2BTWB

Crystal structure of alr0975
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAPETAQYSPYRVFTQDNFFSNEKTKAVIAPEVVAKQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ALR0975 PROTEIN
publication title A Papain-Like Enzyme at Work: Native and Acyl- Enzyme Intermediate Structures in Phytochelatin Synthesis.
pubmed doi rcsb
source organism Anabaena sp.
total genus 65
structure length 210
sequence length 210
ec nomenclature ec 2.3.2.15: Glutathione gamma-glutamylcysteinyltransferase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05023 Phytochelatin Phytochelatin synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.30 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2btwB00
2BU3A 2BTWA 2BTWB
chains in the Genus database with same CATH superfamily
2OZ2A 4BS6A 3OF9A 1THEA 2OULA 4FJCA 4CZWA 2PREA 4W5CA 1AYUA 3H6SA 4OW0A 4QBBA 4WA6A 3H8BA 4WURA 3RNVA 3ZUAA 1TU6A 5EZQA 2FQ9A 1DF0A 5JZEA 1IWDA 2DJFB 4CDEB 5JH3A 4XUIA 4GUAA 3PRPA 1PPOA 1F2CA 1NLJA 2DJGB 2BU3A 4OVZA 3OF8A 4ZTBA 1EWLA 3CBKA 3DF0A 2FO5A 2AYNA 4BOSA 4YYWA 1MHWA 3MTVA 2E03A 4MM3B 3LXSA 4DMYA 4MSXA 2DCAA 3H8CA 3IUTA 1PCIA 3H89A 2YJ2A 1PADA 2AS8A 2C0YA 3W31A 2PNSA 1YVBA 4OELA 1BQIA 4AXLA 2E01A 3U8EA 4QH6A 3P5XA 3N4CA 4RF1A 4BOZA 1DEUA 1CS8A 1AECA 2HWKA 3HD3A 2DZZA 3TMPA 4BPVA 3BB7A 2BTWB 4REZA 2AVWA 5CVNB 3E1ZB 1U9VA 4PI3A 2G7YA 1O0EA 2IBIA 1AU4A 3KSEA 2DC8A 3NHEA 4I05A 1XKGA 3MORA 2DC9A 4RF0A 1VSNA 3OVZA 1ZIVA 3K9MA 2IPPB 2R6NA 2R9MA 1BGOA 2DOSA 2NQIA 1KHQA 4P16A 5KO3A 4YYVA 1BY8A 3N3KA 4RKXA 4FK5A 4D8BA 1FH0A 3S3RA 1CVZA 2BTWA 1NB3A 1NQCA 1GLOA 1AU0A 1QMYA 1CB5A 4YVAA 4HWYA 4QRVA 3W30A 1YK7A 1M6DA 4BOPA 2ACTA 1YT7A 2FRAA 3AI8A 4CDDB 4N4ZA 2E02A 4MZSA 2OP3A 1GMYA 4PP2E 2FRQA 3ERVA 3PHXA 4CDFB 4P6GA 2G8JA 2NQDB 4MI7A 2BDZA 5EF4A 5CVOB 1CV8A 2Z84A 2B1NA 1X9YA 1ME3A 3MTNA 3IMAA 3B79A 3TNXA 4XZXA 7PCKA 2NQGA 3KFQA 1MDWA 4X6HA 3I06A 3HHIA 3P5WA 2YJCA 1QDQA 1JQPA 1ICFA 4MZOA 3PW3A 3PHUA 1PPPA 4I04A 3BC3A 2YJ9A 5EZSA 4BS5A 3PNRA 4W5BA 2F7DA 1KFUL 1U9WA 3RVXA 1BP4A 1AU2A 1NL6A 2CIOA 3B21A 4YYUA 2J7QC 4DMXA 3HHAA 4D8IA 3KX1A 3BPMA 2VHSA 2FYEA 4HXDB 1A6RA 4YYRA 3E9SA 2JQGR 1STFE 1HUCB 3P5VA 1AU3A 1MIRA 3PSEA 1TLOA 3F75A 3IOQA 3H7DA 2DC6A 5JA7A 1S4VA 4XR7A 1Q6KA 5F02A 1YK8A 2P0RA 3F5VA 2JQFR 4BSQA 3KWZA 3CBJA 4YV8A 2HH5A 2FTDA 1UKFA 1PXVA 4N79A 4W4UA 2G6DA 2XU5A 3PHWA 2FUDA 3IV2A 1EWPA 2HHNA 2R9OA 3K8UA 5CHTA 1F29A 1U9XA 2DCDA 1U5IA 3V6EA 4YYQA 1PPNA 2B1MA 4Q8HA 1GECE 6PADA 1CQDA 3PDFA 2F1GA 4AXMA 4RNAA 2NQAA 4PT5A 2AU1A 3MHHA 4A5UA 1ZCMA 3WXEA 2XU4A 3HWNA 2JTCA 3K24A 3BOWA 3C9EA 4PADA 1F2AA 4Q8GA 4IUMA 1ITOA 2R9NA 1SNKA 2G8EA 1DKIA 1PBHA 1Y4HA 2JRIA 2YJ8A 1KXRA 3S3QA 3O0UA 5K16A 2AUZA 5CVMA 5FPWA 3IFUA 5J94A 1PVJA 3OVXA 4QRGA 4BOUA 2E00A 3WXGA 5A24A 2ARYA 1U9QX 1EF7A 3CH2X 4PP1A 3OQCA 3PBHA 3IEJA 2GHUA 1PPDA 3TRKA 1TL9A 4OEMA 1AYWA 1VJVA 4CDCB 3KWBX 2DCCA 1YZBA 1GCBA 2WBFX 1K3BB 2R9FA 8PCHA 3P5UA 1KFXL 2DC7A 4K7CA 1CTEA 2VHFA 2AUXA 3QJ3A 3BCNA 3ZNHA 4R3DA 1NB5A 2PBHA 2HXZA 3BY4A 4X6JA 1PIPA 4FIPA 2O6XA 2AIMA 1AIMA 4IP3A 2FE8A 1QXPA 2HD5A 3USVA 5CHVA 2DCBA 4P6EA 1POPA 1F2BA 1PE6A 3I3TA 3MJ5A 1MEMA 3QT4A 2YJBA 4KLBA 3PRMA 2AGAA 3BPFA 2Y6EA 1MS6A 3WXFA 1ME4A 2FT2A 4BQVA 2H7JA 1YALA 2ATOA 4G54A 2P86A 1QOLA 2AYOA 3D6SA 3V6CA 4I07A 3RVWA 2BDLA 2GFOA 2CB5A 2R9CA 3KW9A 1NPZA 2UZJA 4ZUXU 4RY2A 1AYVA 1Y08A 3O1GA 4X6IA 5PADA 1CPJA 2DZYA 5EGWA 3LFYA 3CH3X 1KHPA 4N8WA 3OISA 2XU1A 3QSDA 1EWMA 9PAPA 3C0RA 1MEGA 3IHPA 1SP4B 3MP2A 3O65A 3M99A 4QRXA 4BOQA 3N3GA 3RVVA 3GCBA 2Y5BA 4M0WA 4D8EA 3PT2A 1CJLA 2PADA 1EWOA 2P7UA 3KKUA 3MHSA 5E6JA 4OVZB 1ATKA 2J7QA 2XU3A 1CSBB 3BWKA 4YYSA 3BBAA
chains in the Genus database with same CATH topology
3BY4A 4P16A 5KO3A 4RKXA 4IP3A 4D8BA 2FE8A 3PHWA 2BTWA 4OW0A 4WURA 3MJ5A 3RNVA 5EZQA 3W30A 4BOPA 5JZEA 3PRMA 2AGAA 3PRPA 4GUAA 3PHXA 4RNAA 4PT5A 2BU3A 4OVZA 4ZTBA 4A5UA 4MI7A 2JTCA 2Z84A 4BOSA 3MTVA 4MM3B 4XZXA 4IUMA 2UZJA 1DKIA 3W31A 3PHUA 2JRIA 5EZSA 4RF1A 3IFUA 4BOZA 1PVJA 4BOUA 2HWKA 3B21A 3TMPA 2J7QC 4D8IA 3C0RA 3OQCA 3BB7A 2BTWB 4REZA 3TRKA 3MP2A 3O65A 4BOQA 4HXDB 3E9SA 1YZBA 4M0WA 4D8EA 3PT2A 3PSEA 5E6JA 4OVZB 4RF0A 2J7QA 3ZNHA 4R3DA 1UKFA 2DOSA 3BBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU3 A;  2BTW A;  2BTW B; 
#chains in the Genus database with same CATH topology
 2OZ2 A;  4BS6 A;  3OF9 A;  1THE A;  2OUL A;  4FJC A;  4CZW A;  2PRE A;  4W5C A;  1AYU A;  3H6S A;  4OW0 A;  4QBB A;  4WA6 A;  3H8B A;  4WUR A;  3RNV A;  3ZUA A;  1TU6 A;  5EZQ A;  2FQ9 A;  1DF0 A;  5JZE A;  1IWD A;  2DJF B;  4CDE B;  5JH3 A;  4XUI A;  4GUA A;  3PRP A;  1PPO A;  1F2C A;  1NLJ A;  2DJG B;  2BU3 A;  4OVZ A;  3OF8 A;  4ZTB A;  1EWL A;  3CBK A;  3DF0 A;  2FO5 A;  2AYN A;  4BOS A;  4YYW A;  1MHW A;  3MTV A;  2E03 A;  4MM3 B;  3LXS A;  4DMY A;  4MSX A;  2DCA A;  3H8C A;  3IUT A;  1PCI A;  3H89 A;  2YJ2 A;  1PAD A;  2AS8 A;  2C0Y A;  3W31 A;  2PNS A;  1YVB A;  4OEL A;  1BQI A;  4AXL A;  2E01 A;  3U8E A;  4QH6 A;  3P5X A;  3N4C A;  4RF1 A;  4BOZ A;  1DEU A;  1CS8 A;  1AEC A;  2HWK A;  3HD3 A;  2DZZ A;  3TMP A;  4BPV A;  3BB7 A;  2BTW B;  4REZ A;  2AVW A;  5CVN B;  3E1Z B;  1U9V A;  4PI3 A;  2G7Y A;  1O0E A;  2IBI A;  1AU4 A;  3KSE A;  2DC8 A;  3NHE A;  4I05 A;  1XKG A;  3MOR A;  2DC9 A;  4RF0 A;  1VSN A;  3OVZ A;  1ZIV A;  3K9M A;  2IPP B;  2R6N A;  2R9M A;  1BGO A;  2DOS A;  2NQI A;  1KHQ A;  4P16 A;  5KO3 A;  4YYV A;  1BY8 A;  3N3K A;  4RKX A;  4FK5 A;  4D8B A;  1FH0 A;  3S3R A;  1CVZ A;  2BTW A;  1NB3 A;  1NQC A;  1GLO A;  1AU0 A;  1QMY A;  1CB5 A;  4YVA A;  4HWY A;  4QRV A;  3W30 A;  1YK7 A;  1M6D A;  4BOP A;  2ACT A;  1YT7 A;  2FRA A;  3AI8 A;  4CDD B;  4N4Z A;  2E02 A;  4MZS A;  2OP3 A;  1GMY A;  4PP2 E;  2FRQ A;  3ERV A;  3PHX A;  4CDF B;  4P6G A;  2G8J A;  2NQD B;  4MI7 A;  2BDZ A;  5EF4 A;  5CVO B;  1CV8 A;  2Z84 A;  2B1N A;  1X9Y A;  1ME3 A;  3MTN A;  3IMA A;  3B79 A;  3TNX A;  4XZX A;  7PCK A;  2NQG A;  3KFQ A;  1MDW A;  4X6H A;  3I06 A;  3HHI A;  3P5W A;  2YJC A;  1QDQ A;  1JQP A;  1ICF A;  4MZO A;  3PW3 A;  3PHU A;  1PPP A;  4I04 A;  3BC3 A;  2YJ9 A;  5EZS A;  4BS5 A;  3PNR A;  4W5B A;  2F7D A;  1KFU L;  1U9W A;  3RVX A;  1BP4 A;  1AU2 A;  1NL6 A;  2CIO A;  3B21 A;  4YYU A;  2J7Q C;  4DMX A;  3HHA A;  4D8I A;  3KX1 A;  3BPM A;  2VHS A;  2FYE A;  4HXD B;  1A6R A;  4YYR A;  3E9S A;  2JQG R;  1STF E;  1HUC B;  3P5V A;  1AU3 A;  1MIR A;  3PSE A;  1TLO A;  3F75 A;  3IOQ A;  3H7D A;  2DC6 A;  5JA7 A;  1S4V A;  4XR7 A;  1Q6K A;  5F02 A;  1YK8 A;  2P0R A;  3F5V A;  2JQF R;  4BSQ A;  3KWZ A;  3CBJ A;  4YV8 A;  2HH5 A;  2FTD A;  1UKF A;  1PXV A;  4N79 A;  4W4U A;  2G6D A;  2XU5 A;  3PHW A;  2FUD A;  3IV2 A;  1EWP A;  2HHN A;  2R9O A;  3K8U A;  5CHT A;  1F29 A;  1U9X A;  2DCD A;  1U5I A;  3V6E A;  4YYQ A;  1PPN A;  2B1M A;  4Q8H A;  1GEC E;  6PAD A;  1CQD A;  3PDF A;  2F1G A;  4AXM A;  4RNA A;  2NQA A;  4PT5 A;  2AU1 A;  3MHH A;  4A5U A;  1ZCM A;  3WXE A;  2XU4 A;  3HWN A;  2JTC A;  3K24 A;  3BOW A;  3C9E A;  4PAD A;  1F2A A;  4Q8G A;  4IUM A;  1ITO A;  2R9N A;  1SNK A;  2G8E A;  1DKI A;  1PBH A;  1Y4H A;  2JRI A;  2YJ8 A;  1KXR A;  3S3Q A;  3O0U A;  5K16 A;  2AUZ A;  5CVM A;  5FPW A;  3IFU A;  5J94 A;  1PVJ A;  3OVX A;  4QRG A;  4BOU A;  2E00 A;  3WXG A;  5A24 A;  2ARY A;  1U9Q X;  1EF7 A;  3CH2 X;  4PP1 A;  3OQC A;  3PBH A;  3IEJ A;  2GHU A;  1PPD A;  3TRK A;  1TL9 A;  4OEM A;  1AYW A;  1VJV A;  4CDC B;  3KWB X;  2DCC A;  1YZB A;  1GCB A;  2WBF X;  1K3B B;  2R9F A;  8PCH A;  3P5U A;  1KFX L;  2DC7 A;  4K7C A;  1CTE A;  2VHF A;  2AUX A;  3QJ3 A;  3BCN A;  3ZNH A;  4R3D A;  1NB5 A;  2PBH A;  2HXZ A;  3BY4 A;  4X6J A;  1PIP A;  4FIP A;  2O6X A;  2AIM A;  1AIM A;  4IP3 A;  2FE8 A;  1QXP A;  2HD5 A;  3USV A;  5CHV A;  2DCB A;  4P6E A;  1POP A;  1F2B A;  1PE6 A;  3I3T A;  3MJ5 A;  1MEM A;  3QT4 A;  2YJB A;  4KLB A;  3PRM A;  2AGA A;  3BPF A;  2Y6E A;  1MS6 A;  3WXF A;  1ME4 A;  2FT2 A;  4BQV A;  2H7J A;  1YAL A;  2ATO A;  4G54 A;  2P86 A;  1QOL A;  2AYO A;  3D6S A;  3V6C A;  4I07 A;  3RVW A;  2BDL A;  2GFO A;  2CB5 A;  2R9C A;  3KW9 A;  1NPZ A;  2UZJ A;  4ZUX U;  4RY2 A;  1AYV A;  1Y08 A;  3O1G A;  4X6I A;  5PAD A;  1CPJ A;  2DZY A;  5EGW A;  3LFY A;  3CH3 X;  1KHP A;  4N8W A;  3OIS A;  2XU1 A;  3QSD A;  1EWM A;  9PAP A;  3C0R A;  1MEG A;  3IHP A;  1SP4 B;  3MP2 A;  3O65 A;  3M99 A;  4QRX A;  4BOQ A;  3N3G A;  3RVV A;  3GCB A;  2Y5B A;  4M0W A;  4D8E A;  3PT2 A;  1CJL A;  2PAD A;  1EWO A;  2P7U A;  3KKU A;  3MHS A;  5E6J A;  4OVZ B;  1ATK A;  2J7Q A;  2XU3 A;  1CSB B;  3BWK A;  4YYS A;  3BBA A; 
#chains in the Genus database with same CATH homology
 3BY4 A;  4P16 A;  5KO3 A;  4RKX A;  4IP3 A;  4D8B A;  2FE8 A;  3PHW A;  2BTW A;  4OW0 A;  4WUR A;  3MJ5 A;  3RNV A;  5EZQ A;  3W30 A;  4BOP A;  5JZE A;  3PRM A;  2AGA A;  3PRP A;  4GUA A;  3PHX A;  4RNA A;  4PT5 A;  2BU3 A;  4OVZ A;  4ZTB A;  4A5U A;  4MI7 A;  2JTC A;  2Z84 A;  4BOS A;  3MTV A;  4MM3 B;  4XZX A;  4IUM A;  2UZJ A;  1DKI A;  3W31 A;  3PHU A;  2JRI A;  5EZS A;  4RF1 A;  3IFU A;  4BOZ A;  1PVJ A;  4BOU A;  2HWK A;  3B21 A;  3TMP A;  2J7Q C;  4D8I A;  3C0R A;  3OQC A;  3BB7 A;  2BTW B;  4REZ A;  3TRK A;  3MP2 A;  3O65 A;  4BOQ A;  4HXD B;  3E9S A;  1YZB A;  4M0W A;  4D8E A;  3PT2 A;  3PSE A;  5E6J A;  4OVZ B;  4RF0 A;  2J7Q A;  3ZNH A;  4R3D A;  1UKF A;  2DOS A;  3BBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...