2BTWB

Crystal structure of alr0975
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAPETAQYSPYRVFTQDNFFSNEKTKAVIAPEVVAKQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Transferase
molecule keywords ALR0975 PROTEIN
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2btwB00
2BU3A 2BTWB 2BTWA
chains in the Genus database with same CATH superfamily
3GCBA 1GECE 1EWOA 5JA7A 1YT7A 1A6RA 2FT2A 2VHSA 2AS8A 1ZIVA 1GMYA 3OVZA 3ZNHA 4W4UA 1F2AA 3I06A 2HH5A 3CBJA 6PADA 1CS8A 1YZBA 1NL6A 1NPZA 2YJBA 3ZUAA 3KWBX 2NQAA 4DMYA 3BPFA 1CB5A 1AU3A 1BP4A 4Q8HA 3IOQA 1AYVA 2PBHA 4ZUXU 3AI8A 5FPWA 1KHPA 3HHIA 4N79A 2AIMA 4BS5A 1PXVA 1Q6KA 2GFOA 2BU3A 1HUCB 1FH0A 4YVAA 2O6XA 3H8BA 3ERVA 2BDLA 2DC9A 2NQGA 2JTCA 1M6DA 2IBIA 1NQCA 3BCNA 2HHNA 1MIRA 3OF8A 2AGAA 4CDCB 4X6IA 2BTWB 4RF0A 3CBKA 4D8BA 5KO3A 4WA6A 1SP4B 3TMPA 3V6CA 4I04A 3W30A 3H89A 2DC8A 1AU2A 1CSBB 4RF1A 2AUZA 1O0EA 5CHTA 1ITOA 4PI3A 1YVBA 1AYWA 4G54A 3BB7A 3HHAA 4FK5A 4BOUA 1MEMA 2E03A 2ATOA 4I07A 4MM3B 4PADA 3IMAA 2E00A 7PCKA 3MTNA 1F2CA 1SNKA 4PT5A 3K9MA 2XU5A 3B21A 2IPPB 4IUMA 4P6GA 4P16A 5CHVA 4PP2E 1GCBA 1AECA 1THEA 5F02A 4FJCA 2HXZA 3RVXA 1DF0A 2UZJA 4QRXA 1AIMA 1STFE 8PCHA 1U9XA 2FE8A 2XU4A 1Y08A 4HXDB 2DJGB 2G7YA 2DZZA 2B1NA 3PBHA 3MTVA 1MHWA 2G8EA 4BQVA 1NB3A 1PADA 4RY2A 1Y4HA 4BOQA 1PBHA 4OELA 3PHUA 4ZTBA 5J94A 2ARYA 3PHXA 3MHSA 1BY8A 2E01A 4QBBA 1YALA 2P0RA 2XU3A 2FTDA 3HD3A 3OF9A 1U9VA 3WXEA 1EWLA 2AYOA 3H7DA 3QSDA 3RNVA 3IV2A 4RKXA 1ME3A 5A24A 2DOSA 3NHEA 4OVZA 1MS6A 3N3KA 2NQIA 1YK8A 1NB5A 4YYVA 3D6SA 2R9OA 3IEJA 4OEMA 2G8JA 4XUIA 1GLOA 1KFXL 3BBAA 1ICFA 3DF0A 2FRQA 4Q8GA 1PPOA 4BOSA 3OQCA 3PHWA 1TLOA 3QT4A 3OISA 1AU0A 1AYUA 4YV8A 2YJ2A 2HWKA 2BDZA 3P5VA 4KLBA 1AU4A 3WXGA 2PADA 2R9MA 1NLJA 1QXPA 2DCCA 3KSEA 3OVXA 4OVZB 3I3TA 1TU6A 1U5IA 1S4VA 3K8UA 2DC6A 4A5UA 4N4ZA 2Y6EA 3KW9A 2PNSA 3MP2A 1F29A 4K7CA 4OW0A 4MZSA 1UKFA 2JQFR 1U9QX 4MI7A 3BPMA 2J7QA 2DCAA 4YYSA 3E1ZB 5EZQA 2BTWA 1QMYA 3WXFA 3TNXA 4YYQA 1KFUL 3KX1A 4X6HA 1BGOA 2XU1A 3PW3A 1BQIA 4DMXA 2HD5A 2NQDB 3E9SA 1CPJA 3IFUA 3PT2A 5PADA 1U9WA 1CV8A 1EWPA 3O1GA 4QH6A 3PRMA 2AYNA 4IP3A 4N8WA 2YJCA 2PREA 5K16A 3IHPA 3O0UA 3QJ3A 2Y5BA 1ATKA 4YYRA 1MEGA 4BOPA 2P86A 4M0WA 4I05A 4R3DA 2ACTA 2DC7A 2YJ9A 1QOLA 4XR7A 2F7DA 3CH2X 4FIPA 5EZSA 4CDDB 2E02A 4AXLA 4WURA 5JZEA 2FO5A 1CVZA 4W5CA 1CTEA 4AXMA 2FQ9A 3P5XA 2G6DA 1IWDA 1EF7A 2OZ2A 1VJVA 3F5VA 3O65A 4YYWA 3PSEA 2AVWA 1QDQA 3K24A 3KFQA 3IUTA 3C9EA 2R6NA 3KKUA 5JH3A 3BWKA 4D8EA 4XZXA 3N4CA 2DCBA 3TRKA 1ZCMA 3BC3A 1PE6A 4X6JA 3USVA 2FYEA 1KXRA 2VHFA 1POPA 1PPNA 4REZA 4GUAA 2DJFB 2JQGR 2WBFX 4QRGA 3HWNA 3C0RA 3U8EA 4YYUA 1TL9A 2YJ8A 1KHQA 3PRPA 2FUDA 2OULA 1ME4A 2GHUA 2B1MA 1CQDA 3S3QA 1CJLA 3P5UA 4RNAA 3LFYA 3MHHA 4BPVA 4D8IA 3MJ5A 2H7JA 3S3RA 4HWYA 2OP3A 2Z84A 5EF4A 2DZYA 4QRVA 5EGWA 3RVWA 1XKGA 3B79A 2J7QC 2CIOA 4W5BA 4PP1A 1PIPA 3F75A 1PPDA 1DKIA 3BY4A 3KWZA 4MSXA 1PCIA 3BOWA 1PPPA 4CDEB 5CVNB 3H6SA 4BS6A 4CZWA 4MZOA 2FRAA 3MORA 3V6EA 2CB5A 3LXSA 1K3BB 2R9NA 2R9FA 3N3GA 4BOZA 5E6JA 3PNRA 2DCDA 2C0YA 3H8CA 3PDFA 5CVOB 2R9CA 1DEUA 2JRIA 4BSQA 1PVJA 2AU1A 3M99A 1YK7A 1VSNA 1MDWA 1JQPA 2P7UA 3RVVA 3W31A 9PAPA 4P6EA 4CDFB 2F1GA 2AUXA 3CH3X 1X9YA 1EWMA 3P5WA 5CVMA 1F2BA
chains in the Genus database with same CATH topology
4OVZA 5EZQA 5EZSA 3PRMA 4BOQA 2BTWA 2BU3A 2BTWB 2UZJA 4IP3A 3C0RA 2J7QC 4RF0A 3PHUA 4OVZB 4ZTBA 4BOUA 4MM3B 4WURA 4D8BA 5JZEA 3PHXA 5KO3A 3TMPA 2JRIA 3PRPA 4A5UA 3BBAA 1DKIA 2FE8A 2JTCA 3BY4A 1PVJA 4XZXA 4D8EA 3W30A 3MP2A 4HXDB 4BOSA 4BOPA 4M0WA 4RF1A 4OW0A 4D8IA 3OQCA 4RNAA 4PT5A 3PHWA 4R3DA 3E9SA 3IFUA 3ZNHA 3MTVA 3B21A 1UKFA 3MJ5A 3PT2A 4MI7A 3RNVA 4IUMA 3TRKA 3W31A 4P16A 4BOZA 4RKXA 5E6JA 2HWKA 2J7QA 3O65A 3PSEA 2Z84A 1YZBA 3BB7A 4REZA 4GUAA 2AGAA 2DOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU3 A;  2BTW B;  2BTW A; 
#chains in the Genus database with same CATH topology
 3GCB A;  1GEC E;  1EWO A;  5JA7 A;  1YT7 A;  1A6R A;  2FT2 A;  2VHS A;  2AS8 A;  1ZIV A;  1GMY A;  3OVZ A;  3ZNH A;  4W4U A;  1F2A A;  3I06 A;  2HH5 A;  3CBJ A;  6PAD A;  1CS8 A;  1YZB A;  1NL6 A;  1NPZ A;  2YJB A;  3ZUA A;  3KWB X;  2NQA A;  4DMY A;  3BPF A;  1CB5 A;  1AU3 A;  1BP4 A;  4Q8H A;  3IOQ A;  1AYV A;  2PBH A;  4ZUX U;  3AI8 A;  5FPW A;  1KHP A;  3HHI A;  4N79 A;  2AIM A;  4BS5 A;  1PXV A;  1Q6K A;  2GFO A;  2BU3 A;  1HUC B;  1FH0 A;  4YVA A;  2O6X A;  3H8B A;  3ERV A;  2BDL A;  2DC9 A;  2NQG A;  2JTC A;  1M6D A;  2IBI A;  1NQC A;  3BCN A;  2HHN A;  1MIR A;  3OF8 A;  2AGA A;  4CDC B;  4X6I A;  2BTW B;  4RF0 A;  3CBK A;  4D8B A;  5KO3 A;  4WA6 A;  1SP4 B;  3TMP A;  3V6C A;  4I04 A;  3W30 A;  3H89 A;  2DC8 A;  1AU2 A;  1CSB B;  4RF1 A;  2AUZ A;  1O0E A;  5CHT A;  1ITO A;  4PI3 A;  1YVB A;  1AYW A;  4G54 A;  3BB7 A;  3HHA A;  4FK5 A;  4BOU A;  1MEM A;  2E03 A;  2ATO A;  4I07 A;  4MM3 B;  4PAD A;  3IMA A;  2E00 A;  7PCK A;  3MTN A;  1F2C A;  1SNK A;  4PT5 A;  3K9M A;  2XU5 A;  3B21 A;  2IPP B;  4IUM A;  4P6G A;  4P16 A;  5CHV A;  4PP2 E;  1GCB A;  1AEC A;  1THE A;  5F02 A;  4FJC A;  2HXZ A;  3RVX A;  1DF0 A;  2UZJ A;  4QRX A;  1AIM A;  1STF E;  8PCH A;  1U9X A;  2FE8 A;  2XU4 A;  1Y08 A;  4HXD B;  2DJG B;  2G7Y A;  2DZZ A;  2B1N A;  3PBH A;  3MTV A;  1MHW A;  2G8E A;  4BQV A;  1NB3 A;  1PAD A;  4RY2 A;  1Y4H A;  4BOQ A;  1PBH A;  4OEL A;  3PHU A;  4ZTB A;  5J94 A;  2ARY A;  3PHX A;  3MHS A;  1BY8 A;  2E01 A;  4QBB A;  1YAL A;  2P0R A;  2XU3 A;  2FTD A;  3HD3 A;  3OF9 A;  1U9V A;  3WXE A;  1EWL A;  2AYO A;  3H7D A;  3QSD A;  3RNV A;  3IV2 A;  4RKX A;  1ME3 A;  5A24 A;  2DOS A;  3NHE A;  4OVZ A;  1MS6 A;  3N3K A;  2NQI A;  1YK8 A;  1NB5 A;  4YYV A;  3D6S A;  2R9O A;  3IEJ A;  4OEM A;  2G8J A;  4XUI A;  1GLO A;  1KFX L;  3BBA A;  1ICF A;  3DF0 A;  2FRQ A;  4Q8G A;  1PPO A;  4BOS A;  3OQC A;  3PHW A;  1TLO A;  3QT4 A;  3OIS A;  1AU0 A;  1AYU A;  4YV8 A;  2YJ2 A;  2HWK A;  2BDZ A;  3P5V A;  4KLB A;  1AU4 A;  3WXG A;  2PAD A;  2R9M A;  1NLJ A;  1QXP A;  2DCC A;  3KSE A;  3OVX A;  4OVZ B;  3I3T A;  1TU6 A;  1U5I A;  1S4V A;  3K8U A;  2DC6 A;  4A5U A;  4N4Z A;  2Y6E A;  3KW9 A;  2PNS A;  3MP2 A;  1F29 A;  4K7C A;  4OW0 A;  4MZS A;  1UKF A;  2JQF R;  1U9Q X;  4MI7 A;  3BPM A;  2J7Q A;  2DCA A;  4YYS A;  3E1Z B;  5EZQ A;  2BTW A;  1QMY A;  3WXF A;  3TNX A;  4YYQ A;  1KFU L;  3KX1 A;  4X6H A;  1BGO A;  2XU1 A;  3PW3 A;  1BQI A;  4DMX A;  2HD5 A;  2NQD B;  3E9S A;  1CPJ A;  3IFU A;  3PT2 A;  5PAD A;  1U9W A;  1CV8 A;  1EWP A;  3O1G A;  4QH6 A;  3PRM A;  2AYN A;  4IP3 A;  4N8W A;  2YJC A;  2PRE A;  5K16 A;  3IHP A;  3O0U A;  3QJ3 A;  2Y5B A;  1ATK A;  4YYR A;  1MEG A;  4BOP A;  2P86 A;  4M0W A;  4I05 A;  4R3D A;  2ACT A;  2DC7 A;  2YJ9 A;  1QOL A;  4XR7 A;  2F7D A;  3CH2 X;  4FIP A;  5EZS A;  4CDD B;  2E02 A;  4AXL A;  4WUR A;  5JZE A;  2FO5 A;  1CVZ A;  4W5C A;  1CTE A;  4AXM A;  2FQ9 A;  3P5X A;  2G6D A;  1IWD A;  1EF7 A;  2OZ2 A;  1VJV A;  3F5V A;  3O65 A;  4YYW A;  3PSE A;  2AVW A;  1QDQ A;  3K24 A;  3KFQ A;  3IUT A;  3C9E A;  2R6N A;  3KKU A;  5JH3 A;  3BWK A;  4D8E A;  4XZX A;  3N4C A;  2DCB A;  3TRK A;  1ZCM A;  3BC3 A;  1PE6 A;  4X6J A;  3USV A;  2FYE A;  1KXR A;  2VHF A;  1POP A;  1PPN A;  4REZ A;  4GUA A;  2DJF B;  2JQG R;  2WBF X;  4QRG A;  3HWN A;  3C0R A;  3U8E A;  4YYU A;  1TL9 A;  2YJ8 A;  1KHQ A;  3PRP A;  2FUD A;  2OUL A;  1ME4 A;  2GHU A;  2B1M A;  1CQD A;  3S3Q A;  1CJL A;  3P5U A;  4RNA A;  3LFY A;  3MHH A;  4BPV A;  4D8I A;  3MJ5 A;  2H7J A;  3S3R A;  4HWY A;  2OP3 A;  2Z84 A;  5EF4 A;  2DZY A;  4QRV A;  5EGW A;  3RVW A;  1XKG A;  3B79 A;  2J7Q C;  2CIO A;  4W5B A;  4PP1 A;  1PIP A;  3F75 A;  1PPD A;  1DKI A;  3BY4 A;  3KWZ A;  4MSX A;  1PCI A;  3BOW A;  1PPP A;  4CDE B;  5CVN B;  3H6S A;  4BS6 A;  4CZW A;  4MZO A;  2FRA A;  3MOR A;  3V6E A;  2CB5 A;  3LXS A;  1K3B B;  2R9N A;  2R9F A;  3N3G A;  4BOZ A;  5E6J A;  3PNR A;  2DCD A;  2C0Y A;  3H8C A;  3PDF A;  5CVO B;  2R9C A;  1DEU A;  2JRI A;  4BSQ A;  1PVJ A;  2AU1 A;  3M99 A;  1YK7 A;  1VSN A;  1MDW A;  1JQP A;  2P7U A;  3RVV A;  3W31 A;  9PAP A;  4P6E A;  4CDF B;  2F1G A;  2AUX A;  3CH3 X;  1X9Y A;  1EWM A;  3P5W A;  5CVM A;  1F2B A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  5EZQ A;  5EZS A;  3PRM A;  4BOQ A;  2BTW A;  2BU3 A;  2BTW B;  2UZJ A;  4IP3 A;  3C0R A;  2J7Q C;  4RF0 A;  3PHU A;  4OVZ B;  4ZTB A;  4BOU A;  4MM3 B;  4WUR A;  4D8B A;  5JZE A;  3PHX A;  5KO3 A;  3TMP A;  2JRI A;  3PRP A;  4A5U A;  3BBA A;  1DKI A;  2FE8 A;  2JTC A;  3BY4 A;  1PVJ A;  4XZX A;  4D8E A;  3W30 A;  3MP2 A;  4HXD B;  4BOS A;  4BOP A;  4M0W A;  4RF1 A;  4OW0 A;  4D8I A;  3OQC A;  4RNA A;  4PT5 A;  3PHW A;  4R3D A;  3E9S A;  3IFU A;  3ZNH A;  3MTV A;  3B21 A;  1UKF A;  3MJ5 A;  3PT2 A;  4MI7 A;  3RNV A;  4IUM A;  3TRK A;  3W31 A;  4P16 A;  4BOZ A;  4RKX A;  5E6J A;  2HWK A;  2J7Q A;  3O65 A;  3PSE A;  2Z84 A;  1YZB A;  3BB7 A;  4REZ A;  4GUA A;  2AGA A;  2DOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...