1MEMA

Crystal structure of cathepsin k complexed with a potent vinyl sulfone inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Crystal structure of human cathepsin K complexed with a potent inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1memA00
1ITOA 1JQPA 1K3BB 4I05A 1CV8A 4BPVA 2G8JA 1PADA 2DCBA 6PADA 1NB5A 1PPDA 5JH3A 3N3KA 1ICFA 2DZYA 5PADA 1SNKA 1VSNA 2XU1A 1CB5A 1GMYA 3QJ3A 2XU5A 3OF8A 1KHPA 3H7DA 3MORA 1ME4A 2PREA 2Y5BA 1BGOA 4Q8HA 1EWOA 1QOLA 3PDFA 2DJFB 1PPOA 4Q8GA 1NB3A 2AIMA 4N8WA 1AU0A 1YALA 3MHSA 3U8EA 1U9WA 3QSDA 3H6SA 1F29A 1KXRA 1NPZA 4KLBA 2PADA 4BQVA 1POPA 3MTNA 3KFQA 3IV2A 3AI8A 2DC6A 2GFOA 3F5VA 2E03A 1CTEA 2F7DA 3BOWA 2Y6EA 1TU6A 2B1NA 2PNSA 4X6IA 1PXVA 3BWKA 3KSEA 1U9VA 4YYSA 5JA7A 2FRAA 2XU4A 2E01A 1QDQA 3B79A 4XUIA 3OISA 3HHAA 4N4ZA 3S3RA 4I04A 4P6EA 3CH3X 2DCAA 1CS8A 1PE6A 2BDZA 4YYWA 1SP4B 1AU4A 3OVZA 2YJBA 5FPWA 3KWBX 1MHWA 3PNRA 3GCBA 2NQAA 3HD3A 3M99A 3RVXA 3KX1A 3HHIA 2DCCA 2FTDA 3BPFA 1O0EA 5J94A 1NL6A 4CDFB 2CB5A 1KFUL 2R9CA 1TL9A 4HWYA 3H89A 1AU3A 1AYWA 5CVNB 1BY8A 3NHEA 1AIMA 1NQCA 2G7YA 4PP1A 3P5XA 3N3GA 1CSBB 4MSXA 2FRQA 1MEGA 1IWDA 1AU2A 3IUTA 2P86A 2IPPB 4ZUXU 2HD5A 4P6GA 3IHPA 3OVXA 3O0UA 1TLOA 3WXGA 3DF0A 3E1ZB 4K7CA 3KW9A 2AYOA 1GLOA 1KFXL 1GCBA 2AYNA 1MIRA 2VHFA 1EWPA 3BPMA 3IMAA 2AUXA 4PADA 5EGWA 1F2BA 1EWMA 2JQGR 2NQDB 2YJ2A 4RY2A 1KHQA 7PCKA 3CBJA 4XR7A 1ZCMA 4N79A 1QXPA 4PI3A 1Q6KA 3IOQA 4X6HA 4BSQA 4YVAA 2R9FA 3CH2X 1S4VA 3N4CA 3I06A 3O1GA 1DEUA 4OEMA 2DCDA 4AXLA 3P5WA 2AVWA 4FK5A 8PCHA 2FT2A 3H8BA 4CZWA 4DMXA 3QT4A 5CHVA 2DC8A 4QRGA 3F75A 2FYEA 2PBHA 3K24A 1BQIA 4BS5A 4I07A 1XKGA 1PPPA 3ZUAA 2DC9A 1THEA 3HWNA 3USVA 1U9XA 4CDDB 4YYRA 3C9EA 3KWZA 1AYUA 1VJVA 1DF0A 2NQGA 4AXMA 4YV8A 3LXSA 1QMYA 1X9YA 2B1MA 3MHHA 2YJCA 2G6DA 4FJCA 4DMYA 3I3TA 4G54A 1GECE 2DC7A 1U9QX 4BS6A 3P5UA 1YK8A 2AU1A 3P5VA 2HHNA 4W5BA 1A6RA 3WXEA 1PBHA 1MS6A 5F02A 1U5IA 1MEMA 1ME3A 1ZIVA 1EF7A 2E02A 5CVMA 4QBBA 4FIPA 4PP2E 2VHSA 1CJLA 1BP4A 2ATOA 3V6EA 3H8CA 1CPJA 2NQIA 4QRXA 1M6DA 3ERVA 3K9MA 4QH6A 1NLJA 5A24A 2R6NA 1CQDA 3PBHA 2ACTA 1Y08A 4YYQA 2OZ2A 2CIOA 2BDLA 3KKUA 1F2AA 4MZOA 3RVVA 1STFE 3K8UA 2WBFX 2FQ9A 3RVWA 4W4UA 3V6CA 3CBKA 1CVZA 3WXFA 2O6XA 3D6SA 4CDEB 1PCIA 4OELA 1AYVA 5K16A 5CHTA 2XU3A 2FO5A 4CDCB 2YJ9A 4WA6A 2P7UA 1MDWA 2AS8A 1AECA 4W5CA 2GHUA 2C0YA 2HH5A 2G8EA 5CVOB 2R9OA 1F2CA 3PW3A 3IEJA 2FUDA 4QRVA 2OP3A 2YJ8A 1FH0A 2R9NA 2OULA 1YVBA 1PIPA 4YYUA 2F1GA 1HUCB 2P0RA 1YT7A 3BC3A 1EWLA 2E00A 2JQFR 3BCNA 1ATKA 1PPNA 1YK7A 2DZZA 3OF9A 2HXZA 2AUZA 2R9MA 2IBIA 2H7JA 9PAPA 5EF4A 1Y4HA 4MZSA 4X6JA 3TNXA 2ARYA 4YYVA 2DJGB 3S3QA 3LFYA
chains in the Genus database with same CATH superfamily
1ITOA 1JQPA 1K3BB 4I05A 1CV8A 4BPVA 2G8JA 1PADA 2DCBA 3OQCA 6PADA 1NB5A 4WURA 1PPDA 3O65A 2BTWA 4IP3A 5JH3A 3N3KA 4XZXA 1ICFA 2DZYA 4REZA 5PADA 1SNKA 1VSNA 2XU1A 1CB5A 1GMYA 3QJ3A 2XU5A 3OF8A 1KHPA 3H7DA 3MORA 1ME4A 2J7QC 2PREA 2Y5BA 1BGOA 4Q8HA 1EWOA 1QOLA 3PDFA 2DJFB 1PPOA 4Q8GA 1NB3A 2AIMA 4N8WA 1AU0A 2JRIA 1YALA 3MHSA 4OVZA 1DKIA 3U8EA 1U9WA 5EZQA 3W30A 4MI7A 3QSDA 3H6SA 1F29A 1KXRA 1NPZA 4KLBA 2PADA 2Z84A 4BQVA 1POPA 3MTNA 3KFQA 3IV2A 3AI8A 2DC6A 2GFOA 3F5VA 2E03A 1CTEA 2F7DA 3BOWA 2Y6EA 1TU6A 2B1NA 2PNSA 4X6IA 1PXVA 2BU3A 3BWKA 3KSEA 1U9VA 4YYSA 5JA7A 2FRAA 3MJ5A 2XU4A 2E01A 1QDQA 3B79A 4XUIA 3OISA 3HHAA 4N4ZA 3S3RA 4I04A 5KO3A 4IUMA 4P6EA 3CH3X 2DCAA 1CS8A 1PE6A 2BDZA 4YYWA 1SP4B 1AU4A 3OVZA 2YJBA 5FPWA 4RKXA 3KWBX 1MHWA 3PNRA 3MP2A 4PT5A 3GCBA 2NQAA 3HD3A 3M99A 3RVXA 3KX1A 3HHIA 5EZSA 2DCCA 2FTDA 3BPFA 3E9SA 1O0EA 5J94A 3ZNHA 1NL6A 4CDFB 5JZEA 2CB5A 3W31A 1KFUL 2R9CA 1TL9A 4HWYA 4RF1A 3H89A 1AU3A 1AYWA 5CVNB 1BY8A 3NHEA 1AIMA 1NQCA 2G7YA 4PP1A 3P5XA 3N3GA 4RNAA 4OW0A 1CSBB 4MSXA 2FRQA 1MEGA 1IWDA 1AU2A 3IUTA 4P16A 2P86A 2IPPB 4ZUXU 3B21A 4D8BA 2HD5A 4P6GA 4BOPA 3IHPA 3OVXA 3O0UA 1TLOA 3WXGA 5E6JA 3DF0A 3PRPA 2AGAA 3E1ZB 4K7CA 3KW9A 2AYOA 1GLOA 1KFXL 1GCBA 2AYNA 4MM3B 1MIRA 2VHFA 1EWPA 3BPMA 3IMAA 2AUXA 4PADA 5EGWA 3BY4A 1F2BA 1EWMA 2JQGR 2NQDB 2YJ2A 4RY2A 1KHQA 7PCKA 3CBJA 4XR7A 1ZCMA 4N79A 1QXPA 4PI3A 1Q6KA 3IOQA 4X6HA 4BSQA 4YVAA 2R9FA 3CH2X 1S4VA 3N4CA 3I06A 4A5UA 3O1GA 4ZTBA 1DEUA 4OEMA 4BOSA 2DCDA 1PVJA 3P5WA 4AXLA 2AVWA 4FK5A 8PCHA 2FT2A 3H8BA 3PHWA 2HWKA 4BOQA 4CZWA 3PHUA 4DMXA 3QT4A 5CHVA 2DC8A 4QRGA 3F75A 2FYEA 2PBHA 4HXDB 1YZBA 2BTWB 3K24A 1BQIA 4BS5A 4I07A 4D8IA 1XKGA 1PPPA 3ZUAA 4M0WA 2DC9A 1THEA 2UZJA 3HWNA 3USVA 1U9XA 4CDDB 4YYRA 3TRKA 3C9EA 3KWZA 1AYUA 1VJVA 1DF0A 2NQGA 4GUAA 4AXMA 4YV8A 3LXSA 1QMYA 3C0RA 1X9YA 2B1MA 3MHHA 2YJCA 2G6DA 4FJCA 4DMYA 3I3TA 4G54A 1GECE 2DC7A 1U9QX 3TMPA 4BS6A 3P5UA 3MTVA 1YK8A 2AU1A 3P5VA 2HHNA 4W5BA 1A6RA 4R3DA 3WXEA 1PBHA 1MS6A 5F02A 1U5IA 3PHXA 1MEMA 1ME3A 1ZIVA 1EF7A 2E02A 5CVMA 4QBBA 4FIPA 4PP2E 2VHSA 1CJLA 1BP4A 2ATOA 4RF0A 3V6EA 4D8EA 3H8CA 1CPJA 2NQIA 4QRXA 1M6DA 3ERVA 3K9MA 4QH6A 1NLJA 5A24A 2R6NA 1CQDA 3PBHA 2ACTA 1Y08A 4YYQA 2OZ2A 2CIOA 2BDLA 3KKUA 1F2AA 4MZOA 3RVVA 1STFE 3K8UA 2WBFX 2FQ9A 3RNVA 3RVWA 4W4UA 3V6CA 3CBKA 1CVZA 3WXFA 2DOSA 2O6XA 3D6SA 3PSEA 4CDEB 1PCIA 4OELA 1AYVA 5K16A 3BB7A 5CHTA 2XU3A 2FO5A 4CDCB 2YJ9A 4WA6A 2P7UA 1MDWA 2AS8A 2FE8A 1AECA 4W5CA 2GHUA 2C0YA 2HH5A 2G8EA 5CVOB 2R9OA 1F2CA 3PW3A 3IEJA 2FUDA 4QRVA 2OP3A 2YJ8A 1UKFA 2JTCA 1FH0A 2R9NA 2OULA 1YVBA 1PIPA 3PT2A 4YYUA 2F1GA 1HUCB 2P0RA 1YT7A 3BC3A 1EWLA 2E00A 2JQFR 3BCNA 4OVZB 3PRMA 1ATKA 1PPNA 1YK7A 2DZZA 3BBAA 3OF9A 2HXZA 2AUZA 2R9MA 2IBIA 2H7JA 9PAPA 5EF4A 1Y4HA 3IFUA 4MZSA 4X6JA 2J7QA 4BOUA 3TNXA 2ARYA 4YYVA 2DJGB 3S3QA 3LFYA 4BOZA
chains in the Genus database with same CATH topology
1ITOA 1JQPA 1K3BB 3LTWA 4I05A 1CV8A 4BPVA 2G8JA 1PADA 2DCBA 6PADA 1NB5A 1PPDA 5JH3A 3N3KA 2BSZA 1ICFA 2DZYA 5PADA 1SNKA 1VSNA 2XU1A 1CB5A 1GMYA 3QJ3A 2XU5A 3OF8A 1KHPA 3H7DA 3MORA 4NV7A 1ME4A 2PREA 2Y5BA 1BGOA 4Q8HA 1EWOA 1QOLA 3PDFA 2DJFB 1PPOA 4Q8GA 1NB3A 2AIMA 4N8WA 1AU0A 1YALA 3MHSA 3U8EA 1U9WA 3QSDA 3H6SA 1F29A 1KXRA 1NPZA 4KLBA 2PADA 4BGFA 4BQVA 1POPA 3MTNA 3KFQA 3IV2A 3AI8A 2DC6A 2GFOA 3F5VA 2E03A 1CTEA 2F7DA 3BOWA 2Y6EA 1TU6A 2B1NA 2PNSA 4X6IA 1PXVA 3BWKA 3KSEA 1U9VA 4YYSA 5JA7A 2FRAA 1W6FA 2XU4A 2E01A 1QDQA 3B79A 4XUIA 3OISA 3HHAA 4N4ZA 3S3RA 4I04A 4P6EA 3CH3X 2DCAA 1CS8A 1PE6A 2BDZA 4YYWA 1SP4B 1AU4A 3OVZA 2YJBA 5FPWA 3KWBX 1MHWA 3PNRA 3GCBA 2NQAA 3HD3A 3M99A 3RVXA 3KX1A 3HHIA 2DCCA 2FTDA 3BPFA 1O0EA 5J94A 1NL6A 4CDFB 2CB5A 1KFUL 2R9CA 1TL9A 4HWYA 3H89A 1AU3A 1AYWA 5CVNB 1BY8A 3NHEA 4NV8A 1AIMA 1NQCA 2G7YA 4PP1A 3P5XA 3N3GA 1CSBB 4MSXA 2FRQA 1MEGA 1IWDA 1AU2A 4GUZA 3IUTA 2P86A 2IPPB 4ZUXU 2HD5A 4P6GA 3IHPA 3OVXA 3O0UA 1TLOA 3WXGA 3DF0A 3E1ZB 4K7CA 3KW9A 2AYOA 1GLOA 1KFXL 1GCBA 2AYNA 1MIRA 2VHFA 1EWPA 3BPMA 3IMAA 2AUXA 2VFBA 4PADA 5EGWA 1F2BA 1EWMA 2JQGR 2NQDB 2YJ2A 4RY2A 1KHQA 7PCKA 3CBJA 3D9WA 4XR7A 1ZCMA 4N79A 1QXPA 4PI3A 1Q6KA 3IOQA 4X6HA 4BSQA 4YVAA 2R9FA 3CH2X 1S4VA 3N4CA 3I06A 3O1GA 1DEUA 4OEMA 2DCDA 4AXLA 3P5WA 2AVWA 4FK5A 8PCHA 2FT2A 3H8BA 1W4TA 4CZWA 4DMXA 3QT4A 5CHVA 2DC8A 4QRGA 3F75A 4B55A 2FYEA 2PBHA 3K24A 1BQIA 4BS5A 4I07A 1XKGA 1PPPA 3ZUAA 2DC9A 1THEA 3HWNA 3USVA 1U9XA 4CDDB 4YYRA 3C9EA 3KWZA 1AYUA 1VJVA 1DF0A 2NQGA 4AXMA 4YV8A 3LXSA 1QMYA 1X9YA 2B1MA 3MHHA 2YJCA 1E2TA 2G6DA 4FJCA 4DMYA 3I3TA 4G54A 1GECE 2DC7A 1U9QX 4BS6A 3P5UA 1YK8A 2AU1A 3P5VA 2HHNA 4W5BA 1A6RA 3WXEA 1PBHA 1MS6A 5F02A 1U5IA 4C5PA 1MEMA 1ME3A 1ZIVA 1EF7A 2E02A 5CVMA 4QBBA 4FIPA 4PP2E 2VHSA 1CJLA 1BP4A 2ATOA 3V6EA 3H8CA 1CPJA 2NQIA 4QRXA 1M6DA 3ERVA 3K9MA 4QH6A 1NLJA 5A24A 2R6NA 1CQDA 3PBHA 2ACTA 1Y08A 1W5RA 4YYQA 2OZ2A 2CIOA 2BDLA 3KKUA 2VFCA 1F2AA 4MZOA 3RVVA 1STFE 3K8UA 2WBFX 2FQ9A 3RVWA 4W4UA 3V6CA 3CBKA 1CVZA 3WXFA 2O6XA 3D6SA 4CDEB 1PCIA 4OELA 1AYVA 5K16A 5CHTA 2XU3A 2FO5A 4CDCB 1GX3A 2YJ9A 4WA6A 2P7UA 1MDWA 2AS8A 1AECA 4W5CA 2GHUA 2C0YA 2HH5A 2G8EA 5CVOB 2R9OA 1F2CA 3PW3A 3IEJA 2FUDA 4QRVA 2OP3A 2YJ8A 1FH0A 2R9NA 2OULA 1YVBA 1PIPA 4YYUA 2F1GA 1HUCB 2P0RA 1YT7A 3BC3A 1EWLA 2E00A 2JQFR 3BCNA 1ATKA 1PPNA 1YK7A 2DZZA 3OF9A 2HXZA 2AUZA 2R9MA 2IBIA 2H7JA 9PAPA 5EF4A 1Y4HA 4MZSA 4X6JA 3TNXA 2ARYA 4YYVA 2DJGB 3S3QA 3LFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ITO A;  1JQP A;  1K3B B;  4I05 A;  1CV8 A;  4BPV A;  2G8J A;  1PAD A;  2DCB A;  6PAD A;  1NB5 A;  1PPD A;  5JH3 A;  3N3K A;  1ICF A;  2DZY A;  5PAD A;  1SNK A;  1VSN A;  2XU1 A;  1CB5 A;  1GMY A;  3QJ3 A;  2XU5 A;  3OF8 A;  1KHP A;  3H7D A;  3MOR A;  1ME4 A;  2PRE A;  2Y5B A;  1BGO A;  4Q8H A;  1EWO A;  1QOL A;  3PDF A;  2DJF B;  1PPO A;  4Q8G A;  1NB3 A;  2AIM A;  4N8W A;  1AU0 A;  1YAL A;  3MHS A;  3U8E A;  1U9W A;  3QSD A;  3H6S A;  1F29 A;  1KXR A;  1NPZ A;  4KLB A;  2PAD A;  4BQV A;  1POP A;  3MTN A;  3KFQ A;  3IV2 A;  3AI8 A;  2DC6 A;  2GFO A;  3F5V A;  2E03 A;  1CTE A;  2F7D A;  3BOW A;  2Y6E A;  1TU6 A;  2B1N A;  2PNS A;  4X6I A;  1PXV A;  3BWK A;  3KSE A;  1U9V A;  4YYS A;  5JA7 A;  2FRA A;  2XU4 A;  2E01 A;  1QDQ A;  3B79 A;  4XUI A;  3OIS A;  3HHA A;  4N4Z A;  3S3R A;  4I04 A;  4P6E A;  3CH3 X;  2DCA A;  1CS8 A;  1PE6 A;  2BDZ A;  4YYW A;  1SP4 B;  1AU4 A;  3OVZ A;  2YJB A;  5FPW A;  3KWB X;  1MHW A;  3PNR A;  3GCB A;  2NQA A;  3HD3 A;  3M99 A;  3RVX A;  3KX1 A;  3HHI A;  2DCC A;  2FTD A;  3BPF A;  1O0E A;  5J94 A;  1NL6 A;  4CDF B;  2CB5 A;  1KFU L;  2R9C A;  1TL9 A;  4HWY A;  3H89 A;  1AU3 A;  1AYW A;  5CVN B;  1BY8 A;  3NHE A;  1AIM A;  1NQC A;  2G7Y A;  4PP1 A;  3P5X A;  3N3G A;  1CSB B;  4MSX A;  2FRQ A;  1MEG A;  1IWD A;  1AU2 A;  3IUT A;  2P86 A;  2IPP B;  4ZUX U;  2HD5 A;  4P6G A;  3IHP A;  3OVX A;  3O0U A;  1TLO A;  3WXG A;  3DF0 A;  3E1Z B;  4K7C A;  3KW9 A;  2AYO A;  1GLO A;  1KFX L;  1GCB A;  2AYN A;  1MIR A;  2VHF A;  1EWP A;  3BPM A;  3IMA A;  2AUX A;  4PAD A;  5EGW A;  1F2B A;  1EWM A;  2JQG R;  2NQD B;  2YJ2 A;  4RY2 A;  1KHQ A;  7PCK A;  3CBJ A;  4XR7 A;  1ZCM A;  4N79 A;  1QXP A;  4PI3 A;  1Q6K A;  3IOQ A;  4X6H A;  4BSQ A;  4YVA A;  2R9F A;  3CH2 X;  1S4V A;  3N4C A;  3I06 A;  3O1G A;  1DEU A;  4OEM A;  2DCD A;  4AXL A;  3P5W A;  2AVW A;  4FK5 A;  8PCH A;  2FT2 A;  3H8B A;  4CZW A;  4DMX A;  3QT4 A;  5CHV A;  2DC8 A;  4QRG A;  3F75 A;  2FYE A;  2PBH A;  3K24 A;  1BQI A;  4BS5 A;  4I07 A;  1XKG A;  1PPP A;  3ZUA A;  2DC9 A;  1THE A;  3HWN A;  3USV A;  1U9X A;  4CDD B;  4YYR A;  3C9E A;  3KWZ A;  1AYU A;  1VJV A;  1DF0 A;  2NQG A;  4AXM A;  4YV8 A;  3LXS A;  1QMY A;  1X9Y A;  2B1M A;  3MHH A;  2YJC A;  2G6D A;  4FJC A;  4DMY A;  3I3T A;  4G54 A;  1GEC E;  2DC7 A;  1U9Q X;  4BS6 A;  3P5U A;  1YK8 A;  2AU1 A;  3P5V A;  2HHN A;  4W5B A;  1A6R A;  3WXE A;  1PBH A;  1MS6 A;  5F02 A;  1U5I A;  1MEM A;  1ME3 A;  1ZIV A;  1EF7 A;  2E02 A;  5CVM A;  4QBB A;  4FIP A;  4PP2 E;  2VHS A;  1CJL A;  1BP4 A;  2ATO A;  3V6E A;  3H8C A;  1CPJ A;  2NQI A;  4QRX A;  1M6D A;  3ERV A;  3K9M A;  4QH6 A;  1NLJ A;  5A24 A;  2R6N A;  1CQD A;  3PBH A;  2ACT A;  1Y08 A;  4YYQ A;  2OZ2 A;  2CIO A;  2BDL A;  3KKU A;  1F2A A;  4MZO A;  3RVV A;  1STF E;  3K8U A;  2WBF X;  2FQ9 A;  3RVW A;  4W4U A;  3V6C A;  3CBK A;  1CVZ A;  3WXF A;  2O6X A;  3D6S A;  4CDE B;  1PCI A;  4OEL A;  1AYV A;  5K16 A;  5CHT A;  2XU3 A;  2FO5 A;  4CDC B;  2YJ9 A;  4WA6 A;  2P7U A;  1MDW A;  2AS8 A;  1AEC A;  4W5C A;  2GHU A;  2C0Y A;  2HH5 A;  2G8E A;  5CVO B;  2R9O A;  1F2C A;  3PW3 A;  3IEJ A;  2FUD A;  4QRV A;  2OP3 A;  2YJ8 A;  1FH0 A;  2R9N A;  2OUL A;  1YVB A;  1PIP A;  4YYU A;  2F1G A;  1HUC B;  2P0R A;  1YT7 A;  3BC3 A;  1EWL A;  2E00 A;  2JQF R;  3BCN A;  1ATK A;  1PPN A;  1YK7 A;  2DZZ A;  3OF9 A;  2HXZ A;  2AUZ A;  2R9M A;  2IBI A;  2H7J A;  9PAP A;  5EF4 A;  1Y4H A;  4MZS A;  4X6J A;  3TNX A;  2ARY A;  4YYV A;  2DJG B;  3S3Q A;  3LFY A; 
#chains in the Genus database with same CATH topology
 1ITO A;  1JQP A;  1K3B B;  4I05 A;  1CV8 A;  4BPV A;  2G8J A;  1PAD A;  2DCB A;  3OQC A;  6PAD A;  1NB5 A;  4WUR A;  1PPD A;  3O65 A;  2BTW A;  4IP3 A;  5JH3 A;  3N3K A;  4XZX A;  1ICF A;  2DZY A;  4REZ A;  5PAD A;  1SNK A;  1VSN A;  2XU1 A;  1CB5 A;  1GMY A;  3QJ3 A;  2XU5 A;  3OF8 A;  1KHP A;  3H7D A;  3MOR A;  1ME4 A;  2J7Q C;  2PRE A;  2Y5B A;  1BGO A;  4Q8H A;  1EWO A;  1QOL A;  3PDF A;  2DJF B;  1PPO A;  4Q8G A;  1NB3 A;  2AIM A;  4N8W A;  1AU0 A;  2JRI A;  1YAL A;  3MHS A;  4OVZ A;  1DKI A;  3U8E A;  1U9W A;  5EZQ A;  3W30 A;  4MI7 A;  3QSD A;  3H6S A;  1F29 A;  1KXR A;  1NPZ A;  4KLB A;  2PAD A;  2Z84 A;  4BQV A;  1POP A;  3MTN A;  3KFQ A;  3IV2 A;  3AI8 A;  2DC6 A;  2GFO A;  3F5V A;  2E03 A;  1CTE A;  2F7D A;  3BOW A;  2Y6E A;  1TU6 A;  2B1N A;  2PNS A;  4X6I A;  1PXV A;  2BU3 A;  3BWK A;  3KSE A;  1U9V A;  4YYS A;  5JA7 A;  2FRA A;  3MJ5 A;  2XU4 A;  2E01 A;  1QDQ A;  3B79 A;  4XUI A;  3OIS A;  3HHA A;  4N4Z A;  3S3R A;  4I04 A;  5KO3 A;  4IUM A;  4P6E A;  3CH3 X;  2DCA A;  1CS8 A;  1PE6 A;  2BDZ A;  4YYW A;  1SP4 B;  1AU4 A;  3OVZ A;  2YJB A;  5FPW A;  4RKX A;  3KWB X;  1MHW A;  3PNR A;  3MP2 A;  4PT5 A;  3GCB A;  2NQA A;  3HD3 A;  3M99 A;  3RVX A;  3KX1 A;  3HHI A;  5EZS A;  2DCC A;  2FTD A;  3BPF A;  3E9S A;  1O0E A;  5J94 A;  3ZNH A;  1NL6 A;  4CDF B;  5JZE A;  2CB5 A;  3W31 A;  1KFU L;  2R9C A;  1TL9 A;  4HWY A;  4RF1 A;  3H89 A;  1AU3 A;  1AYW A;  5CVN B;  1BY8 A;  3NHE A;  1AIM A;  1NQC A;  2G7Y A;  4PP1 A;  3P5X A;  3N3G A;  4RNA A;  4OW0 A;  1CSB B;  4MSX A;  2FRQ A;  1MEG A;  1IWD A;  1AU2 A;  3IUT A;  4P16 A;  2P86 A;  2IPP B;  4ZUX U;  3B21 A;  4D8B A;  2HD5 A;  4P6G A;  4BOP A;  3IHP A;  3OVX A;  3O0U A;  1TLO A;  3WXG A;  5E6J A;  3DF0 A;  3PRP A;  2AGA A;  3E1Z B;  4K7C A;  3KW9 A;  2AYO A;  1GLO A;  1KFX L;  1GCB A;  2AYN A;  4MM3 B;  1MIR A;  2VHF A;  1EWP A;  3BPM A;  3IMA A;  2AUX A;  4PAD A;  5EGW A;  3BY4 A;  1F2B A;  1EWM A;  2JQG R;  2NQD B;  2YJ2 A;  4RY2 A;  1KHQ A;  7PCK A;  3CBJ A;  4XR7 A;  1ZCM A;  4N79 A;  1QXP A;  4PI3 A;  1Q6K A;  3IOQ A;  4X6H A;  4BSQ A;  4YVA A;  2R9F A;  3CH2 X;  1S4V A;  3N4C A;  3I06 A;  4A5U A;  3O1G A;  4ZTB A;  1DEU A;  4OEM A;  4BOS A;  2DCD A;  1PVJ A;  3P5W A;  4AXL A;  2AVW A;  4FK5 A;  8PCH A;  2FT2 A;  3H8B A;  3PHW A;  2HWK A;  4BOQ A;  4CZW A;  3PHU A;  4DMX A;  3QT4 A;  5CHV A;  2DC8 A;  4QRG A;  3F75 A;  2FYE A;  2PBH A;  4HXD B;  1YZB A;  2BTW B;  3K24 A;  1BQI A;  4BS5 A;  4I07 A;  4D8I A;  1XKG A;  1PPP A;  3ZUA A;  4M0W A;  2DC9 A;  1THE A;  2UZJ A;  3HWN A;  3USV A;  1U9X A;  4CDD B;  4YYR A;  3TRK A;  3C9E A;  3KWZ A;  1AYU A;  1VJV A;  1DF0 A;  2NQG A;  4GUA A;  4AXM A;  4YV8 A;  3LXS A;  1QMY A;  3C0R A;  1X9Y A;  2B1M A;  3MHH A;  2YJC A;  2G6D A;  4FJC A;  4DMY A;  3I3T A;  4G54 A;  1GEC E;  2DC7 A;  1U9Q X;  3TMP A;  4BS6 A;  3P5U A;  3MTV A;  1YK8 A;  2AU1 A;  3P5V A;  2HHN A;  4W5B A;  1A6R A;  4R3D A;  3WXE A;  1PBH A;  1MS6 A;  5F02 A;  1U5I A;  3PHX A;  1MEM A;  1ME3 A;  1ZIV A;  1EF7 A;  2E02 A;  5CVM A;  4QBB A;  4FIP A;  4PP2 E;  2VHS A;  1CJL A;  1BP4 A;  2ATO A;  4RF0 A;  3V6E A;  4D8E A;  3H8C A;  1CPJ A;  2NQI A;  4QRX A;  1M6D A;  3ERV A;  3K9M A;  4QH6 A;  1NLJ A;  5A24 A;  2R6N A;  1CQD A;  3PBH A;  2ACT A;  1Y08 A;  4YYQ A;  2OZ2 A;  2CIO A;  2BDL A;  3KKU A;  1F2A A;  4MZO A;  3RVV A;  1STF E;  3K8U A;  2WBF X;  2FQ9 A;  3RNV A;  3RVW A;  4W4U A;  3V6C A;  3CBK A;  1CVZ A;  3WXF A;  2DOS A;  2O6X A;  3D6S A;  3PSE A;  4CDE B;  1PCI A;  4OEL A;  1AYV A;  5K16 A;  3BB7 A;  5CHT A;  2XU3 A;  2FO5 A;  4CDC B;  2YJ9 A;  4WA6 A;  2P7U A;  1MDW A;  2AS8 A;  2FE8 A;  1AEC A;  4W5C A;  2GHU A;  2C0Y A;  2HH5 A;  2G8E A;  5CVO B;  2R9O A;  1F2C A;  3PW3 A;  3IEJ A;  2FUD A;  4QRV A;  2OP3 A;  2YJ8 A;  1UKF A;  2JTC A;  1FH0 A;  2R9N A;  2OUL A;  1YVB A;  1PIP A;  3PT2 A;  4YYU A;  2F1G A;  1HUC B;  2P0R A;  1YT7 A;  3BC3 A;  1EWL A;  2E00 A;  2JQF R;  3BCN A;  4OVZ B;  3PRM A;  1ATK A;  1PPN A;  1YK7 A;  2DZZ A;  3BBA A;  3OF9 A;  2HXZ A;  2AUZ A;  2R9M A;  2IBI A;  2H7J A;  9PAP A;  5EF4 A;  1Y4H A;  3IFU A;  4MZS A;  4X6J A;  2J7Q A;  4BOU A;  3TNX A;  2ARY A;  4YYV A;  2DJG B;  3S3Q A;  3LFY A;  4BOZ A; 
#chains in the Genus database with same CATH homology
 1ITO A;  1JQP A;  1K3B B;  3LTW A;  4I05 A;  1CV8 A;  4BPV A;  2G8J A;  1PAD A;  2DCB A;  6PAD A;  1NB5 A;  1PPD A;  5JH3 A;  3N3K A;  2BSZ A;  1ICF A;  2DZY A;  5PAD A;  1SNK A;  1VSN A;  2XU1 A;  1CB5 A;  1GMY A;  3QJ3 A;  2XU5 A;  3OF8 A;  1KHP A;  3H7D A;  3MOR A;  4NV7 A;  1ME4 A;  2PRE A;  2Y5B A;  1BGO A;  4Q8H A;  1EWO A;  1QOL A;  3PDF A;  2DJF B;  1PPO A;  4Q8G A;  1NB3 A;  2AIM A;  4N8W A;  1AU0 A;  1YAL A;  3MHS A;  3U8E A;  1U9W A;  3QSD A;  3H6S A;  1F29 A;  1KXR A;  1NPZ A;  4KLB A;  2PAD A;  4BGF A;  4BQV A;  1POP A;  3MTN A;  3KFQ A;  3IV2 A;  3AI8 A;  2DC6 A;  2GFO A;  3F5V A;  2E03 A;  1CTE A;  2F7D A;  3BOW A;  2Y6E A;  1TU6 A;  2B1N A;  2PNS A;  4X6I A;  1PXV A;  3BWK A;  3KSE A;  1U9V A;  4YYS A;  5JA7 A;  2FRA A;  1W6F A;  2XU4 A;  2E01 A;  1QDQ A;  3B79 A;  4XUI A;  3OIS A;  3HHA A;  4N4Z A;  3S3R A;  4I04 A;  4P6E A;  3CH3 X;  2DCA A;  1CS8 A;  1PE6 A;  2BDZ A;  4YYW A;  1SP4 B;  1AU4 A;  3OVZ A;  2YJB A;  5FPW A;  3KWB X;  1MHW A;  3PNR A;  3GCB A;  2NQA A;  3HD3 A;  3M99 A;  3RVX A;  3KX1 A;  3HHI A;  2DCC A;  2FTD A;  3BPF A;  1O0E A;  5J94 A;  1NL6 A;  4CDF B;  2CB5 A;  1KFU L;  2R9C A;  1TL9 A;  4HWY A;  3H89 A;  1AU3 A;  1AYW A;  5CVN B;  1BY8 A;  3NHE A;  4NV8 A;  1AIM A;  1NQC A;  2G7Y A;  4PP1 A;  3P5X A;  3N3G A;  1CSB B;  4MSX A;  2FRQ A;  1MEG A;  1IWD A;  1AU2 A;  4GUZ A;  3IUT A;  2P86 A;  2IPP B;  4ZUX U;  2HD5 A;  4P6G A;  3IHP A;  3OVX A;  3O0U A;  1TLO A;  3WXG A;  3DF0 A;  3E1Z B;  4K7C A;  3KW9 A;  2AYO A;  1GLO A;  1KFX L;  1GCB A;  2AYN A;  1MIR A;  2VHF A;  1EWP A;  3BPM A;  3IMA A;  2AUX A;  2VFB A;  4PAD A;  5EGW A;  1F2B A;  1EWM A;  2JQG R;  2NQD B;  2YJ2 A;  4RY2 A;  1KHQ A;  7PCK A;  3CBJ A;  3D9W A;  4XR7 A;  1ZCM A;  4N79 A;  1QXP A;  4PI3 A;  1Q6K A;  3IOQ A;  4X6H A;  4BSQ A;  4YVA A;  2R9F A;  3CH2 X;  1S4V A;  3N4C A;  3I06 A;  3O1G A;  1DEU A;  4OEM A;  2DCD A;  4AXL A;  3P5W A;  2AVW A;  4FK5 A;  8PCH A;  2FT2 A;  3H8B A;  1W4T A;  4CZW A;  4DMX A;  3QT4 A;  5CHV A;  2DC8 A;  4QRG A;  3F75 A;  4B55 A;  2FYE A;  2PBH A;  3K24 A;  1BQI A;  4BS5 A;  4I07 A;  1XKG A;  1PPP A;  3ZUA A;  2DC9 A;  1THE A;  3HWN A;  3USV A;  1U9X A;  4CDD B;  4YYR A;  3C9E A;  3KWZ A;  1AYU A;  1VJV A;  1DF0 A;  2NQG A;  4AXM A;  4YV8 A;  3LXS A;  1QMY A;  1X9Y A;  2B1M A;  3MHH A;  2YJC A;  1E2T A;  2G6D A;  4FJC A;  4DMY A;  3I3T A;  4G54 A;  1GEC E;  2DC7 A;  1U9Q X;  4BS6 A;  3P5U A;  1YK8 A;  2AU1 A;  3P5V A;  2HHN A;  4W5B A;  1A6R A;  3WXE A;  1PBH A;  1MS6 A;  5F02 A;  1U5I A;  4C5P A;  1MEM A;  1ME3 A;  1ZIV A;  1EF7 A;  2E02 A;  5CVM A;  4QBB A;  4FIP A;  4PP2 E;  2VHS A;  1CJL A;  1BP4 A;  2ATO A;  3V6E A;  3H8C A;  1CPJ A;  2NQI A;  4QRX A;  1M6D A;  3ERV A;  3K9M A;  4QH6 A;  1NLJ A;  5A24 A;  2R6N A;  1CQD A;  3PBH A;  2ACT A;  1Y08 A;  1W5R A;  4YYQ A;  2OZ2 A;  2CIO A;  2BDL A;  3KKU A;  2VFC A;  1F2A A;  4MZO A;  3RVV A;  1STF E;  3K8U A;  2WBF X;  2FQ9 A;  3RVW A;  4W4U A;  3V6C A;  3CBK A;  1CVZ A;  3WXF A;  2O6X A;  3D6S A;  4CDE B;  1PCI A;  4OEL A;  1AYV A;  5K16 A;  5CHT A;  2XU3 A;  2FO5 A;  4CDC B;  1GX3 A;  2YJ9 A;  4WA6 A;  2P7U A;  1MDW A;  2AS8 A;  1AEC A;  4W5C A;  2GHU A;  2C0Y A;  2HH5 A;  2G8E A;  5CVO B;  2R9O A;  1F2C A;  3PW3 A;  3IEJ A;  2FUD A;  4QRV A;  2OP3 A;  2YJ8 A;  1FH0 A;  2R9N A;  2OUL A;  1YVB A;  1PIP A;  4YYU A;  2F1G A;  1HUC B;  2P0R A;  1YT7 A;  3BC3 A;  1EWL A;  2E00 A;  2JQF R;  3BCN A;  1ATK A;  1PPN A;  1YK7 A;  2DZZ A;  3OF9 A;  2HXZ A;  2AUZ A;  2R9M A;  2IBI A;  2H7J A;  9PAP A;  5EF4 A;  1Y4H A;  4MZS A;  4X6J A;  3TNX A;  2ARY A;  4YYV A;  2DJG B;  3S3Q A;  3LFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...