1MEMA

Crystal structure of cathepsin k complexed with a potent vinyl sulfone inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Crystal structure of human cathepsin K complexed with a potent inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1memA00
4N79A 1QOLA 2NQDB 3CBKA 1PCIA 4QRXA 1CQDA 3N3GA 1PPOA 1YK8A 5PADA 1MIRA 4XR7A 2XU3A 3IUTA 1NL6A 1PPNA 4RY2A 1SP4B 2DC7A 2DZZA 1AIMA 4I05A 1YT7A 2IPPB 4ZUXU 1TL9A 2F7DA 1MEGA 1A6RA 5CVMA 1THEA 1FH0A 3ERVA 3F75A 2DCCA 2DC8A 4HWYA 2YJ9A 3IV2A 2E03A 4MSXA 4CDFB 1PPPA 1CJLA 3I06A 1STFE 1NB3A 7PCKA 1QDQA 4N4ZA 2YJBA 4Q8HA 1CS8A 1CVZA 3H7DA 1GLOA 3BWKA 2AVWA 3BCNA 1AU3A 1AECA 3NHEA 3HHIA 4PI3A 1KFUL 3LXSA 9PAPA 1EWOA 1CPJA 5CVOB 1EWLA 2OULA 4YYSA 4P6EA 4CZWA 3BPMA 1F2CA 8PCHA 1F2BA 1PADA 2YJ2A 5FPWA 3V6CA 4MZSA 2YJCA 2DC9A 1TLOA 2G8EA 1CB5A 3MHHA 2HH5A 1CV8A 2P7UA 3CH2X 4CDDB 1F2AA 3KKUA 1EWMA 3KX1A 2P86A 1CTEA 4QRGA 1U5IA 2R9CA 3H89A 1Y4HA 3RVXA 1ITOA 3OVZA 5EF4A 2AYOA 2VHSA 2DZYA 1JQPA 4K7CA 2G7YA 1S4VA 2H7JA 3P5WA 2R9FA 3S3RA 1XKGA 1ME4A 2FQ9A 5CHTA 1MS6A 1ME3A 4I04A 1Y08A 5EGWA 3S3QA 1POPA 3HHAA 3P5UA 4G54A 5JH3A 2BDLA 3F5VA 1GECE 3HWNA 1K3BB 4I07A 5CVNB 3QT4A 3KFQA 2WBFX 5F02A 2P0RA 3KSEA 4PP1A 1GCBA 4MZOA 3O0UA 1KHPA 2B1NA 3GCBA 3BC3A 1NLJA 4P6GA 5A24A 2Y6EA 3V6EA 2Y5BA 2R9MA 2AU1A 1PXVA 2ARYA 3OF9A 2OZ2A 4KLBA 2FRAA 3K8UA 3H8BA 4DMYA 2VHFA 3LFYA 3PDFA 1KFXL 1PPDA 4DMXA 1F29A 2PNSA 1BY8A 3IEJA 4AXMA 2ACTA 3HD3A 5JA7A 1PIPA 1BP4A 2JQFR 3USVA 4BPVA 6PADA 1SNKA 2DC6A 3IOQA 1MDWA 3QSDA 3BPFA 3B79A 2FYEA 3M99A 2FUDA 4PADA 3N3KA 3MORA 2XU1A 4W5CA 2NQAA 2E01A 3P5XA 1ZIVA 3C9EA 1DF0A 2JQGR 1X9YA 3PBHA 4YYWA 1U9VA 2AS8A 2HD5A 1MHWA 4AXLA 1Q6KA 3P5VA 4FIPA 1YALA 4YYRA 3IMAA 4QH6A 4YV8A 3K24A 3PNRA 4CDEB 4BS5A 4QBBA 1AYVA 2PBHA 3H8CA 2CIOA 3CBJA 2CB5A 1YVBA 2FT2A 3IHPA 1EWPA 1IWDA 2R6NA 2XU5A 3KW9A 2DJGB 2FO5A 2DCBA 3O1GA 4YYUA 1ICFA 4N8WA 3N4CA 1AU2A 2E00A 3E1ZB 3KWBX 4W5BA 2GHUA 3WXGA 1U9XA 1CSBB 4W4UA 4X6IA 4YYQA 1NPZA 1VSNA 2F1GA 3K9MA 1PBHA 4WA6A 2DJFB 1AU4A 1BQIA 1DEUA 4BSQA 2G6DA 2AUZA 3I3TA 3MTNA 1YK7A 1NQCA 3CH3X 1TU6A 2FTDA 5K16A 1ZCMA 2XU4A 3RVVA 1NB5A 2HXZA 5J94A 3WXEA 4OEMA 2G8JA 4XUIA 4X6JA 3RVWA 4OELA 1QMYA 2R9OA 2PREA 1GMYA 3U8EA 3DF0A 3MHSA 1U9WA 2YJ8A 4PP2E 4FK5A 4X6HA 2GFOA 1EF7A 2AUXA 1BGOA 2R9NA 3TNXA 1AYWA 1MEMA 3H6SA 1AU0A 2HHNA 3WXFA 4FJCA 2AYNA 2IBIA 3KWZA 1PE6A 2AIMA 3PW3A 4QRVA 2O6XA 2ATOA 2OP3A 2B1MA 4BS6A 2NQGA 3BOWA 2DCDA 2E02A 1M6DA 1U9QX 3D6SA 1QXPA 3OISA 4CDCB 2NQIA 3OVXA 1ATKA 2PADA 1KXRA 2DCAA 3ZUAA 1AYUA 3AI8A 4Q8GA 1HUCB 2BDZA 1KHQA 4YYVA 3OF8A 4BQVA 3QJ3A 1O0EA 5CHVA 2FRQA 4YVAA 1VJVA 2C0YA
chains in the Genus database with same CATH superfamily
3PRPA 4N79A 1QOLA 2NQDB 3MJ5A 3CBKA 1PCIA 4QRXA 1CQDA 3N3GA 1PPOA 1YK8A 5PADA 1MIRA 4XR7A 2XU3A 3IUTA 1NL6A 1PPNA 4RY2A 1SP4B 2DC7A 2DZZA 1AIMA 4I05A 1YT7A 2IPPB 4ZUXU 1TL9A 2F7DA 1MEGA 1A6RA 5CVMA 1THEA 1FH0A 3ERVA 3F75A 2DCCA 2DC8A 4HWYA 2YJ9A 3IV2A 2E03A 3PHUA 4MSXA 4CDFB 1PPPA 1CJLA 3I06A 1STFE 2BTWA 1NB3A 7PCKA 1QDQA 4N4ZA 2YJBA 4Q8HA 1CS8A 1CVZA 3H7DA 1GLOA 2DOSA 4RF1A 3BWKA 2AVWA 3BCNA 1AU3A 1AECA 3MTVA 3PHXA 3NHEA 3HHIA 4PI3A 1KFUL 3LXSA 9PAPA 1EWOA 1CPJA 5CVOB 1EWLA 2OULA 4PT5A 4YYSA 4P6EA 4CZWA 3BPMA 1F2CA 3RNVA 8PCHA 1F2BA 1PADA 2YJ2A 5FPWA 3V6CA 4MZSA 2YJCA 2DC9A 1TLOA 2G8EA 3E9SA 1CB5A 3MHHA 3TRKA 2HH5A 1CV8A 2P7UA 4RNAA 3CH2X 4CDDB 1F2AA 3KKUA 1EWMA 3KX1A 2P86A 1CTEA 4QRGA 2FE8A 1U5IA 2R9CA 3H89A 1Y4HA 3RVXA 1ITOA 3OVZA 5EF4A 2AYOA 2VHSA 3ZNHA 2DZYA 1JQPA 3IFUA 4K7CA 5EZQA 2G7YA 1S4VA 2H7JA 3P5WA 2R9FA 3S3RA 4D8EA 1XKGA 1ME4A 2FQ9A 5CHTA 4D8IA 1MS6A 1ME3A 4I04A 3O65A 1Y08A 5EGWA 3S3QA 1POPA 3HHAA 3P5UA 4G54A 5JH3A 2HWKA 2BDLA 3F5VA 1GECE 3HWNA 5EZSA 1K3BB 4BOUA 4I07A 4IP3A 5CVNB 3W30A 3QT4A 3KFQA 2WBFX 3PSEA 5F02A 2P0RA 1DKIA 3KSEA 4PP1A 1GCBA 4MZOA 3O0UA 1KHPA 2B1NA 3GCBA 3BC3A 4RF0A 1NLJA 4P6GA 5A24A 3PRMA 2Y6EA 3V6EA 2Y5BA 2R9MA 2AU1A 1PXVA 2ARYA 3OF9A 3TMPA 2OZ2A 4KLBA 2FRAA 3K8UA 3H8BA 2J7QA 4DMYA 2BU3A 2VHFA 3LFYA 4R3DA 3PDFA 1KFXL 1PPDA 4DMXA 1F29A 2PNSA 1BY8A 3IEJA 4AXMA 4OVZB 2ACTA 3HD3A 5JA7A 4BOQA 1PIPA 1BP4A 2JQFR 3USVA 4BPVA 6PADA 1SNKA 2DC6A 3IOQA 1MDWA 3QSDA 3BPFA 3B79A 2FYEA 3M99A 3OQCA 2FUDA 4PADA 3N3KA 3MP2A 3MORA 2XU1A 4GUAA 4W5CA 2NQAA 2E01A 3P5XA 1ZIVA 3C9EA 1DF0A 2JQGR 1X9YA 3PBHA 4YYWA 1U9VA 2AS8A 3BB7A 2HD5A 1MHWA 4AXLA 1Q6KA 3P5VA 4FIPA 1YALA 4YYRA 3IMAA 4QH6A 4YV8A 3K24A 3PNRA 4CDEB 4BS5A 4QBBA 1AYVA 2PBHA 4ZTBA 2JTCA 3H8CA 2CIOA 3CBJA 2CB5A 1YVBA 2FT2A 3IHPA 1EWPA 4BOSA 1IWDA 2R6NA 4OW0A 2XU5A 3KW9A 2DJGB 2FO5A 2DCBA 3O1GA 4YYUA 1ICFA 4N8WA 3N4CA 1AU2A 2BTWB 5JZEA 3B21A 4D8BA 2E00A 3E1ZB 3KWBX 4W5BA 2GHUA 3WXGA 1U9XA 1CSBB 2AGAA 4MI7A 4W4UA 4X6IA 4YYQA 1NPZA 1VSNA 2F1GA 3K9MA 1YZBA 1PBHA 4WA6A 4HXDB 2DJFB 5E6JA 1AU4A 1BQIA 1DEUA 3BBAA 4IUMA 3W31A 4BSQA 2G6DA 2AUZA 3I3TA 3MTNA 1YK7A 1NQCA 3CH3X 1TU6A 2FTDA 3C0RA 5K16A 4P16A 1ZCMA 2XU4A 3RVVA 1NB5A 2HXZA 5J94A 3WXEA 4OEMA 2G8JA 4XUIA 4MM3B 4X6JA 3RVWA 4OELA 1QMYA 2R9OA 2PREA 1GMYA 3U8EA 3DF0A 3MHSA 1U9WA 2YJ8A 4PP2E 4FK5A 1PVJA 4X6HA 2GFOA 1EF7A 2AUXA 4RKXA 1BGOA 2R9NA 4XZXA 2UZJA 3TNXA 1AYWA 1MEMA 4BOZA 3H6SA 1AU0A 2HHNA 3WXFA 4FJCA 2AYNA 2IBIA 3KWZA 1PE6A 4M0WA 2AIMA 3PW3A 4QRVA 2O6XA 2ATOA 2J7QC 2OP3A 2B1MA 4BS6A 2JRIA 2NQGA 3BOWA 3BY4A 2DCDA 2E02A 1M6DA 1U9QX 3D6SA 1QXPA 3OISA 4CDCB 2NQIA 4OVZA 3OVXA 4WURA 1ATKA 4REZA 2PADA 2Z84A 5KO3A 4BOPA 1KXRA 2DCAA 3ZUAA 1AYUA 3AI8A 3PHWA 4Q8GA 1HUCB 2BDZA 1KHQA 4YYVA 3OF8A 4BQVA 3QJ3A 3PT2A 1O0EA 5CHVA 2FRQA 4YVAA 1VJVA 4A5UA 2C0YA 1UKFA
chains in the Genus database with same CATH topology
4N79A 1QOLA 2NQDB 3CBKA 1PCIA 4QRXA 1CQDA 3N3GA 1PPOA 1YK8A 5PADA 1W6FA 1MIRA 4B55A 4XR7A 2XU3A 3IUTA 1NL6A 1PPNA 4RY2A 1SP4B 2DC7A 2DZZA 1GX3A 1AIMA 4I05A 1YT7A 2IPPB 4ZUXU 1TL9A 2F7DA 1MEGA 1A6RA 5CVMA 1THEA 1FH0A 3ERVA 3F75A 2DCCA 2DC8A 4HWYA 2YJ9A 3IV2A 2E03A 4MSXA 4CDFB 1PPPA 1CJLA 3I06A 1STFE 1NB3A 7PCKA 1QDQA 4N4ZA 2YJBA 4Q8HA 1CS8A 1CVZA 3H7DA 1GLOA 3BWKA 2AVWA 3BCNA 4NV8A 1AU3A 1AECA 3NHEA 3HHIA 4PI3A 1KFUL 3LXSA 9PAPA 1EWOA 1CPJA 2VFBA 5CVOB 1EWLA 2OULA 4YYSA 4P6EA 4CZWA 3BPMA 1F2CA 8PCHA 1F2BA 1PADA 2YJ2A 5FPWA 3V6CA 4MZSA 2YJCA 2DC9A 1TLOA 2G8EA 1CB5A 3MHHA 2HH5A 1CV8A 2P7UA 3CH2X 4CDDB 1F2AA 3KKUA 1EWMA 3KX1A 2P86A 1CTEA 4QRGA 1U5IA 2R9CA 3H89A 1Y4HA 3RVXA 1ITOA 3OVZA 5EF4A 2AYOA 2VHSA 2DZYA 1JQPA 4K7CA 2G7YA 1S4VA 2H7JA 3P5WA 2R9FA 3S3RA 1XKGA 1ME4A 2FQ9A 5CHTA 1MS6A 1ME3A 4I04A 1Y08A 5EGWA 3S3QA 1POPA 3HHAA 3P5UA 4G54A 5JH3A 2BDLA 3F5VA 1GECE 3HWNA 4NV7A 1K3BB 4I07A 5CVNB 3QT4A 3KFQA 2WBFX 5F02A 2P0RA 3KSEA 4PP1A 1GCBA 4MZOA 3O0UA 1KHPA 2B1NA 3GCBA 3BC3A 1NLJA 4P6GA 1W4TA 5A24A 2Y6EA 3V6EA 2Y5BA 2R9MA 2AU1A 1PXVA 2ARYA 3OF9A 2OZ2A 4KLBA 2FRAA 3K8UA 3H8BA 4DMYA 2VHFA 3LFYA 3PDFA 4GUZA 1KFXL 1PPDA 4DMXA 1F29A 2PNSA 1BY8A 3IEJA 4AXMA 2ACTA 3D9WA 3HD3A 5JA7A 1PIPA 1BP4A 2JQFR 3USVA 4BPVA 6PADA 1SNKA 2DC6A 3IOQA 1MDWA 3QSDA 3BPFA 3B79A 2FYEA 3M99A 2FUDA 4PADA 3N3KA 3MORA 2XU1A 4W5CA 2NQAA 2E01A 3P5XA 1ZIVA 3C9EA 1DF0A 2JQGR 1X9YA 3PBHA 4YYWA 1U9VA 2AS8A 2HD5A 1MHWA 4AXLA 1Q6KA 3P5VA 4FIPA 1YALA 4YYRA 3IMAA 4QH6A 4YV8A 3K24A 3PNRA 4CDEB 4BS5A 4QBBA 1AYVA 2PBHA 3H8CA 2CIOA 3CBJA 2CB5A 1YVBA 2FT2A 3IHPA 1E2TA 1EWPA 1IWDA 2R6NA 2XU5A 3KW9A 2DJGB 2FO5A 2DCBA 3O1GA 4YYUA 1ICFA 4N8WA 3N4CA 1AU2A 2E00A 3E1ZB 3KWBX 4W5BA 2GHUA 3WXGA 1U9XA 1CSBB 4C5PA 4W4UA 4X6IA 3LTWA 4YYQA 1NPZA 1VSNA 2F1GA 3K9MA 1PBHA 4WA6A 2DJFB 1AU4A 1BQIA 1DEUA 4BGFA 4BSQA 2G6DA 2AUZA 3I3TA 3MTNA 1YK7A 1NQCA 2VFCA 3CH3X 1TU6A 2FTDA 5K16A 2BSZA 1ZCMA 2XU4A 3RVVA 1NB5A 2HXZA 5J94A 3WXEA 4OEMA 2G8JA 4XUIA 4X6JA 3RVWA 4OELA 1QMYA 2R9OA 2PREA 1GMYA 3U8EA 3DF0A 3MHSA 1U9WA 2YJ8A 4PP2E 4FK5A 4X6HA 2GFOA 1EF7A 2AUXA 1BGOA 2R9NA 3TNXA 1AYWA 1MEMA 3H6SA 1AU0A 2HHNA 3WXFA 4FJCA 2AYNA 2IBIA 3KWZA 1PE6A 2AIMA 3PW3A 4QRVA 2O6XA 2ATOA 2OP3A 2B1MA 4BS6A 2NQGA 3BOWA 2DCDA 2E02A 1M6DA 1U9QX 3D6SA 1QXPA 3OISA 4CDCB 2NQIA 3OVXA 1ATKA 2PADA 1W5RA 1KXRA 2DCAA 3ZUAA 1AYUA 3AI8A 4Q8GA 1HUCB 2BDZA 1KHQA 4YYVA 3OF8A 4BQVA 3QJ3A 1O0EA 5CHVA 2FRQA 4YVAA 1VJVA 2C0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N79 A;  1QOL A;  2NQD B;  3CBK A;  1PCI A;  4QRX A;  1CQD A;  3N3G A;  1PPO A;  1YK8 A;  5PAD A;  1MIR A;  4XR7 A;  2XU3 A;  3IUT A;  1NL6 A;  1PPN A;  4RY2 A;  1SP4 B;  2DC7 A;  2DZZ A;  1AIM A;  4I05 A;  1YT7 A;  2IPP B;  4ZUX U;  1TL9 A;  2F7D A;  1MEG A;  1A6R A;  5CVM A;  1THE A;  1FH0 A;  3ERV A;  3F75 A;  2DCC A;  2DC8 A;  4HWY A;  2YJ9 A;  3IV2 A;  2E03 A;  4MSX A;  4CDF B;  1PPP A;  1CJL A;  3I06 A;  1STF E;  1NB3 A;  7PCK A;  1QDQ A;  4N4Z A;  2YJB A;  4Q8H A;  1CS8 A;  1CVZ A;  3H7D A;  1GLO A;  3BWK A;  2AVW A;  3BCN A;  1AU3 A;  1AEC A;  3NHE A;  3HHI A;  4PI3 A;  1KFU L;  3LXS A;  9PAP A;  1EWO A;  1CPJ A;  5CVO B;  1EWL A;  2OUL A;  4YYS A;  4P6E A;  4CZW A;  3BPM A;  1F2C A;  8PCH A;  1F2B A;  1PAD A;  2YJ2 A;  5FPW A;  3V6C A;  4MZS A;  2YJC A;  2DC9 A;  1TLO A;  2G8E A;  1CB5 A;  3MHH A;  2HH5 A;  1CV8 A;  2P7U A;  3CH2 X;  4CDD B;  1F2A A;  3KKU A;  1EWM A;  3KX1 A;  2P86 A;  1CTE A;  4QRG A;  1U5I A;  2R9C A;  3H89 A;  1Y4H A;  3RVX A;  1ITO A;  3OVZ A;  5EF4 A;  2AYO A;  2VHS A;  2DZY A;  1JQP A;  4K7C A;  2G7Y A;  1S4V A;  2H7J A;  3P5W A;  2R9F A;  3S3R A;  1XKG A;  1ME4 A;  2FQ9 A;  5CHT A;  1MS6 A;  1ME3 A;  4I04 A;  1Y08 A;  5EGW A;  3S3Q A;  1POP A;  3HHA A;  3P5U A;  4G54 A;  5JH3 A;  2BDL A;  3F5V A;  1GEC E;  3HWN A;  1K3B B;  4I07 A;  5CVN B;  3QT4 A;  3KFQ A;  2WBF X;  5F02 A;  2P0R A;  3KSE A;  4PP1 A;  1GCB A;  4MZO A;  3O0U A;  1KHP A;  2B1N A;  3GCB A;  3BC3 A;  1NLJ A;  4P6G A;  5A24 A;  2Y6E A;  3V6E A;  2Y5B A;  2R9M A;  2AU1 A;  1PXV A;  2ARY A;  3OF9 A;  2OZ2 A;  4KLB A;  2FRA A;  3K8U A;  3H8B A;  4DMY A;  2VHF A;  3LFY A;  3PDF A;  1KFX L;  1PPD A;  4DMX A;  1F29 A;  2PNS A;  1BY8 A;  3IEJ A;  4AXM A;  2ACT A;  3HD3 A;  5JA7 A;  1PIP A;  1BP4 A;  2JQF R;  3USV A;  4BPV A;  6PAD A;  1SNK A;  2DC6 A;  3IOQ A;  1MDW A;  3QSD A;  3BPF A;  3B79 A;  2FYE A;  3M99 A;  2FUD A;  4PAD A;  3N3K A;  3MOR A;  2XU1 A;  4W5C A;  2NQA A;  2E01 A;  3P5X A;  1ZIV A;  3C9E A;  1DF0 A;  2JQG R;  1X9Y A;  3PBH A;  4YYW A;  1U9V A;  2AS8 A;  2HD5 A;  1MHW A;  4AXL A;  1Q6K A;  3P5V A;  4FIP A;  1YAL A;  4YYR A;  3IMA A;  4QH6 A;  4YV8 A;  3K24 A;  3PNR A;  4CDE B;  4BS5 A;  4QBB A;  1AYV A;  2PBH A;  3H8C A;  2CIO A;  3CBJ A;  2CB5 A;  1YVB A;  2FT2 A;  3IHP A;  1EWP A;  1IWD A;  2R6N A;  2XU5 A;  3KW9 A;  2DJG B;  2FO5 A;  2DCB A;  3O1G A;  4YYU A;  1ICF A;  4N8W A;  3N4C A;  1AU2 A;  2E00 A;  3E1Z B;  3KWB X;  4W5B A;  2GHU A;  3WXG A;  1U9X A;  1CSB B;  4W4U A;  4X6I A;  4YYQ A;  1NPZ A;  1VSN A;  2F1G A;  3K9M A;  1PBH A;  4WA6 A;  2DJF B;  1AU4 A;  1BQI A;  1DEU A;  4BSQ A;  2G6D A;  2AUZ A;  3I3T A;  3MTN A;  1YK7 A;  1NQC A;  3CH3 X;  1TU6 A;  2FTD A;  5K16 A;  1ZCM A;  2XU4 A;  3RVV A;  1NB5 A;  2HXZ A;  5J94 A;  3WXE A;  4OEM A;  2G8J A;  4XUI A;  4X6J A;  3RVW A;  4OEL A;  1QMY A;  2R9O A;  2PRE A;  1GMY A;  3U8E A;  3DF0 A;  3MHS A;  1U9W A;  2YJ8 A;  4PP2 E;  4FK5 A;  4X6H A;  2GFO A;  1EF7 A;  2AUX A;  1BGO A;  2R9N A;  3TNX A;  1AYW A;  1MEM A;  3H6S A;  1AU0 A;  2HHN A;  3WXF A;  4FJC A;  2AYN A;  2IBI A;  3KWZ A;  1PE6 A;  2AIM A;  3PW3 A;  4QRV A;  2O6X A;  2ATO A;  2OP3 A;  2B1M A;  4BS6 A;  2NQG A;  3BOW A;  2DCD A;  2E02 A;  1M6D A;  1U9Q X;  3D6S A;  1QXP A;  3OIS A;  4CDC B;  2NQI A;  3OVX A;  1ATK A;  2PAD A;  1KXR A;  2DCA A;  3ZUA A;  1AYU A;  3AI8 A;  4Q8G A;  1HUC B;  2BDZ A;  1KHQ A;  4YYV A;  3OF8 A;  4BQV A;  3QJ3 A;  1O0E A;  5CHV A;  2FRQ A;  4YVA A;  1VJV A;  2C0Y A; 
#chains in the Genus database with same CATH topology
 3PRP A;  4N79 A;  1QOL A;  2NQD B;  3MJ5 A;  3CBK A;  1PCI A;  4QRX A;  1CQD A;  3N3G A;  1PPO A;  1YK8 A;  5PAD A;  1MIR A;  4XR7 A;  2XU3 A;  3IUT A;  1NL6 A;  1PPN A;  4RY2 A;  1SP4 B;  2DC7 A;  2DZZ A;  1AIM A;  4I05 A;  1YT7 A;  2IPP B;  4ZUX U;  1TL9 A;  2F7D A;  1MEG A;  1A6R A;  5CVM A;  1THE A;  1FH0 A;  3ERV A;  3F75 A;  2DCC A;  2DC8 A;  4HWY A;  2YJ9 A;  3IV2 A;  2E03 A;  3PHU A;  4MSX A;  4CDF B;  1PPP A;  1CJL A;  3I06 A;  1STF E;  2BTW A;  1NB3 A;  7PCK A;  1QDQ A;  4N4Z A;  2YJB A;  4Q8H A;  1CS8 A;  1CVZ A;  3H7D A;  1GLO A;  2DOS A;  4RF1 A;  3BWK A;  2AVW A;  3BCN A;  1AU3 A;  1AEC A;  3MTV A;  3PHX A;  3NHE A;  3HHI A;  4PI3 A;  1KFU L;  3LXS A;  9PAP A;  1EWO A;  1CPJ A;  5CVO B;  1EWL A;  2OUL A;  4PT5 A;  4YYS A;  4P6E A;  4CZW A;  3BPM A;  1F2C A;  3RNV A;  8PCH A;  1F2B A;  1PAD A;  2YJ2 A;  5FPW A;  3V6C A;  4MZS A;  2YJC A;  2DC9 A;  1TLO A;  2G8E A;  3E9S A;  1CB5 A;  3MHH A;  3TRK A;  2HH5 A;  1CV8 A;  2P7U A;  4RNA A;  3CH2 X;  4CDD B;  1F2A A;  3KKU A;  1EWM A;  3KX1 A;  2P86 A;  1CTE A;  4QRG A;  2FE8 A;  1U5I A;  2R9C A;  3H89 A;  1Y4H A;  3RVX A;  1ITO A;  3OVZ A;  5EF4 A;  2AYO A;  2VHS A;  3ZNH A;  2DZY A;  1JQP A;  3IFU A;  4K7C A;  5EZQ A;  2G7Y A;  1S4V A;  2H7J A;  3P5W A;  2R9F A;  3S3R A;  4D8E A;  1XKG A;  1ME4 A;  2FQ9 A;  5CHT A;  4D8I A;  1MS6 A;  1ME3 A;  4I04 A;  3O65 A;  1Y08 A;  5EGW A;  3S3Q A;  1POP A;  3HHA A;  3P5U A;  4G54 A;  5JH3 A;  2HWK A;  2BDL A;  3F5V A;  1GEC E;  3HWN A;  5EZS A;  1K3B B;  4BOU A;  4I07 A;  4IP3 A;  5CVN B;  3W30 A;  3QT4 A;  3KFQ A;  2WBF X;  3PSE A;  5F02 A;  2P0R A;  1DKI A;  3KSE A;  4PP1 A;  1GCB A;  4MZO A;  3O0U A;  1KHP A;  2B1N A;  3GCB A;  3BC3 A;  4RF0 A;  1NLJ A;  4P6G A;  5A24 A;  3PRM A;  2Y6E A;  3V6E A;  2Y5B A;  2R9M A;  2AU1 A;  1PXV A;  2ARY A;  3OF9 A;  3TMP A;  2OZ2 A;  4KLB A;  2FRA A;  3K8U A;  3H8B A;  2J7Q A;  4DMY A;  2BU3 A;  2VHF A;  3LFY A;  4R3D A;  3PDF A;  1KFX L;  1PPD A;  4DMX A;  1F29 A;  2PNS A;  1BY8 A;  3IEJ A;  4AXM A;  4OVZ B;  2ACT A;  3HD3 A;  5JA7 A;  4BOQ A;  1PIP A;  1BP4 A;  2JQF R;  3USV A;  4BPV A;  6PAD A;  1SNK A;  2DC6 A;  3IOQ A;  1MDW A;  3QSD A;  3BPF A;  3B79 A;  2FYE A;  3M99 A;  3OQC A;  2FUD A;  4PAD A;  3N3K A;  3MP2 A;  3MOR A;  2XU1 A;  4GUA A;  4W5C A;  2NQA A;  2E01 A;  3P5X A;  1ZIV A;  3C9E A;  1DF0 A;  2JQG R;  1X9Y A;  3PBH A;  4YYW A;  1U9V A;  2AS8 A;  3BB7 A;  2HD5 A;  1MHW A;  4AXL A;  1Q6K A;  3P5V A;  4FIP A;  1YAL A;  4YYR A;  3IMA A;  4QH6 A;  4YV8 A;  3K24 A;  3PNR A;  4CDE B;  4BS5 A;  4QBB A;  1AYV A;  2PBH A;  4ZTB A;  2JTC A;  3H8C A;  2CIO A;  3CBJ A;  2CB5 A;  1YVB A;  2FT2 A;  3IHP A;  1EWP A;  4BOS A;  1IWD A;  2R6N A;  4OW0 A;  2XU5 A;  3KW9 A;  2DJG B;  2FO5 A;  2DCB A;  3O1G A;  4YYU A;  1ICF A;  4N8W A;  3N4C A;  1AU2 A;  2BTW B;  5JZE A;  3B21 A;  4D8B A;  2E00 A;  3E1Z B;  3KWB X;  4W5B A;  2GHU A;  3WXG A;  1U9X A;  1CSB B;  2AGA A;  4MI7 A;  4W4U A;  4X6I A;  4YYQ A;  1NPZ A;  1VSN A;  2F1G A;  3K9M A;  1YZB A;  1PBH A;  4WA6 A;  4HXD B;  2DJF B;  5E6J A;  1AU4 A;  1BQI A;  1DEU A;  3BBA A;  4IUM A;  3W31 A;  4BSQ A;  2G6D A;  2AUZ A;  3I3T A;  3MTN A;  1YK7 A;  1NQC A;  3CH3 X;  1TU6 A;  2FTD A;  3C0R A;  5K16 A;  4P16 A;  1ZCM A;  2XU4 A;  3RVV A;  1NB5 A;  2HXZ A;  5J94 A;  3WXE A;  4OEM A;  2G8J A;  4XUI A;  4MM3 B;  4X6J A;  3RVW A;  4OEL A;  1QMY A;  2R9O A;  2PRE A;  1GMY A;  3U8E A;  3DF0 A;  3MHS A;  1U9W A;  2YJ8 A;  4PP2 E;  4FK5 A;  1PVJ A;  4X6H A;  2GFO A;  1EF7 A;  2AUX A;  4RKX A;  1BGO A;  2R9N A;  4XZX A;  2UZJ A;  3TNX A;  1AYW A;  1MEM A;  4BOZ A;  3H6S A;  1AU0 A;  2HHN A;  3WXF A;  4FJC A;  2AYN A;  2IBI A;  3KWZ A;  1PE6 A;  4M0W A;  2AIM A;  3PW3 A;  4QRV A;  2O6X A;  2ATO A;  2J7Q C;  2OP3 A;  2B1M A;  4BS6 A;  2JRI A;  2NQG A;  3BOW A;  3BY4 A;  2DCD A;  2E02 A;  1M6D A;  1U9Q X;  3D6S A;  1QXP A;  3OIS A;  4CDC B;  2NQI A;  4OVZ A;  3OVX A;  4WUR A;  1ATK A;  4REZ A;  2PAD A;  2Z84 A;  5KO3 A;  4BOP A;  1KXR A;  2DCA A;  3ZUA A;  1AYU A;  3AI8 A;  3PHW A;  4Q8G A;  1HUC B;  2BDZ A;  1KHQ A;  4YYV A;  3OF8 A;  4BQV A;  3QJ3 A;  3PT2 A;  1O0E A;  5CHV A;  2FRQ A;  4YVA A;  1VJV A;  4A5U A;  2C0Y A;  1UKF A; 
#chains in the Genus database with same CATH homology
 4N79 A;  1QOL A;  2NQD B;  3CBK A;  1PCI A;  4QRX A;  1CQD A;  3N3G A;  1PPO A;  1YK8 A;  5PAD A;  1W6F A;  1MIR A;  4B55 A;  4XR7 A;  2XU3 A;  3IUT A;  1NL6 A;  1PPN A;  4RY2 A;  1SP4 B;  2DC7 A;  2DZZ A;  1GX3 A;  1AIM A;  4I05 A;  1YT7 A;  2IPP B;  4ZUX U;  1TL9 A;  2F7D A;  1MEG A;  1A6R A;  5CVM A;  1THE A;  1FH0 A;  3ERV A;  3F75 A;  2DCC A;  2DC8 A;  4HWY A;  2YJ9 A;  3IV2 A;  2E03 A;  4MSX A;  4CDF B;  1PPP A;  1CJL A;  3I06 A;  1STF E;  1NB3 A;  7PCK A;  1QDQ A;  4N4Z A;  2YJB A;  4Q8H A;  1CS8 A;  1CVZ A;  3H7D A;  1GLO A;  3BWK A;  2AVW A;  3BCN A;  4NV8 A;  1AU3 A;  1AEC A;  3NHE A;  3HHI A;  4PI3 A;  1KFU L;  3LXS A;  9PAP A;  1EWO A;  1CPJ A;  2VFB A;  5CVO B;  1EWL A;  2OUL A;  4YYS A;  4P6E A;  4CZW A;  3BPM A;  1F2C A;  8PCH A;  1F2B A;  1PAD A;  2YJ2 A;  5FPW A;  3V6C A;  4MZS A;  2YJC A;  2DC9 A;  1TLO A;  2G8E A;  1CB5 A;  3MHH A;  2HH5 A;  1CV8 A;  2P7U A;  3CH2 X;  4CDD B;  1F2A A;  3KKU A;  1EWM A;  3KX1 A;  2P86 A;  1CTE A;  4QRG A;  1U5I A;  2R9C A;  3H89 A;  1Y4H A;  3RVX A;  1ITO A;  3OVZ A;  5EF4 A;  2AYO A;  2VHS A;  2DZY A;  1JQP A;  4K7C A;  2G7Y A;  1S4V A;  2H7J A;  3P5W A;  2R9F A;  3S3R A;  1XKG A;  1ME4 A;  2FQ9 A;  5CHT A;  1MS6 A;  1ME3 A;  4I04 A;  1Y08 A;  5EGW A;  3S3Q A;  1POP A;  3HHA A;  3P5U A;  4G54 A;  5JH3 A;  2BDL A;  3F5V A;  1GEC E;  3HWN A;  4NV7 A;  1K3B B;  4I07 A;  5CVN B;  3QT4 A;  3KFQ A;  2WBF X;  5F02 A;  2P0R A;  3KSE A;  4PP1 A;  1GCB A;  4MZO A;  3O0U A;  1KHP A;  2B1N A;  3GCB A;  3BC3 A;  1NLJ A;  4P6G A;  1W4T A;  5A24 A;  2Y6E A;  3V6E A;  2Y5B A;  2R9M A;  2AU1 A;  1PXV A;  2ARY A;  3OF9 A;  2OZ2 A;  4KLB A;  2FRA A;  3K8U A;  3H8B A;  4DMY A;  2VHF A;  3LFY A;  3PDF A;  4GUZ A;  1KFX L;  1PPD A;  4DMX A;  1F29 A;  2PNS A;  1BY8 A;  3IEJ A;  4AXM A;  2ACT A;  3D9W A;  3HD3 A;  5JA7 A;  1PIP A;  1BP4 A;  2JQF R;  3USV A;  4BPV A;  6PAD A;  1SNK A;  2DC6 A;  3IOQ A;  1MDW A;  3QSD A;  3BPF A;  3B79 A;  2FYE A;  3M99 A;  2FUD A;  4PAD A;  3N3K A;  3MOR A;  2XU1 A;  4W5C A;  2NQA A;  2E01 A;  3P5X A;  1ZIV A;  3C9E A;  1DF0 A;  2JQG R;  1X9Y A;  3PBH A;  4YYW A;  1U9V A;  2AS8 A;  2HD5 A;  1MHW A;  4AXL A;  1Q6K A;  3P5V A;  4FIP A;  1YAL A;  4YYR A;  3IMA A;  4QH6 A;  4YV8 A;  3K24 A;  3PNR A;  4CDE B;  4BS5 A;  4QBB A;  1AYV A;  2PBH A;  3H8C A;  2CIO A;  3CBJ A;  2CB5 A;  1YVB A;  2FT2 A;  3IHP A;  1E2T A;  1EWP A;  1IWD A;  2R6N A;  2XU5 A;  3KW9 A;  2DJG B;  2FO5 A;  2DCB A;  3O1G A;  4YYU A;  1ICF A;  4N8W A;  3N4C A;  1AU2 A;  2E00 A;  3E1Z B;  3KWB X;  4W5B A;  2GHU A;  3WXG A;  1U9X A;  1CSB B;  4C5P A;  4W4U A;  4X6I A;  3LTW A;  4YYQ A;  1NPZ A;  1VSN A;  2F1G A;  3K9M A;  1PBH A;  4WA6 A;  2DJF B;  1AU4 A;  1BQI A;  1DEU A;  4BGF A;  4BSQ A;  2G6D A;  2AUZ A;  3I3T A;  3MTN A;  1YK7 A;  1NQC A;  2VFC A;  3CH3 X;  1TU6 A;  2FTD A;  5K16 A;  2BSZ A;  1ZCM A;  2XU4 A;  3RVV A;  1NB5 A;  2HXZ A;  5J94 A;  3WXE A;  4OEM A;  2G8J A;  4XUI A;  4X6J A;  3RVW A;  4OEL A;  1QMY A;  2R9O A;  2PRE A;  1GMY A;  3U8E A;  3DF0 A;  3MHS A;  1U9W A;  2YJ8 A;  4PP2 E;  4FK5 A;  4X6H A;  2GFO A;  1EF7 A;  2AUX A;  1BGO A;  2R9N A;  3TNX A;  1AYW A;  1MEM A;  3H6S A;  1AU0 A;  2HHN A;  3WXF A;  4FJC A;  2AYN A;  2IBI A;  3KWZ A;  1PE6 A;  2AIM A;  3PW3 A;  4QRV A;  2O6X A;  2ATO A;  2OP3 A;  2B1M A;  4BS6 A;  2NQG A;  3BOW A;  2DCD A;  2E02 A;  1M6D A;  1U9Q X;  3D6S A;  1QXP A;  3OIS A;  4CDC B;  2NQI A;  3OVX A;  1ATK A;  2PAD A;  1W5R A;  1KXR A;  2DCA A;  3ZUA A;  1AYU A;  3AI8 A;  4Q8G A;  1HUC B;  2BDZ A;  1KHQ A;  4YYV A;  3OF8 A;  4BQV A;  3QJ3 A;  1O0E A;  5CHV A;  2FRQ A;  4YVA A;  1VJV A;  2C0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...