2AIMA

Cruzain inhibited with benzoyl-arginine-alanine-fluoromethylketone
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
publication title Structural determinants of specificity in the cysteine protease cruzain.
pubmed rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 1997-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2aimA00
1STFE 3N4CA 3KX1A 4DMXA 1GLOA 2E03A 1NLJA 3RVVA 5CHTA 2HH5A 1PXVA 3PBHA 3BWKA 1POPA 1EWPA 2YJCA 4PI3A 3OF8A 4K7CA 4W4UA 2PADA 3BPFA 1CV8A 3I3TA 3IV2A 3GCBA 4OELA 3HHIA 4PP1A 2FQ9A 1U9VA 4YYVA 4N8WA 1F2BA 1AU3A 1NQCA 2XU1A 3H7DA 3OISA 5A24A 1MS6A 1BY8A 2AYNA 1MDWA 3H6SA 2R6NA 1BGOA 3HWNA 1EF7A 1BQIA 4X6IA 3BPMA 1CS8A 1PADA 2R9MA 3F75A 2H7JA 3PDFA 1XKGA 2GFOA 3OVXA 4DMYA 1NB5A 2AU1A 5EF4A 2R9FA 5CVNB 4YV8A 2PNSA 1YT7A 1PPOA 2FO5A 1AYUA 1TLOA 2NQAA 3QSDA 1NB3A 1PPPA 4P6GA 2NQIA 1QXPA 3KWBX 4BS6A 2CIOA 2YJ2A 4I04A 3MHHA 2F1GA 4FIPA 1YALA 2HXZA 1VJVA 2G7YA 3MTNA 4BS5A 2DCAA 4HWYA 3K24A 1JQPA 3O0UA 2ACTA 1KHPA 2AYOA 1PPNA 2FYEA 2PBHA 3MORA 2XU4A 1ME3A 2DJGB 4QH6A 1AU4A 6PADA 2DC9A 1DEUA 1CQDA 1HUCB 2R9NA 4BQVA 1SNKA 4YYSA 1U5IA 3WXFA 1PIPA 2DC7A 3K8UA 3LXSA 4FK5A 4CDFB 3CBKA 4YYWA 2P0RA 1QDQA 3S3QA 1PBHA 1IWDA 1ATKA 1S4VA 1U9QX 1U9XA 2JQGR 1NPZA 3CH3X 2DZYA 5CVOB 3N3KA 1GMYA 4N4ZA 2E00A 3PNRA 3KW9A 2DCDA 3CH2X 8PCHA 1PE6A 4Q8GA 2O6XA 3IUTA 1YVBA 3BC3A 3P5XA 4XUIA 1EWMA 3IMAA 2YJ9A 2OZ2A 1PCIA 1EWLA 3H89A 4XR7A 1A6RA 2ATOA 3K9MA 3IOQA 1SP4B 2CB5A 4PP2E 3M99A 1YK7A 2Y5BA 2FTDA 5JH3A 2G8JA 3H8BA 4MSXA 4Q8HA 2NQGA 1Y08A 4YYQA 4CDEB 5CVMA 1MIRA 3C9EA 1BP4A 5PADA 4CDDB 2XU5A 2E01A 3HHAA 1AYVA 5CHVA 2NQDB 4ZUXU 4QRVA 3HD3A 2P7UA 1QOLA 2F7DA 4BSQA 2R9CA 4AXLA 2HD5A 2FUDA 3P5UA 4YYUA 1U9WA 5JA7A 1YK8A 3DF0A 2IPPB 1M6DA 1QMYA 2AIMA 1AECA 2DC6A 1CVZA 2C0YA 4WA6A 4MZOA 3USVA 1CB5A 1NL6A 2HHNA 3N3GA 1KFXL 1ZCMA 2VHFA 1TL9A 3KFQA 3KSEA 3P5VA 3V6EA 3IHPA 4W5CA 1Q6KA 4RY2A 3WXEA 2DJFB 3BCNA 4KLBA 1GECE 3O1GA 3MHSA 3V6CA 4BPVA 4I05A 1DF0A 2FRQA 1ZIVA 2DCBA 1O0EA 1MEGA 1CTEA 1AIMA 2AS8A 4X6HA 4QRGA 1AU2A 2OULA 3PW3A 4G54A 1KHQA 5EGWA 5J94A 2E02A 2XU3A 2BDZA 2B1NA 4FJCA 1VSNA 1GCBA 1K3BB 2DCCA 3ERVA 3KWZA 2GHUA 1CPJA 4CZWA 2ARYA 3F5VA 1CSBB 2DC8A 2FT2A 3I06A 2IBIA 1THEA 2AUXA 2G6DA 3E1ZB 2AUZA 2AVWA 1KFUL 3D6SA 4YVAA 2P86A 1AU0A 3RVWA 2VHSA 1FH0A 2YJBA 5F02A 1TU6A 9PAPA 1F2CA 1AYWA 3B79A 3TNXA 2BDLA 1ICFA 3H8CA 3QT4A 4I07A 4P6EA 3QJ3A 2B1MA 2PREA 3P5WA 1PPDA 1KXRA 2FRAA 2R9OA 3BOWA 1F29A 4OEMA 2YJ8A 4W5BA 3OVZA 2WBFX 3IEJA 1MHWA 1Y4HA 2DZZA 3LFYA 3S3RA 7PCKA 4MZSA 1ITOA 3WXGA 3AI8A 1CJLA 2G8EA 4PADA 1F2AA 1MEMA 2OP3A 1ME4A 2JQFR 4X6JA 4YYRA 3U8EA 3CBJA 3RVXA 3OF9A 4CDCB 2Y6EA 5K16A 3ZUAA 3NHEA 3KKUA 1EWOA 4AXMA 5FPWA 4N79A 1X9YA 4QRXA 4QBBA
chains in the Genus database with same CATH superfamily
1STFE 3N4CA 3KX1A 4DMXA 1GLOA 2E03A 1NLJA 2JRIA 3O65A 3RVVA 5CHTA 3MTVA 2HH5A 1PXVA 3B21A 3PBHA 3BWKA 1POPA 1EWPA 4PT5A 2YJCA 3MJ5A 4PI3A 3OF8A 4K7CA 4W4UA 2PADA 3BPFA 1CV8A 3I3TA 3IV2A 3GCBA 4OELA 3HHIA 4PP1A 1PVJA 2FQ9A 4BOZA 1U9VA 4YYVA 3PHWA 4N8WA 1F2BA 1AU3A 1NQCA 4XZXA 2XU1A 3H7DA 2Z84A 3OISA 5A24A 1MS6A 1BY8A 2AYNA 1MDWA 3H6SA 2R6NA 1BGOA 3HWNA 1EF7A 1BQIA 4X6IA 3BPMA 1CS8A 1PADA 2R9MA 3F75A 2H7JA 3PDFA 1XKGA 2GFOA 3OVXA 4R3DA 4DMYA 1NB5A 2AU1A 4BOSA 5EF4A 2R9FA 5CVNB 4YV8A 2PNSA 1YT7A 1PPOA 2FO5A 1AYUA 1TLOA 4A5UA 4REZA 2NQAA 3QSDA 1NB3A 1PPPA 4P6GA 4RF0A 2NQIA 3ZNHA 4IP3A 1QXPA 3KWBX 4BS6A 2CIOA 2AGAA 2YJ2A 4I04A 3MHHA 2J7QC 4WURA 2F1GA 4FIPA 4QRXA 1YALA 2HXZA 1VJVA 2G7YA 3MTNA 4BS5A 2DCAA 4HWYA 3K24A 1JQPA 3O0UA 2ACTA 3TRKA 1KHPA 2AYOA 1PPNA 2FYEA 2PBHA 3MORA 4RNAA 2XU4A 1ME3A 2DJGB 4QH6A 1AU4A 6PADA 2DC9A 1DEUA 1CQDA 1HUCB 2R9NA 4BQVA 1SNKA 4YYSA 1U5IA 4HXDB 3WXFA 1PIPA 2DC7A 3K8UA 3LXSA 4FK5A 4CDFB 2BU3A 4OVZB 3CBKA 4YYWA 2P0RA 1QDQA 3S3QA 1PBHA 1IWDA 1ATKA 1S4VA 3TMPA 3PRPA 1U9QX 1U9XA 2JQGR 4BOUA 1YZBA 1NPZA 3CH3X 2DZYA 5CVOB 3N3KA 1GMYA 2BTWB 4N4ZA 2E00A 3PNRA 3BY4A 3KW9A 2DCDA 3CH2X 8PCHA 2J7QA 1PE6A 4Q8GA 2O6XA 3IUTA 1YVBA 3BC3A 3P5XA 4RF1A 4XUIA 1EWMA 3IMAA 2YJ9A 2OZ2A 5KO3A 1PCIA 3H89A 4XR7A 1A6RA 2ATOA 3K9MA 3IOQA 1SP4B 2CB5A 4PP2E 3M99A 1YK7A 1UKFA 2Y5BA 2FTDA 5JH3A 2G8JA 3H8BA 4MSXA 4Q8HA 2NQGA 1Y08A 4YYQA 4CDEB 5CVMA 1MIRA 3C9EA 1BP4A 5PADA 4CDDB 2XU5A 2E01A 3HHAA 1AYVA 5CHVA 2NQDB 4ZUXU 4QRVA 2HWKA 3HD3A 2P7UA 1QOLA 5EZSA 2F7DA 4BSQA 2R9CA 4AXLA 2HD5A 2FUDA 4P16A 3P5UA 4YYUA 1U9WA 5JA7A 1YK8A 3DF0A 2IPPB 1DKIA 1M6DA 4MI7A 5EZQA 1QMYA 2AIMA 1AECA 2DC6A 1CVZA 2C0YA 4WA6A 4MZOA 3USVA 1CB5A 1NL6A 2HHNA 3N3GA 1KFXL 1ZCMA 3W31A 2VHFA 1TL9A 3KFQA 4GUAA 3KSEA 3P5VA 3BBAA 3V6EA 3IHPA 4W5CA 1Q6KA 3PRMA 4RY2A 3WXEA 2DJFB 3BCNA 4KLBA 1GECE 3O1GA 3RNVA 3MHSA 3V6CA 3PSEA 4BPVA 4I05A 1DF0A 2FRQA 1ZIVA 2DCBA 1O0EA 1MEGA 1CTEA 4RKXA 1AIMA 4M0WA 2AS8A 4X6HA 4QRGA 1AU2A 4BOPA 2OULA 3PW3A 4G54A 1KHQA 5EGWA 5J94A 2E02A 2XU3A 2BDZA 2B1NA 4FJCA 1VSNA 1GCBA 1K3BB 3C0RA 2DCCA 3ERVA 3KWZA 5JZEA 2GHUA 1CPJA 4CZWA 2ARYA 3F5VA 1CSBB 2DC8A 2FT2A 3I06A 2IBIA 1THEA 4BOQA 2AUXA 2G6DA 3W30A 3E1ZB 2AUZA 2AVWA 4MM3B 1KFUL 3BB7A 3D6SA 4YVAA 2P86A 1AU0A 3RVWA 2VHSA 4D8IA 1FH0A 2YJBA 4OW0A 3PHXA 3OQCA 5F02A 1TU6A 9PAPA 1F2CA 1AYWA 3B79A 2DOSA 3TNXA 3PT2A 2BDLA 1ICFA 3H8CA 3QT4A 4I07A 4P6EA 2JTCA 3QJ3A 2B1MA 2PREA 3P5WA 1PPDA 3IFUA 1KXRA 2FRAA 2R9OA 3BOWA 1F29A 2UZJA 4OEMA 2YJ8A 4W5BA 3OVZA 2WBFX 4OVZA 3IEJA 1MHWA 1Y4HA 2DZZA 3LFYA 3E9SA 3S3RA 7PCKA 4MZSA 1ITOA 3WXGA 4ZTBA 3AI8A 1CJLA 4D8EA 2G8EA 4PADA 1F2AA 1MEMA 4IUMA 2OP3A 1ME4A 2JQFR 4X6JA 4YYRA 2BTWA 4D8BA 3U8EA 3CBJA 3RVXA 3OF9A 4CDCB 2Y6EA 5K16A 3ZUAA 5E6JA 3NHEA 3KKUA 1EWOA 4AXMA 5FPWA 2FE8A 4N79A 1X9YA 3PHUA 3MP2A 1EWLA 4QBBA
chains in the Genus database with same CATH topology
1STFE 3N4CA 3KX1A 4DMXA 1GLOA 2E03A 1NLJA 3RVVA 5CHTA 2HH5A 1PXVA 3PBHA 3BWKA 1POPA 1EWPA 2YJCA 4PI3A 3OF8A 4K7CA 4W4UA 2PADA 3BPFA 1CV8A 3I3TA 3IV2A 1W5RA 3GCBA 4OELA 3HHIA 4PP1A 2FQ9A 1U9VA 4YYVA 4N8WA 1F2BA 1AU3A 1NQCA 2XU1A 3H7DA 3OISA 5A24A 1MS6A 1BY8A 2AYNA 1MDWA 3H6SA 2R6NA 1BGOA 2VFCA 3HWNA 1EF7A 1BQIA 4X6IA 3BPMA 1E2TA 1CS8A 1PADA 2R9MA 3F75A 2H7JA 3PDFA 1XKGA 2GFOA 4NV7A 3OVXA 4DMYA 1NB5A 2AU1A 5EF4A 2R9FA 5CVNB 4YV8A 2PNSA 1YT7A 1PPOA 2FO5A 1AYUA 1TLOA 4BGFA 2NQAA 3QSDA 1NB3A 1PPPA 4P6GA 2NQIA 1QXPA 3KWBX 4BS6A 2CIOA 2YJ2A 4I04A 3MHHA 2F1GA 4FIPA 4QRXA 1YALA 2HXZA 1VJVA 2G7YA 3MTNA 4BS5A 2DCAA 4HWYA 3K24A 1JQPA 3O0UA 2ACTA 1KHPA 2AYOA 1PPNA 2FYEA 2PBHA 3MORA 2XU4A 1ME3A 2DJGB 4QH6A 1AU4A 6PADA 2DC9A 1DEUA 1CQDA 1HUCB 2R9NA 4BQVA 1SNKA 4YYSA 1U5IA 3WXFA 1PIPA 2DC7A 3K8UA 3LXSA 4FK5A 4CDFB 3CBKA 4YYWA 2P0RA 1QDQA 3S3QA 1PBHA 1IWDA 1ATKA 1S4VA 1U9QX 1U9XA 2JQGR 1NPZA 3CH3X 2DZYA 5CVOB 3N3KA 1GMYA 4N4ZA 2E00A 3PNRA 3KW9A 2DCDA 3CH2X 8PCHA 1W4TA 1PE6A 4Q8GA 2O6XA 3IUTA 1YVBA 3BC3A 3P5XA 4XUIA 1EWMA 3IMAA 2YJ9A 2OZ2A 1PCIA 3H89A 4XR7A 1A6RA 2ATOA 3K9MA 3IOQA 1SP4B 2CB5A 4PP2E 1GX3A 3M99A 1YK7A 2Y5BA 2FTDA 5JH3A 2G8JA 3H8BA 4MSXA 4Q8HA 2NQGA 1Y08A 4YYQA 1W6FA 4CDEB 5CVMA 1MIRA 3C9EA 1BP4A 5PADA 4CDDB 2XU5A 2E01A 3HHAA 1AYVA 5CHVA 2NQDB 4ZUXU 4QRVA 3HD3A 2P7UA 1QOLA 2F7DA 4BSQA 2R9CA 4AXLA 2HD5A 2FUDA 3P5UA 4YYUA 1U9WA 5JA7A 1YK8A 3DF0A 2IPPB 1M6DA 1QMYA 2AIMA 1AECA 2DC6A 1CVZA 2C0YA 4WA6A 4MZOA 3USVA 1CB5A 1NL6A 2HHNA 3N3GA 1KFXL 1ZCMA 2VHFA 1TL9A 3KFQA 3KSEA 3P5VA 3V6EA 3IHPA 4W5CA 1Q6KA 4RY2A 3D9WA 3WXEA 2DJFB 3BCNA 4KLBA 1GECE 3O1GA 3MHSA 3V6CA 4BPVA 4I05A 1DF0A 2FRQA 1ZIVA 2DCBA 1O0EA 1MEGA 1CTEA 1AIMA 2AS8A 4X6HA 4QRGA 1AU2A 2OULA 3LTWA 3PW3A 4G54A 1KHQA 5EGWA 5J94A 2E02A 2XU3A 2BDZA 2B1NA 4FJCA 1VSNA 1GCBA 1K3BB 2DCCA 3ERVA 3KWZA 2BSZA 4B55A 2GHUA 1CPJA 4CZWA 2ARYA 3F5VA 1CSBB 2DC8A 2FT2A 2VFBA 3I06A 4C5PA 2IBIA 1THEA 2AUXA 2G6DA 3E1ZB 2AUZA 2AVWA 1KFUL 3D6SA 4YVAA 2P86A 1AU0A 3RVWA 2VHSA 1FH0A 2YJBA 5F02A 1TU6A 9PAPA 1F2CA 1AYWA 3B79A 3TNXA 2BDLA 1ICFA 3H8CA 3QT4A 4I07A 4P6EA 3QJ3A 2B1MA 2PREA 3P5WA 1PPDA 1KXRA 2FRAA 2R9OA 3BOWA 1F29A 4OEMA 2YJ8A 4W5BA 3OVZA 2WBFX 3IEJA 1MHWA 1Y4HA 2DZZA 3LFYA 3S3RA 7PCKA 4MZSA 1ITOA 4GUZA 3WXGA 3AI8A 1CJLA 2G8EA 4NV8A 4PADA 1F2AA 1MEMA 2OP3A 1ME4A 2JQFR 4X6JA 4YYRA 3U8EA 3CBJA 3RVXA 3OF9A 4CDCB 2Y6EA 5K16A 3ZUAA 3NHEA 3KKUA 1EWOA 4AXMA 5FPWA 4N79A 1X9YA 1EWLA 4QBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STF E;  3N4C A;  3KX1 A;  4DMX A;  1GLO A;  2E03 A;  1NLJ A;  3RVV A;  5CHT A;  2HH5 A;  1PXV A;  3PBH A;  3BWK A;  1POP A;  1EWP A;  2YJC A;  4PI3 A;  3OF8 A;  4K7C A;  4W4U A;  2PAD A;  3BPF A;  1CV8 A;  3I3T A;  3IV2 A;  3GCB A;  4OEL A;  3HHI A;  4PP1 A;  2FQ9 A;  1U9V A;  4YYV A;  4N8W A;  1F2B A;  1AU3 A;  1NQC A;  2XU1 A;  3H7D A;  3OIS A;  5A24 A;  1MS6 A;  1BY8 A;  2AYN A;  1MDW A;  3H6S A;  2R6N A;  1BGO A;  3HWN A;  1EF7 A;  1BQI A;  4X6I A;  3BPM A;  1CS8 A;  1PAD A;  2R9M A;  3F75 A;  2H7J A;  3PDF A;  1XKG A;  2GFO A;  3OVX A;  4DMY A;  1NB5 A;  2AU1 A;  5EF4 A;  2R9F A;  5CVN B;  4YV8 A;  2PNS A;  1YT7 A;  1PPO A;  2FO5 A;  1AYU A;  1TLO A;  2NQA A;  3QSD A;  1NB3 A;  1PPP A;  4P6G A;  2NQI A;  1QXP A;  3KWB X;  4BS6 A;  2CIO A;  2YJ2 A;  4I04 A;  3MHH A;  2F1G A;  4FIP A;  1YAL A;  2HXZ A;  1VJV A;  2G7Y A;  3MTN A;  4BS5 A;  2DCA A;  4HWY A;  3K24 A;  1JQP A;  3O0U A;  2ACT A;  1KHP A;  2AYO A;  1PPN A;  2FYE A;  2PBH A;  3MOR A;  2XU4 A;  1ME3 A;  2DJG B;  4QH6 A;  1AU4 A;  6PAD A;  2DC9 A;  1DEU A;  1CQD A;  1HUC B;  2R9N A;  4BQV A;  1SNK A;  4YYS A;  1U5I A;  3WXF A;  1PIP A;  2DC7 A;  3K8U A;  3LXS A;  4FK5 A;  4CDF B;  3CBK A;  4YYW A;  2P0R A;  1QDQ A;  3S3Q A;  1PBH A;  1IWD A;  1ATK A;  1S4V A;  1U9Q X;  1U9X A;  2JQG R;  1NPZ A;  3CH3 X;  2DZY A;  5CVO B;  3N3K A;  1GMY A;  4N4Z A;  2E00 A;  3PNR A;  3KW9 A;  2DCD A;  3CH2 X;  8PCH A;  1PE6 A;  4Q8G A;  2O6X A;  3IUT A;  1YVB A;  3BC3 A;  3P5X A;  4XUI A;  1EWM A;  3IMA A;  2YJ9 A;  2OZ2 A;  1PCI A;  1EWL A;  3H89 A;  4XR7 A;  1A6R A;  2ATO A;  3K9M A;  3IOQ A;  1SP4 B;  2CB5 A;  4PP2 E;  3M99 A;  1YK7 A;  2Y5B A;  2FTD A;  5JH3 A;  2G8J A;  3H8B A;  4MSX A;  4Q8H A;  2NQG A;  1Y08 A;  4YYQ A;  4CDE B;  5CVM A;  1MIR A;  3C9E A;  1BP4 A;  5PAD A;  4CDD B;  2XU5 A;  2E01 A;  3HHA A;  1AYV A;  5CHV A;  2NQD B;  4ZUX U;  4QRV A;  3HD3 A;  2P7U A;  1QOL A;  2F7D A;  4BSQ A;  2R9C A;  4AXL A;  2HD5 A;  2FUD A;  3P5U A;  4YYU A;  1U9W A;  5JA7 A;  1YK8 A;  3DF0 A;  2IPP B;  1M6D A;  1QMY A;  2AIM A;  1AEC A;  2DC6 A;  1CVZ A;  2C0Y A;  4WA6 A;  4MZO A;  3USV A;  1CB5 A;  1NL6 A;  2HHN A;  3N3G A;  1KFX L;  1ZCM A;  2VHF A;  1TL9 A;  3KFQ A;  3KSE A;  3P5V A;  3V6E A;  3IHP A;  4W5C A;  1Q6K A;  4RY2 A;  3WXE A;  2DJF B;  3BCN A;  4KLB A;  1GEC E;  3O1G A;  3MHS A;  3V6C A;  4BPV A;  4I05 A;  1DF0 A;  2FRQ A;  1ZIV A;  2DCB A;  1O0E A;  1MEG A;  1CTE A;  1AIM A;  2AS8 A;  4X6H A;  4QRG A;  1AU2 A;  2OUL A;  3PW3 A;  4G54 A;  1KHQ A;  5EGW A;  5J94 A;  2E02 A;  2XU3 A;  2BDZ A;  2B1N A;  4FJC A;  1VSN A;  1GCB A;  1K3B B;  2DCC A;  3ERV A;  3KWZ A;  2GHU A;  1CPJ A;  4CZW A;  2ARY A;  3F5V A;  1CSB B;  2DC8 A;  2FT2 A;  3I06 A;  2IBI A;  1THE A;  2AUX A;  2G6D A;  3E1Z B;  2AUZ A;  2AVW A;  1KFU L;  3D6S A;  4YVA A;  2P86 A;  1AU0 A;  3RVW A;  2VHS A;  1FH0 A;  2YJB A;  5F02 A;  1TU6 A;  9PAP A;  1F2C A;  1AYW A;  3B79 A;  3TNX A;  2BDL A;  1ICF A;  3H8C A;  3QT4 A;  4I07 A;  4P6E A;  3QJ3 A;  2B1M A;  2PRE A;  3P5W A;  1PPD A;  1KXR A;  2FRA A;  2R9O A;  3BOW A;  1F29 A;  4OEM A;  2YJ8 A;  4W5B A;  3OVZ A;  2WBF X;  3IEJ A;  1MHW A;  1Y4H A;  2DZZ A;  3LFY A;  3S3R A;  7PCK A;  4MZS A;  1ITO A;  3WXG A;  3AI8 A;  1CJL A;  2G8E A;  4PAD A;  1F2A A;  1MEM A;  2OP3 A;  1ME4 A;  2JQF R;  4X6J A;  4YYR A;  3U8E A;  3CBJ A;  3RVX A;  3OF9 A;  4CDC B;  2Y6E A;  5K16 A;  3ZUA A;  3NHE A;  3KKU A;  1EWO A;  4AXM A;  5FPW A;  4N79 A;  1X9Y A;  4QRX A;  4QBB A; 
#chains in the Genus database with same CATH topology
 1STF E;  3N4C A;  3KX1 A;  4DMX A;  1GLO A;  2E03 A;  1NLJ A;  2JRI A;  3O65 A;  3RVV A;  5CHT A;  3MTV A;  2HH5 A;  1PXV A;  3B21 A;  3PBH A;  3BWK A;  1POP A;  1EWP A;  4PT5 A;  2YJC A;  3MJ5 A;  4PI3 A;  3OF8 A;  4K7C A;  4W4U A;  2PAD A;  3BPF A;  1CV8 A;  3I3T A;  3IV2 A;  3GCB A;  4OEL A;  3HHI A;  4PP1 A;  1PVJ A;  2FQ9 A;  4BOZ A;  1U9V A;  4YYV A;  3PHW A;  4N8W A;  1F2B A;  1AU3 A;  1NQC A;  4XZX A;  2XU1 A;  3H7D A;  2Z84 A;  3OIS A;  5A24 A;  1MS6 A;  1BY8 A;  2AYN A;  1MDW A;  3H6S A;  2R6N A;  1BGO A;  3HWN A;  1EF7 A;  1BQI A;  4X6I A;  3BPM A;  1CS8 A;  1PAD A;  2R9M A;  3F75 A;  2H7J A;  3PDF A;  1XKG A;  2GFO A;  3OVX A;  4R3D A;  4DMY A;  1NB5 A;  2AU1 A;  4BOS A;  5EF4 A;  2R9F A;  5CVN B;  4YV8 A;  2PNS A;  1YT7 A;  1PPO A;  2FO5 A;  1AYU A;  1TLO A;  4A5U A;  4REZ A;  2NQA A;  3QSD A;  1NB3 A;  1PPP A;  4P6G A;  4RF0 A;  2NQI A;  3ZNH A;  4IP3 A;  1QXP A;  3KWB X;  4BS6 A;  2CIO A;  2AGA A;  2YJ2 A;  4I04 A;  3MHH A;  2J7Q C;  4WUR A;  2F1G A;  4FIP A;  4QRX A;  1YAL A;  2HXZ A;  1VJV A;  2G7Y A;  3MTN A;  4BS5 A;  2DCA A;  4HWY A;  3K24 A;  1JQP A;  3O0U A;  2ACT A;  3TRK A;  1KHP A;  2AYO A;  1PPN A;  2FYE A;  2PBH A;  3MOR A;  4RNA A;  2XU4 A;  1ME3 A;  2DJG B;  4QH6 A;  1AU4 A;  6PAD A;  2DC9 A;  1DEU A;  1CQD A;  1HUC B;  2R9N A;  4BQV A;  1SNK A;  4YYS A;  1U5I A;  4HXD B;  3WXF A;  1PIP A;  2DC7 A;  3K8U A;  3LXS A;  4FK5 A;  4CDF B;  2BU3 A;  4OVZ B;  3CBK A;  4YYW A;  2P0R A;  1QDQ A;  3S3Q A;  1PBH A;  1IWD A;  1ATK A;  1S4V A;  3TMP A;  3PRP A;  1U9Q X;  1U9X A;  2JQG R;  4BOU A;  1YZB A;  1NPZ A;  3CH3 X;  2DZY A;  5CVO B;  3N3K A;  1GMY A;  2BTW B;  4N4Z A;  2E00 A;  3PNR A;  3BY4 A;  3KW9 A;  2DCD A;  3CH2 X;  8PCH A;  2J7Q A;  1PE6 A;  4Q8G A;  2O6X A;  3IUT A;  1YVB A;  3BC3 A;  3P5X A;  4RF1 A;  4XUI A;  1EWM A;  3IMA A;  2YJ9 A;  2OZ2 A;  5KO3 A;  1PCI A;  3H89 A;  4XR7 A;  1A6R A;  2ATO A;  3K9M A;  3IOQ A;  1SP4 B;  2CB5 A;  4PP2 E;  3M99 A;  1YK7 A;  1UKF A;  2Y5B A;  2FTD A;  5JH3 A;  2G8J A;  3H8B A;  4MSX A;  4Q8H A;  2NQG A;  1Y08 A;  4YYQ A;  4CDE B;  5CVM A;  1MIR A;  3C9E A;  1BP4 A;  5PAD A;  4CDD B;  2XU5 A;  2E01 A;  3HHA A;  1AYV A;  5CHV A;  2NQD B;  4ZUX U;  4QRV A;  2HWK A;  3HD3 A;  2P7U A;  1QOL A;  5EZS A;  2F7D A;  4BSQ A;  2R9C A;  4AXL A;  2HD5 A;  2FUD A;  4P16 A;  3P5U A;  4YYU A;  1U9W A;  5JA7 A;  1YK8 A;  3DF0 A;  2IPP B;  1DKI A;  1M6D A;  4MI7 A;  5EZQ A;  1QMY A;  2AIM A;  1AEC A;  2DC6 A;  1CVZ A;  2C0Y A;  4WA6 A;  4MZO A;  3USV A;  1CB5 A;  1NL6 A;  2HHN A;  3N3G A;  1KFX L;  1ZCM A;  3W31 A;  2VHF A;  1TL9 A;  3KFQ A;  4GUA A;  3KSE A;  3P5V A;  3BBA A;  3V6E A;  3IHP A;  4W5C A;  1Q6K A;  3PRM A;  4RY2 A;  3WXE A;  2DJF B;  3BCN A;  4KLB A;  1GEC E;  3O1G A;  3RNV A;  3MHS A;  3V6C A;  3PSE A;  4BPV A;  4I05 A;  1DF0 A;  2FRQ A;  1ZIV A;  2DCB A;  1O0E A;  1MEG A;  1CTE A;  4RKX A;  1AIM A;  4M0W A;  2AS8 A;  4X6H A;  4QRG A;  1AU2 A;  4BOP A;  2OUL A;  3PW3 A;  4G54 A;  1KHQ A;  5EGW A;  5J94 A;  2E02 A;  2XU3 A;  2BDZ A;  2B1N A;  4FJC A;  1VSN A;  1GCB A;  1K3B B;  3C0R A;  2DCC A;  3ERV A;  3KWZ A;  5JZE A;  2GHU A;  1CPJ A;  4CZW A;  2ARY A;  3F5V A;  1CSB B;  2DC8 A;  2FT2 A;  3I06 A;  2IBI A;  1THE A;  4BOQ A;  2AUX A;  2G6D A;  3W30 A;  3E1Z B;  2AUZ A;  2AVW A;  4MM3 B;  1KFU L;  3BB7 A;  3D6S A;  4YVA A;  2P86 A;  1AU0 A;  3RVW A;  2VHS A;  4D8I A;  1FH0 A;  2YJB A;  4OW0 A;  3PHX A;  3OQC A;  5F02 A;  1TU6 A;  9PAP A;  1F2C A;  1AYW A;  3B79 A;  2DOS A;  3TNX A;  3PT2 A;  2BDL A;  1ICF A;  3H8C A;  3QT4 A;  4I07 A;  4P6E A;  2JTC A;  3QJ3 A;  2B1M A;  2PRE A;  3P5W A;  1PPD A;  3IFU A;  1KXR A;  2FRA A;  2R9O A;  3BOW A;  1F29 A;  2UZJ A;  4OEM A;  2YJ8 A;  4W5B A;  3OVZ A;  2WBF X;  4OVZ A;  3IEJ A;  1MHW A;  1Y4H A;  2DZZ A;  3LFY A;  3E9S A;  3S3R A;  7PCK A;  4MZS A;  1ITO A;  3WXG A;  4ZTB A;  3AI8 A;  1CJL A;  4D8E A;  2G8E A;  4PAD A;  1F2A A;  1MEM A;  4IUM A;  2OP3 A;  1ME4 A;  2JQF R;  4X6J A;  4YYR A;  2BTW A;  4D8B A;  3U8E A;  3CBJ A;  3RVX A;  3OF9 A;  4CDC B;  2Y6E A;  5K16 A;  3ZUA A;  5E6J A;  3NHE A;  3KKU A;  1EWO A;  4AXM A;  5FPW A;  2FE8 A;  4N79 A;  1X9Y A;  3PHU A;  3MP2 A;  1EWL A;  4QBB A; 
#chains in the Genus database with same CATH homology
 1STF E;  3N4C A;  3KX1 A;  4DMX A;  1GLO A;  2E03 A;  1NLJ A;  3RVV A;  5CHT A;  2HH5 A;  1PXV A;  3PBH A;  3BWK A;  1POP A;  1EWP A;  2YJC A;  4PI3 A;  3OF8 A;  4K7C A;  4W4U A;  2PAD A;  3BPF A;  1CV8 A;  3I3T A;  3IV2 A;  1W5R A;  3GCB A;  4OEL A;  3HHI A;  4PP1 A;  2FQ9 A;  1U9V A;  4YYV A;  4N8W A;  1F2B A;  1AU3 A;  1NQC A;  2XU1 A;  3H7D A;  3OIS A;  5A24 A;  1MS6 A;  1BY8 A;  2AYN A;  1MDW A;  3H6S A;  2R6N A;  1BGO A;  2VFC A;  3HWN A;  1EF7 A;  1BQI A;  4X6I A;  3BPM A;  1E2T A;  1CS8 A;  1PAD A;  2R9M A;  3F75 A;  2H7J A;  3PDF A;  1XKG A;  2GFO A;  4NV7 A;  3OVX A;  4DMY A;  1NB5 A;  2AU1 A;  5EF4 A;  2R9F A;  5CVN B;  4YV8 A;  2PNS A;  1YT7 A;  1PPO A;  2FO5 A;  1AYU A;  1TLO A;  4BGF A;  2NQA A;  3QSD A;  1NB3 A;  1PPP A;  4P6G A;  2NQI A;  1QXP A;  3KWB X;  4BS6 A;  2CIO A;  2YJ2 A;  4I04 A;  3MHH A;  2F1G A;  4FIP A;  4QRX A;  1YAL A;  2HXZ A;  1VJV A;  2G7Y A;  3MTN A;  4BS5 A;  2DCA A;  4HWY A;  3K24 A;  1JQP A;  3O0U A;  2ACT A;  1KHP A;  2AYO A;  1PPN A;  2FYE A;  2PBH A;  3MOR A;  2XU4 A;  1ME3 A;  2DJG B;  4QH6 A;  1AU4 A;  6PAD A;  2DC9 A;  1DEU A;  1CQD A;  1HUC B;  2R9N A;  4BQV A;  1SNK A;  4YYS A;  1U5I A;  3WXF A;  1PIP A;  2DC7 A;  3K8U A;  3LXS A;  4FK5 A;  4CDF B;  3CBK A;  4YYW A;  2P0R A;  1QDQ A;  3S3Q A;  1PBH A;  1IWD A;  1ATK A;  1S4V A;  1U9Q X;  1U9X A;  2JQG R;  1NPZ A;  3CH3 X;  2DZY A;  5CVO B;  3N3K A;  1GMY A;  4N4Z A;  2E00 A;  3PNR A;  3KW9 A;  2DCD A;  3CH2 X;  8PCH A;  1W4T A;  1PE6 A;  4Q8G A;  2O6X A;  3IUT A;  1YVB A;  3BC3 A;  3P5X A;  4XUI A;  1EWM A;  3IMA A;  2YJ9 A;  2OZ2 A;  1PCI A;  3H89 A;  4XR7 A;  1A6R A;  2ATO A;  3K9M A;  3IOQ A;  1SP4 B;  2CB5 A;  4PP2 E;  1GX3 A;  3M99 A;  1YK7 A;  2Y5B A;  2FTD A;  5JH3 A;  2G8J A;  3H8B A;  4MSX A;  4Q8H A;  2NQG A;  1Y08 A;  4YYQ A;  1W6F A;  4CDE B;  5CVM A;  1MIR A;  3C9E A;  1BP4 A;  5PAD A;  4CDD B;  2XU5 A;  2E01 A;  3HHA A;  1AYV A;  5CHV A;  2NQD B;  4ZUX U;  4QRV A;  3HD3 A;  2P7U A;  1QOL A;  2F7D A;  4BSQ A;  2R9C A;  4AXL A;  2HD5 A;  2FUD A;  3P5U A;  4YYU A;  1U9W A;  5JA7 A;  1YK8 A;  3DF0 A;  2IPP B;  1M6D A;  1QMY A;  2AIM A;  1AEC A;  2DC6 A;  1CVZ A;  2C0Y A;  4WA6 A;  4MZO A;  3USV A;  1CB5 A;  1NL6 A;  2HHN A;  3N3G A;  1KFX L;  1ZCM A;  2VHF A;  1TL9 A;  3KFQ A;  3KSE A;  3P5V A;  3V6E A;  3IHP A;  4W5C A;  1Q6K A;  4RY2 A;  3D9W A;  3WXE A;  2DJF B;  3BCN A;  4KLB A;  1GEC E;  3O1G A;  3MHS A;  3V6C A;  4BPV A;  4I05 A;  1DF0 A;  2FRQ A;  1ZIV A;  2DCB A;  1O0E A;  1MEG A;  1CTE A;  1AIM A;  2AS8 A;  4X6H A;  4QRG A;  1AU2 A;  2OUL A;  3LTW A;  3PW3 A;  4G54 A;  1KHQ A;  5EGW A;  5J94 A;  2E02 A;  2XU3 A;  2BDZ A;  2B1N A;  4FJC A;  1VSN A;  1GCB A;  1K3B B;  2DCC A;  3ERV A;  3KWZ A;  2BSZ A;  4B55 A;  2GHU A;  1CPJ A;  4CZW A;  2ARY A;  3F5V A;  1CSB B;  2DC8 A;  2FT2 A;  2VFB A;  3I06 A;  4C5P A;  2IBI A;  1THE A;  2AUX A;  2G6D A;  3E1Z B;  2AUZ A;  2AVW A;  1KFU L;  3D6S A;  4YVA A;  2P86 A;  1AU0 A;  3RVW A;  2VHS A;  1FH0 A;  2YJB A;  5F02 A;  1TU6 A;  9PAP A;  1F2C A;  1AYW A;  3B79 A;  3TNX A;  2BDL A;  1ICF A;  3H8C A;  3QT4 A;  4I07 A;  4P6E A;  3QJ3 A;  2B1M A;  2PRE A;  3P5W A;  1PPD A;  1KXR A;  2FRA A;  2R9O A;  3BOW A;  1F29 A;  4OEM A;  2YJ8 A;  4W5B A;  3OVZ A;  2WBF X;  3IEJ A;  1MHW A;  1Y4H A;  2DZZ A;  3LFY A;  3S3R A;  7PCK A;  4MZS A;  1ITO A;  4GUZ A;  3WXG A;  3AI8 A;  1CJL A;  2G8E A;  4NV8 A;  4PAD A;  1F2A A;  1MEM A;  2OP3 A;  1ME4 A;  2JQF R;  4X6J A;  4YYR A;  3U8E A;  3CBJ A;  3RVX A;  3OF9 A;  4CDC B;  2Y6E A;  5K16 A;  3ZUA A;  3NHE A;  3KKU A;  1EWO A;  4AXM A;  5FPW A;  4N79 A;  1X9Y A;  1EWL A;  4QBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...