4A 1AU0A 4RNAA 3ZUAA 1AECA 4MZOA 1Y4HA 2AUXA 2ACTA 5CHVA 3NHEA 1KHPA 1ICFA 2G7YA 2E02A 2AYOA 4OW0A 2OZ2A 4BS5A 3KKUA 4P16A 3P5XA 1STFE 1YVBA 3CBJA 1NQCA 1CV8A 2AS8A 1EWPA 3N4CA 3PHUA 1QMYA 4QRVA 4DMYA 3IMAA 2HD5A 1DF0A 2AUZA 4QRXA 4IUMA 2G8JA 4W5CA 1Y08A 2B1MA 1JQPA 2H7JA 1VSNA 2FRAA 2PBHA 1XKGA 4YVAA 1MEMA 1O0EA 3WXEA 5JH3A 1DKIA 3C9EA 3KWBX 2WBFX 4BOUA 4PI3A 3K8UA 3M99A 3N3GA 2Z84A 1PCIA 3O65A 3IUTA 3I3TA 1KXRA 3V6CA 3MHHA 2BTWA 4BOQA 3IHPA 1KFUL 3OQCA 4PADA 5F02A 2NQAA 3OF9A 3U8EA 2R9OA 1NLJA 1BY8A 5FPWA 3PW3A 2DC6A 4HWYA 4OEMA 4N8WA 3OISA 3KSEA 1BP4A 2DCCA 3N3KA 1POPA 3C0RA 2NQDB 4RKXA 1YT7A 2BDLA 3LFYA 3MORA 1CTEA 4DMXA 2CB5A 2Y6EA 3MTNA 1PPOA 1AYVA 3PRPA 5KO3A 2DJGB 1PADA 4WURA 1YZBA 2R9CA 4Q8GA 3BY4A 3ZNHA 4FJCA 2ATOA 2XU5A 2FT2A 1AYWA 3W31A 2R6NA 1QDQA 3O1GA 3P5WA 2GFOA 4YYVA 1CB5A 3H89A 5EZQA 2BTWB 4BOZA 2XU1A 8PCHA 3CH3X 1CJLA 3KX1A 5JZEA 1EWMA 3IEJA 2JTCA 2E03A 1F2BA 2DC8A 3MHSA 4YYRA 2XU4A 4YYUA 2O6XA 3IOQA 4N4ZA 1EWLA 1THEA 1PE6A 2F1GA 2HXZA 2PREA 2YJ8A 6PADA 4X6HA 2R9FA 5EGWA 2BU3A 2VHSA 2HH5A 3HHIA 3HWNA 4XR7A 1GLOA 4CDEB 3HD3A 5EZSA 1TU6A 1MS6A 3OVXA 1CQDA 1TL9A 1A6RA 4Q8HA 4PP1A 3PT2A 2DCBA 5EF4A 2DZZA 2ARYA 4QRGA 1X9YA 2FRQA 1MDWA 4BOSA 1PXVA 3P5UA 2F7DA 4D8BA 3WXFA 4YV8A 3B21A 4XZXA 2OULA 4N79A 3V6EA 1ZCMA 4KLBA 1BGOA 4BS6A 3ERVA 3PDFA 1CS8A 3F75A 1PBHA 2FE8A 2FUDA 4CZWA 1PPNA 4G54A 2HHNA 3BC3A 2E00A 3BPFA 1QOLA 4YYQA 2IBIA 3MJ5A 4D8EA 4YYSA 2JRIA 3WXGA 5K16A 2DC7A 3H7DA 1AIMA 4QBBA 1PIPA 3F5VA 3H6SA 5CVOB 2FO5A 4GUAA 2AYNA 2GHUA 1F2CA 4AXMA 2J7QA 1CPJA 4IP3A 2YJBA 4MZSA 4RF1A 3BBAA 3K9MA 3PSEA 3D6SA 4OELA 2YJCA 1IWDA 2B1NA 2DC9A 3W30A 2FTDA 4RY2A 1U9QX 2PADA 4CDCB 3QJ3A 4RF0A 4K7CA 3OVZA 4FK5A 1U9XA 1EF7A 3BCNA 4XUIA 1DEUA 3QSDA 3S3QA 5JA7A 3MP2A 4WA6A 4I04A 4MSXA 3IV2A 3GCBA 1ATKA 2P7UA 1MIRA 5CHTA 2OP3A 3MTVA 2G6DA 1KHQA 2AU1A 3KW9A 3RVWA 1MHWA 2DJFB 4ZUXU 3OF8A 5CVMA 3H8CA 5E6JA 2P0RA 3RVXA 2NQIA 1F29A 4MI7A 4PP2E 1HUCB 3USVA 3RNVA 3E1ZB 1M6DA 4BPVA 1K3BB 1ME3A 1GMYA 4I05A 4QH6A 1EWOA 5J94A 1TLOA 3TNXA 3O0UA 4W5BA 2YJ9A 2VHFA 1GCBA 2UZJA 1CVZA 1U9WA 2PNSA 3BPMA 3PHXA 1F2AA 2JQGR 2AGAA 4FIPA 4P6GA 2NQGA 2IPPB 3PRMA 2R9MA 1AU2A 3PNRA 1AYUA 2FQ9A 2J7QC 4CDFB 4PT5A 4OVZA 7PCKA 3TRKA 2HWKA 1NL6A 4R3DA 1VJVA 4ZTBA 3BOWA 1YK7A 4MM3B 4HXDB 1AU4A 1ITOA 2G8EA 3P5VA 3KFQA 2DOSA 2DCDA 3BB7A 5PADA 4X6IA 4CDDB 3KWZA 4REZA
chains in the Genus database with same CATH topology
1UKFA 3TMPA 1PVJA 3PHWA 2BU3A 3MP2A 1DKIA 4BOUA 5EZSA 2Z84A 3O65A 3PT2A 4M0WA 2BTWA 4BOQA 3MTVA 3OQCA 4BOSA 3IFUA 4OVZB 3E9SA 5E6JA 4A5UA 4D8BA 4MI7A 3B21A 4XZXA 3RNVA 4BOPA 3C0RA 2FE8A 4RKXA 2UZJA 4D8IA 3PHXA 3PRPA 5KO3A 3MJ5A 4D8EA 2JRIA 4WURA 1YZBA 4RNAA 3BY4A 3ZNHA 2AGAA 3W31A 3PRMA 4GUAA 2J7QC 4OW0A 4PT5A 5EZQA 2BTWB 4OVZA 4BOZA 3TRKA 2HWKA 4P16A 2J7QA 4R3DA 4IP3A 4ZTBA 4RF1A 5JZEA 3BBAA 3PSEA 3PHUA 4MM3B 2JTCA 3W30A 4HXDB 2DOSA 4IUMA 4RF0A 3BB7A 4REZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTW B;  2BTW A;  2BU3 A; 
#chains in the Genus database with same CATH topology
 3BWK A;  1SP4 B;  3DF0 A;  9PAP A;  1NPZ A;  4W4U A;  1GEC E;  1UKF A;  2E01 A;  4YYW A;  3QT4 A;  2JQF R;  3TMP A;  1YK8 A;  2R9N A;  5CVN B;  2C0Y A;  1PVJ A;  3PHW A;  2XU3 A;  1U9V A;  1QXP A;  4AXL A;  2YJ2 A;  3LXS A;  1FH0 A;  1MEG A;  3CH2 X;  5A24 A;  3RVV A;  1U5I A;  2DCA A;  4X6J A;  1AU3 A;  1BQI A;  2CIO A;  4M0W A;  1ZIV A;  1S4V A;  3AI8 A;  2AIM A;  3H8B A;  3IFU A;  4OVZ B;  4BQV A;  3S3R A;  3E9S A;  4A5U A;  2P86 A;  3B79 A;  2DZY A;  3CBK A;  2BDZ A;  2Y5B A;  1YAL A;  1SNK A;  3K24 A;  4BOP A;  4I07 A;  2FYE A;  1CSB B;  4BSQ A;  3PBH A;  1NB3 A;  1PPP A;  2AVW A;  1KFX L;  3I06 A;  4D8I A;  4P6E A;  1PPD A;  1Q6K A;  3HHA A;  1NB5 A;  1ME4 A;  1AU0 A;  4RNA A;  3ZUA A;  1AEC A;  4MZO A;  1Y4H A;  2AUX A;  2ACT A;  5CHV A;  3NHE A;  1KHP A;  1ICF A;  2G7Y A;  2E02 A;  2AYO A;  4OW0 A;  2OZ2 A;  4BS5 A;  3KKU A;  4P16 A;  3P5X A;  1STF E;  1YVB A;  3CBJ A;  1NQC A;  1CV8 A;  2AS8 A;  1EWP A;  3N4C A;  3PHU A;  1QMY A;  4QRV A;  4DMY A;  3IMA A;  2HD5 A;  1DF0 A;  2AUZ A;  4QRX A;  4IUM A;  2G8J A;  4W5C A;  1Y08 A;  2B1M A;  1JQP A;  2H7J A;  1VSN A;  2FRA A;  2PBH A;  1XKG A;  4YVA A;  1MEM A;  1O0E A;  3WXE A;  5JH3 A;  1DKI A;  3C9E A;  3KWB X;  2WBF X;  4BOU A;  4PI3 A;  3K8U A;  3M99 A;  3N3G A;  2Z84 A;  1PCI A;  3O65 A;  3IUT A;  3I3T A;  1KXR A;  3V6C A;  3MHH A;  2BTW A;  4BOQ A;  3IHP A;  1KFU L;  3OQC A;  4PAD A;  5F02 A;  2NQA A;  3OF9 A;  3U8E A;  2R9O A;  1NLJ A;  1BY8 A;  5FPW A;  3PW3 A;  2DC6 A;  4HWY A;  4OEM A;  4N8W A;  3OIS A;  3KSE A;  1BP4 A;  2DCC A;  3N3K A;  1POP A;  3C0R A;  2NQD B;  4RKX A;  1YT7 A;  2BDL A;  3LFY A;  3MOR A;  1CTE A;  4DMX A;  2CB5 A;  2Y6E A;  3MTN A;  1PPO A;  1AYV A;  3PRP A;  5KO3 A;  2DJG B;  1PAD A;  4WUR A;  1YZB A;  2R9C A;  4Q8G A;  3BY4 A;  3ZNH A;  4FJC A;  2ATO A;  2XU5 A;  2FT2 A;  1AYW A;  3W31 A;  2R6N A;  1QDQ A;  3O1G A;  3P5W A;  2GFO A;  4YYV A;  1CB5 A;  3H89 A;  5EZQ A;  2BTW B;  4BOZ A;  2XU1 A;  8PCH A;  3CH3 X;  1CJL A;  3KX1 A;  5JZE A;  1EWM A;  3IEJ A;  2JTC A;  2E03 A;  1F2B A;  2DC8 A;  3MHS A;  4YYR A;  2XU4 A;  4YYU A;  2O6X A;  3IOQ A;  4N4Z A;  1EWL A;  1THE A;  1PE6 A;  2F1G A;  2HXZ A;  2PRE A;  2YJ8 A;  6PAD A;  4X6H A;  2R9F A;  5EGW A;  2BU3 A;  2VHS A;  2HH5 A;  3HHI A;  3HWN A;  4XR7 A;  1GLO A;  4CDE B;  3HD3 A;  5EZS A;  1TU6 A;  1MS6 A;  3OVX A;  1CQD A;  1TL9 A;  1A6R A;  4Q8H A;  4PP1 A;  3PT2 A;  2DCB A;  5EF4 A;  2DZZ A;  2ARY A;  4QRG A;  1X9Y A;  2FRQ A;  1MDW A;  4BOS A;  1PXV A;  3P5U A;  2F7D A;  4D8B A;  3WXF A;  4YV8 A;  3B21 A;  4XZX A;  2OUL A;  4N79 A;  3V6E A;  1ZCM A;  4KLB A;  1BGO A;  4BS6 A;  3ERV A;  3PDF A;  1CS8 A;  3F75 A;  1PBH A;  2FE8 A;  2FUD A;  4CZW A;  1PPN A;  4G54 A;  2HHN A;  3BC3 A;  2E00 A;  3BPF A;  1QOL A;  4YYQ A;  2IBI A;  3MJ5 A;  4D8E A;  4YYS A;  2JRI A;  3WXG A;  5K16 A;  2DC7 A;  3H7D A;  1AIM A;  4QBB A;  1PIP A;  3F5V A;  3H6S A;  5CVO B;  2FO5 A;  4GUA A;  2AYN A;  2GHU A;  1F2C A;  4AXM A;  2J7Q A;  1CPJ A;  4IP3 A;  2YJB A;  4MZS A;  4RF1 A;  3BBA A;  3K9M A;  3PSE A;  3D6S A;  4OEL A;  2YJC A;  1IWD A;  2B1N A;  2DC9 A;  3W30 A;  2FTD A;  4RY2 A;  1U9Q X;  2PAD A;  4CDC B;  3QJ3 A;  4RF0 A;  4K7C A;  3OVZ A;  4FK5 A;  1U9X A;  1EF7 A;  3BCN A;  4XUI A;  1DEU A;  3QSD A;  3S3Q A;  5JA7 A;  3MP2 A;  4WA6 A;  4I04 A;  4MSX A;  3IV2 A;  3GCB A;  1ATK A;  2P7U A;  1MIR A;  5CHT A;  2OP3 A;  3MTV A;  2G6D A;  1KHQ A;  2AU1 A;  3KW9 A;  3RVW A;  1MHW A;  2DJF B;  4ZUX U;  3OF8 A;  5CVM A;  3H8C A;  5E6J A;  2P0R A;  3RVX A;  2NQI A;  1F29 A;  4MI7 A;  4PP2 E;  1HUC B;  3USV A;  3RNV A;  3E1Z B;  1M6D A;  4BPV A;  1K3B B;  1ME3 A;  1GMY A;  4I05 A;  4QH6 A;  1EWO A;  5J94 A;  1TLO A;  3TNX A;  3O0U A;  4W5B A;  2YJ9 A;  2VHF A;  1GCB A;  2UZJ A;  1CVZ A;  1U9W A;  2PNS A;  3BPM A;  3PHX A;  1F2A A;  2JQG R;  2AGA A;  4FIP A;  4P6G A;  2NQG A;  2IPP B;  3PRM A;  2R9M A;  1AU2 A;  3PNR A;  1AYU A;  2FQ9 A;  2J7Q C;  4CDF B;  4PT5 A;  4OVZ A;  7PCK A;  3TRK A;  2HWK A;  1NL6 A;  4R3D A;  1VJV A;  4ZTB A;  3BOW A;  1YK7 A;  4MM3 B;  4HXD B;  1AU4 A;  1ITO A;  2G8E A;  3P5V A;  3KFQ A;  2DOS A;  2DCD A;  3BB7 A;  5PAD A;  4X6I A;  4CDD B;  3KWZ A;  4REZ A; 
#chains in the Genus database with same CATH homology
 1UKF A;  3TMP A;  1PVJ A;  3PHW A;  2BU3 A;  3MP2 A;  1DKI A;  4BOU A;  5EZS A;  2Z84 A;  3O65 A;  3PT2 A;  4M0W A;  2BTW A;  4BOQ A;  3MTV A;  3OQC A;  4BOS A;  3IFU A;  4OVZ B;  3E9S A;  5E6J A;  4A5U A;  4D8B A;  4MI7 A;  3B21 A;  4XZX A;  3RNV A;  4BOP A;  3C0R A;  2FE8 A;  4RKX A;  2UZJ A;  4D8I A;  3PHX A;  3PRP A;  5KO3 A;  3MJ5 A;  4D8E A;  2JRI A;  4WUR A;  1YZB A;  4RNA A;  3BY4 A;  3ZNH A;  2AGA A;  3W31 A;  3PRM A;  4GUA A;  2J7Q C;  4OW0 A;  4PT5 A;  5EZQ A;  2BTW B;  4OVZ A;  4BOZ A;  3TRK A;  2HWK A;  4P16 A;  2J7Q A;  4R3D A;  4IP3 A;  4ZTB A;  4RF1 A;  5JZE A;  3BBA A;  3PSE A;  3PHU A;  4MM3 B;  2JTC A;  3W30 A;  4HXD B;  2DOS A;  4IUM A;  4RF0 A;  3BB7 A;  4REZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...