2AIMA

Cruzain inhibited with benzoyl-arginine-alanine-fluoromethylketone
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of specificity in the cysteine protease cruzain.
pubmed rcsb
molecule keywords CRUZAIN
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 1997-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2aimA00
1MDWA 2YJ9A 3OVZA 1CJLA 2DC7A 1SP4B 1ATKA 1ZCMA 7PCKA 4KLBA 1YVBA 2HD5A 3CBKA 6PADA 2DC9A 2OULA 1KXRA 2FTDA 3RVXA 1DEUA 3KX1A 2XU3A 1F2BA 4DMXA 2AU1A 3KWZA 4BQVA 4X6IA 2PNSA 4YYRA 8PCHA 4Q8GA 5CVOB 4ZUXU 3PDFA 1BY8A 1U5IA 1YK8A 3H89A 1JQPA 3M99A 3H8BA 2R9NA 3AI8A 2BDZA 1GMYA 1EWPA 2AVWA 2XU4A 1F29A 3RVWA 1EWOA 3H6SA 3OF9A 3OISA 2IPPB 1NQCA 3H7DA 1Y4HA 4DMYA 2NQDB 2PBHA 2G8JA 3CBJA 1KHPA 1NB3A 4I04A 3S3RA 3U8EA 1PPNA 1U9QX 2DZZA 3IMAA 2ATOA 3K9MA 3K24A 1KHQA 3BWKA 5CVMA 4QRGA 3CH2X 4AXLA 1THEA 1NPZA 3I3TA 4N4ZA 4BS5A 2HXZA 1U9WA 1XKGA 3IHPA 2ARYA 1X9YA 1CTEA 1FH0A 1AYWA 2YJBA 2E00A 2H7JA 4OEMA 1F2AA 1TL9A 2DZYA 3KWBX 4RY2A 4YV8A 1O0EA 3D6SA 1HUCB 1QMYA 2JQFR 3P5VA 1PXVA 4Q8HA 3LFYA 5CVNB 3BOWA 1TLOA 2G6DA 4CZWA 2B1MA 5K16A 3IV2A 2R9MA 3OF8A 2CB5A 3LXSA 3WXGA 1PCIA 1BP4A 2YJ8A 1MEGA 4WA6A 2E01A 1ZIVA 2ACTA 4OELA 4I05A 1POPA 3MTNA 2O6XA 3KW9A 3WXFA 1S4VA 2E03A 1BQIA 3ZUAA 4W5BA 3KFQA 2R6NA 3WXEA 2F7DA 4W5CA 2B1NA 4YYWA 4MSXA 1AIMA 4K7CA 4N79A 1GCBA 5FPWA 2Y6EA 1EF7A 2BDLA 5PADA 3P5UA 3N4CA 2FRQA 4YYQA 1A6RA 1QOLA 4CDDB 4QH6A 4N8WA 3H8CA 1MIRA 4X6HA 2Y5BA 4QRXA 3HD3A 2HHNA 1PIPA 2XU5A 5EGWA 1MEMA 4MZSA 1GECE 2R9OA 3K8UA 1EWLA 2AYOA 1MS6A 3E1ZB 4PP1A 2DJGB 3N3KA 1AECA 3BPMA 3O1GA 2P0RA 2FQ9A 3N3GA 1YALA 5CHVA 3B79A 1STFE 2GHUA 1PPOA 1ICFA 2C0YA 4PADA 1PE6A 3PBHA 1AYVA 4BS6A 1DF0A 3V6EA 1TU6A 1VJVA 4BSQA 1KFUL 3P5XA 1K3BB 3MHHA 4YYUA 2R9FA 4CDCB 2DCBA 3HWNA 5F02A 2PADA 4MZOA 1Y08A 2NQAA 1ME3A 3KKUA 2FT2A 1Q6KA 3HHAA 3PW3A 5CHTA 1YK7A 1YT7A 2YJCA 1IWDA 2E02A 3GCBA 1PPDA 1F2CA 4FJCA 4FIPA 3CH3X 2P86A 1AU3A 2IBIA 4YYVA 2NQIA 1MHWA 1M6DA 2G7YA 5JH3A 3O0UA 2PREA 4XUIA 3MHSA 4PI3A 2YJ2A 1AU4A 3P5WA 3NHEA 2R9CA 1CS8A 3F5VA 3I06A 1AU2A 4QBBA 1NLJA 2DCAA 1CV8A 1QXPA 2G8EA 1NL6A 2AUXA 4CDFB 5JA7A 2GFOA 1GLOA 2AUZA 3DF0A 1SNKA 3ERVA 5EF4A 3BCNA 3HHIA 1CVZA 3MORA 1U9VA 9PAPA 3QJ3A 1EWMA 1U9XA 2OZ2A 3TNXA 2WBFX 4YVAA 3F75A 2AS8A 4P6GA 2DCCA 1PADA 4W4UA 3QSDA 2XU1A 4YYSA 1PBHA 4P6EA 3OVXA 4BPVA 4QRVA 3RVVA 3QT4A 4CDEB 2CIOA 2FYEA 2NQGA 5A24A 1KFXL 2AIMA 3USVA 2DC6A 3KSEA 4FK5A 3BC3A 4AXMA 1CPJA 3IOQA 3IEJA 1ITOA 2DJFB 3S3QA 1AU0A 3C9EA 1VSNA 1ME4A 2JQGR 1QDQA 4G54A 1CB5A 2VHFA 1AYUA 3IUTA 2DC8A 2AYNA 1NB5A 3PNRA 4HWYA 1BGOA 3V6CA 2DCDA 4X6JA 4XR7A 1CQDA 1CSBB 4PP2E 2FRAA 2F1GA 2FUDA 2HH5A 5J94A 1PPPA 3BPFA 2FO5A 2P7UA 2OP3A 4I07A 2VHSA
chains in the Genus database with same CATH superfamily
1MDWA 2YJ9A 2FE8A 3OVZA 1CJLA 4RKXA 2DC7A 4MI7A 1SP4B 4ZTBA 1ATKA 1ZCMA 7PCKA 4KLBA 4REZA 1YVBA 3PHXA 2HD5A 3CBKA 6PADA 2DC9A 2OULA 2BTWA 1KXRA 2FTDA 3RVXA 1DEUA 3KX1A 2XU3A 1F2BA 4DMXA 2AU1A 3KWZA 4BQVA 4X6IA 2PNSA 4YYRA 8PCHA 4Q8GA 5CVOB 4ZUXU 3PDFA 1BY8A 1U5IA 1YK8A 3H89A 1JQPA 3M99A 3H8BA 5EZQA 2R9NA 3AI8A 2BDZA 1GMYA 1EWPA 2AVWA 2XU4A 1F29A 3E9SA 3RVWA 1EWOA 3H6SA 4MM3B 3OF9A 3OISA 2IPPB 1NQCA 3H7DA 4M0WA 4PT5A 1Y4HA 4DMYA 2NQDB 2PBHA 2G8JA 3CBJA 1KHPA 1NB3A 3PSEA 4I04A 3S3RA 3MTVA 3U8EA 1PPNA 1U9QX 2DZZA 3IMAA 2ATOA 3K9MA 3K24A 1KHQA 3BWKA 5CVMA 4BOZA 4QRGA 3CH2X 4AXLA 1THEA 1NPZA 3I3TA 4N4ZA 4BS5A 2HXZA 1U9WA 1XKGA 3IHPA 2ARYA 1X9YA 1CTEA 1FH0A 1AYWA 2YJBA 3RNVA 2E00A 3MP2A 2H7JA 4WURA 4OEMA 1F2AA 4D8EA 1TL9A 2DZYA 3KWBX 4RY2A 4YV8A 1O0EA 3D6SA 1HUCB 2BU3A 2J7QC 1QMYA 2JQFR 3P5VA 1PXVA 4Q8HA 3LFYA 5CVNB 4XZXA 3BOWA 1UKFA 1TLOA 2G6DA 4CZWA 2B1MA 5K16A 3IV2A 2R9MA 3OF8A 2CB5A 3LXSA 3WXGA 1PCIA 1BP4A 2YJ8A 1MEGA 4WA6A 3PHWA 2E01A 1ZIVA 2HWKA 2ACTA 4OELA 4I05A 1POPA 3MTNA 4OVZA 2O6XA 3KW9A 3WXFA 1S4VA 3W30A 3TRKA 2E03A 1BQIA 3ZUAA 4W5BA 3KFQA 2R6NA 4BOQA 4IP3A 3BY4A 3WXEA 2F7DA 4W5CA 3PT2A 4RNAA 1DKIA 2B1NA 4YYWA 4MSXA 3MJ5A 1AIMA 3C0RA 4K7CA 4A5UA 4N79A 1GCBA 5FPWA 2Y6EA 1EF7A 4OW0A 2BDLA 5PADA 3P5UA 3N4CA 2FRQA 4YYQA 1A6RA 1QOLA 4CDDB 4QH6A 4N8WA 3H8CA 3PHUA 1MIRA 4GUAA 4X6HA 2Y5BA 4QRXA 3HD3A 2HHNA 1PIPA 2XU5A 5EGWA 1MEMA 4MZSA 1GECE 2R9OA 3BBAA 3K8UA 1EWLA 3O65A 2AYOA 1MS6A 5KO3A 3E1ZB 4RF0A 4PP1A 2DJGB 3N3KA 1AECA 3BPMA 3O1GA 2P0RA 2FQ9A 3N3GA 1YALA 5CHVA 3B79A 1STFE 2GHUA 1PPOA 1ICFA 2C0YA 4PADA 1PE6A 1YZBA 3PBHA 1AYVA 4BS6A 1DF0A 3V6EA 1TU6A 1VJVA 3B21A 4BSQA 1KFUL 3P5XA 1K3BB 3MHHA 4YYUA 2R9FA 4CDCB 2DCBA 5E6JA 3HWNA 5F02A 2PADA 4MZOA 1Y08A 2NQAA 1ME3A 3KKUA 2FT2A 1Q6KA 3BB7A 5JZEA 3HHAA 3PW3A 5CHTA 1YK7A 1YT7A 2YJCA 1IWDA 2E02A 3GCBA 1PPDA 2JRIA 1F2CA 4FJCA 3IFUA 4IUMA 2DOSA 4FIPA 3CH3X 2BTWB 2P86A 1AU3A 4BOPA 2IBIA 4YYVA 2NQIA 1MHWA 1M6DA 2G7YA 5JH3A 3O0UA 2PREA 4XUIA 3MHSA 4PI3A 2YJ2A 1AU4A 3P5WA 3NHEA 2R9CA 1CS8A 3F5VA 3I06A 1AU2A 2DCAA 1NLJA 4QBBA 3ZNHA 4R3DA 1CV8A 1QXPA 2G8EA 1NL6A 2AUXA 4CDFB 5JA7A 2GFOA 1GLOA 4D8BA 2AUZA 3DF0A 4HXDB 1SNKA 3ERVA 5EF4A 3BCNA 3PRPA 3HHIA 1CVZA 3MORA 1U9VA 9PAPA 3PRMA 1EWMA 1U9XA 2OZ2A 3QJ3A 3TNXA 2WBFX 4YVAA 3F75A 2AS8A 4P6GA 2DCCA 1PADA 4W4UA 3QSDA 2XU1A 4YYSA 1PBHA 4D8IA 4P6EA 3OVXA 4BPVA 4QRVA 3RVVA 3QT4A 4CDEB 2CIOA 2FYEA 2NQGA 2AGAA 5A24A 3W31A 1KFXL 2AIMA 3USVA 2JTCA 2DC6A 3KSEA 4FK5A 3BC3A 4RF1A 4AXMA 1CPJA 3IOQA 3IEJA 1ITOA 2DJFB 3S3QA 2Z84A 1AU0A 4BOSA 3C9EA 1VSNA 1ME4A 2JQGR 1QDQA 4G54A 4BOUA 2J7QA 1CB5A 2VHFA 5EZSA 1AYUA 3IUTA 2DC8A 2AYNA 4P16A 1NB5A 3PNRA 4HWYA 1BGOA 2UZJA 3V6CA 2DCDA 4X6JA 3TMPA 4XR7A 3OQCA 1CQDA 1CSBB 4PP2E 2FRAA 2F1GA 2FUDA 2HH5A 5J94A 1PPPA 3BPFA 2FO5A 2P7UA 2OP3A 4I07A 4OVZB 1PVJA 2VHSA
chains in the Genus database with same CATH topology
1MDWA 2YJ9A 3OVZA 1CJLA 2DC7A 1SP4B 1ATKA 1ZCMA 7PCKA 4KLBA 1YVBA 2HD5A 3CBKA 6PADA 2DC9A 2OULA 1KXRA 2FTDA 3RVXA 1DEUA 3KX1A 2XU3A 1F2BA 4DMXA 2AU1A 3KWZA 4BQVA 4X6IA 2PNSA 4YYRA 8PCHA 4Q8GA 5CVOB 4ZUXU 3PDFA 1BY8A 1U5IA 1YK8A 3H89A 1JQPA 3M99A 3H8BA 2R9NA 3AI8A 2BDZA 1GMYA 1EWPA 2AVWA 2XU4A 1F29A 3RVWA 1EWOA 3H6SA 3OF9A 4C5PA 3OISA 2IPPB 1NQCA 3H7DA 1Y4HA 4DMYA 2NQDB 2PBHA 2G8JA 3CBJA 1KHPA 1NB3A 4I04A 3S3RA 3U8EA 1PPNA 1U9QX 2DZZA 3IMAA 2ATOA 3K9MA 3K24A 1KHQA 3BWKA 5CVMA 4QRGA 3CH2X 4AXLA 1THEA 1NPZA 3I3TA 4N4ZA 4BS5A 2HXZA 1U9WA 1XKGA 3IHPA 2ARYA 1X9YA 1CTEA 1FH0A 1AYWA 2VFCA 2YJBA 2E00A 2H7JA 4OEMA 1F2AA 1TL9A 2DZYA 3KWBX 4NV8A 4RY2A 4YV8A 1O0EA 3D6SA 1HUCB 1QMYA 2JQFR 3P5VA 1PXVA 4Q8HA 3LFYA 5CVNB 3BOWA 1TLOA 2G6DA 4CZWA 2B1MA 5K16A 3IV2A 2R9MA 3OF8A 2CB5A 3LXSA 3WXGA 1PCIA 1BP4A 2YJ8A 3LTWA 1MEGA 4WA6A 2E01A 1ZIVA 2ACTA 4OELA 4I05A 1POPA 3MTNA 2O6XA 3KW9A 3WXFA 1S4VA 4B55A 2E03A 1BQIA 3ZUAA 4W5BA 3KFQA 2R6NA 3D9WA 3WXEA 2F7DA 4W5CA 2B1NA 4YYWA 4MSXA 1AIMA 4K7CA 4N79A 1GCBA 5FPWA 2Y6EA 1EF7A 2BDLA 5PADA 3P5UA 3N4CA 2FRQA 4YYQA 1A6RA 1QOLA 4CDDB 4QH6A 1W5RA 4N8WA 3H8CA 1GX3A 1W6FA 1MIRA 4X6HA 2Y5BA 4QRXA 3HD3A 2HHNA 1PIPA 2XU5A 5EGWA 1MEMA 4MZSA 1GECE 2R9OA 3K8UA 1EWLA 2AYOA 1MS6A 3E1ZB 4PP1A 2DJGB 3N3KA 1AECA 3BPMA 3O1GA 2P0RA 2FQ9A 3N3GA 1YALA 5CHVA 2BSZA 1STFE 2GHUA 1PPOA 3B79A 1ICFA 2C0YA 4PADA 1PE6A 3PBHA 1AYVA 1E2TA 4BS6A 1DF0A 3V6EA 1TU6A 1VJVA 4BSQA 1KFUL 3P5XA 1K3BB 3MHHA 4YYUA 2R9FA 4CDCB 2DCBA 3HWNA 5F02A 2PADA 4MZOA 1Y08A 2NQAA 1ME3A 3KKUA 2FT2A 1Q6KA 3HHAA 3PW3A 5CHTA 1YK7A 1YT7A 2YJCA 1IWDA 2E02A 3GCBA 1PPDA 1F2CA 4FJCA 4FIPA 4BGFA 1W4TA 3CH3X 2P86A 1AU3A 2IBIA 4YYVA 2NQIA 1MHWA 1M6DA 2G7YA 5JH3A 3O0UA 2PREA 4XUIA 3MHSA 4PI3A 2YJ2A 1AU4A 3P5WA 3NHEA 4GUZA 2R9CA 1CS8A 3F5VA 3I06A 1AU2A 2DCAA 1NLJA 4QBBA 1CV8A 1QXPA 2G8EA 4NV7A 1NL6A 2AUXA 4CDFB 5JA7A 2VFBA 2GFOA 1GLOA 2AUZA 3DF0A 1SNKA 3ERVA 5EF4A 3BCNA 3HHIA 1CVZA 3MORA 1U9VA 9PAPA 3QJ3A 1EWMA 1U9XA 2OZ2A 3TNXA 2WBFX 4YVAA 3F75A 2AS8A 4P6GA 2DCCA 1PADA 4W4UA 3QSDA 2XU1A 4YYSA 1PBHA 4P6EA 3OVXA 4BPVA 4QRVA 3RVVA 3QT4A 4CDEB 2CIOA 2FYEA 2NQGA 5A24A 1KFXL 2AIMA 3USVA 2DC6A 3KSEA 4FK5A 3BC3A 4AXMA 1CPJA 3IOQA 3IEJA 1ITOA 2DJFB 3S3QA 1AU0A 3C9EA 1VSNA 1ME4A 2JQGR 1QDQA 4G54A 1CB5A 2VHFA 1AYUA 3IUTA 2DC8A 2AYNA 1NB5A 3PNRA 4HWYA 1BGOA 3V6CA 2DCDA 4X6JA 4XR7A 1CQDA 1CSBB 4PP2E 2FRAA 2F1GA 2FUDA 2HH5A 5J94A 1PPPA 3BPFA 2FO5A 2P7UA 2OP3A 4I07A 2VHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDW A;  2YJ9 A;  3OVZ A;  1CJL A;  2DC7 A;  1SP4 B;  1ATK A;  1ZCM A;  7PCK A;  4KLB A;  1YVB A;  2HD5 A;  3CBK A;  6PAD A;  2DC9 A;  2OUL A;  1KXR A;  2FTD A;  3RVX A;  1DEU A;  3KX1 A;  2XU3 A;  1F2B A;  4DMX A;  2AU1 A;  3KWZ A;  4BQV A;  4X6I A;  2PNS A;  4YYR A;  8PCH A;  4Q8G A;  5CVO B;  4ZUX U;  3PDF A;  1BY8 A;  1U5I A;  1YK8 A;  3H89 A;  1JQP A;  3M99 A;  3H8B A;  2R9N A;  3AI8 A;  2BDZ A;  1GMY A;  1EWP A;  2AVW A;  2XU4 A;  1F29 A;  3RVW A;  1EWO A;  3H6S A;  3OF9 A;  3OIS A;  2IPP B;  1NQC A;  3H7D A;  1Y4H A;  4DMY A;  2NQD B;  2PBH A;  2G8J A;  3CBJ A;  1KHP A;  1NB3 A;  4I04 A;  3S3R A;  3U8E A;  1PPN A;  1U9Q X;  2DZZ A;  3IMA A;  2ATO A;  3K9M A;  3K24 A;  1KHQ A;  3BWK A;  5CVM A;  4QRG A;  3CH2 X;  4AXL A;  1THE A;  1NPZ A;  3I3T A;  4N4Z A;  4BS5 A;  2HXZ A;  1U9W A;  1XKG A;  3IHP A;  2ARY A;  1X9Y A;  1CTE A;  1FH0 A;  1AYW A;  2YJB A;  2E00 A;  2H7J A;  4OEM A;  1F2A A;  1TL9 A;  2DZY A;  3KWB X;  4RY2 A;  4YV8 A;  1O0E A;  3D6S A;  1HUC B;  1QMY A;  2JQF R;  3P5V A;  1PXV A;  4Q8H A;  3LFY A;  5CVN B;  3BOW A;  1TLO A;  2G6D A;  4CZW A;  2B1M A;  5K16 A;  3IV2 A;  2R9M A;  3OF8 A;  2CB5 A;  3LXS A;  3WXG A;  1PCI A;  1BP4 A;  2YJ8 A;  1MEG A;  4WA6 A;  2E01 A;  1ZIV A;  2ACT A;  4OEL A;  4I05 A;  1POP A;  3MTN A;  2O6X A;  3KW9 A;  3WXF A;  1S4V A;  2E03 A;  1BQI A;  3ZUA A;  4W5B A;  3KFQ A;  2R6N A;  3WXE A;  2F7D A;  4W5C A;  2B1N A;  4YYW A;  4MSX A;  1AIM A;  4K7C A;  4N79 A;  1GCB A;  5FPW A;  2Y6E A;  1EF7 A;  2BDL A;  5PAD A;  3P5U A;  3N4C A;  2FRQ A;  4YYQ A;  1A6R A;  1QOL A;  4CDD B;  4QH6 A;  4N8W A;  3H8C A;  1MIR A;  4X6H A;  2Y5B A;  4QRX A;  3HD3 A;  2HHN A;  1PIP A;  2XU5 A;  5EGW A;  1MEM A;  4MZS A;  1GEC E;  2R9O A;  3K8U A;  1EWL A;  2AYO A;  1MS6 A;  3E1Z B;  4PP1 A;  2DJG B;  3N3K A;  1AEC A;  3BPM A;  3O1G A;  2P0R A;  2FQ9 A;  3N3G A;  1YAL A;  5CHV A;  3B79 A;  1STF E;  2GHU A;  1PPO A;  1ICF A;  2C0Y A;  4PAD A;  1PE6 A;  3PBH A;  1AYV A;  4BS6 A;  1DF0 A;  3V6E A;  1TU6 A;  1VJV A;  4BSQ A;  1KFU L;  3P5X A;  1K3B B;  3MHH A;  4YYU A;  2R9F A;  4CDC B;  2DCB A;  3HWN A;  5F02 A;  2PAD A;  4MZO A;  1Y08 A;  2NQA A;  1ME3 A;  3KKU A;  2FT2 A;  1Q6K A;  3HHA A;  3PW3 A;  5CHT A;  1YK7 A;  1YT7 A;  2YJC A;  1IWD A;  2E02 A;  3GCB A;  1PPD A;  1F2C A;  4FJC A;  4FIP A;  3CH3 X;  2P86 A;  1AU3 A;  2IBI A;  4YYV A;  2NQI A;  1MHW A;  1M6D A;  2G7Y A;  5JH3 A;  3O0U A;  2PRE A;  4XUI A;  3MHS A;  4PI3 A;  2YJ2 A;  1AU4 A;  3P5W A;  3NHE A;  2R9C A;  1CS8 A;  3F5V A;  3I06 A;  1AU2 A;  4QBB A;  1NLJ A;  2DCA A;  1CV8 A;  1QXP A;  2G8E A;  1NL6 A;  2AUX A;  4CDF B;  5JA7 A;  2GFO A;  1GLO A;  2AUZ A;  3DF0 A;  1SNK A;  3ERV A;  5EF4 A;  3BCN A;  3HHI A;  1CVZ A;  3MOR A;  1U9V A;  9PAP A;  3QJ3 A;  1EWM A;  1U9X A;  2OZ2 A;  3TNX A;  2WBF X;  4YVA A;  3F75 A;  2AS8 A;  4P6G A;  2DCC A;  1PAD A;  4W4U A;  3QSD A;  2XU1 A;  4YYS A;  1PBH A;  4P6E A;  3OVX A;  4BPV A;  4QRV A;  3RVV A;  3QT4 A;  4CDE B;  2CIO A;  2FYE A;  2NQG A;  5A24 A;  1KFX L;  2AIM A;  3USV A;  2DC6 A;  3KSE A;  4FK5 A;  3BC3 A;  4AXM A;  1CPJ A;  3IOQ A;  3IEJ A;  1ITO A;  2DJF B;  3S3Q A;  1AU0 A;  3C9E A;  1VSN A;  1ME4 A;  2JQG R;  1QDQ A;  4G54 A;  1CB5 A;  2VHF A;  1AYU A;  3IUT A;  2DC8 A;  2AYN A;  1NB5 A;  3PNR A;  4HWY A;  1BGO A;  3V6C A;  2DCD A;  4X6J A;  4XR7 A;  1CQD A;  1CSB B;  4PP2 E;  2FRA A;  2F1G A;  2FUD A;  2HH5 A;  5J94 A;  1PPP A;  3BPF A;  2FO5 A;  2P7U A;  2OP3 A;  4I07 A;  2VHS A; 
#chains in the Genus database with same CATH topology
 1MDW A;  2YJ9 A;  2FE8 A;  3OVZ A;  1CJL A;  4RKX A;  2DC7 A;  4MI7 A;  1SP4 B;  4ZTB A;  1ATK A;  1ZCM A;  7PCK A;  4KLB A;  4REZ A;  1YVB A;  3PHX A;  2HD5 A;  3CBK A;  6PAD A;  2DC9 A;  2OUL A;  2BTW A;  1KXR A;  2FTD A;  3RVX A;  1DEU A;  3KX1 A;  2XU3 A;  1F2B A;  4DMX A;  2AU1 A;  3KWZ A;  4BQV A;  4X6I A;  2PNS A;  4YYR A;  8PCH A;  4Q8G A;  5CVO B;  4ZUX U;  3PDF A;  1BY8 A;  1U5I A;  1YK8 A;  3H89 A;  1JQP A;  3M99 A;  3H8B A;  5EZQ A;  2R9N A;  3AI8 A;  2BDZ A;  1GMY A;  1EWP A;  2AVW A;  2XU4 A;  1F29 A;  3E9S A;  3RVW A;  1EWO A;  3H6S A;  4MM3 B;  3OF9 A;  3OIS A;  2IPP B;  1NQC A;  3H7D A;  4M0W A;  4PT5 A;  1Y4H A;  4DMY A;  2NQD B;  2PBH A;  2G8J A;  3CBJ A;  1KHP A;  1NB3 A;  3PSE A;  4I04 A;  3S3R A;  3MTV A;  3U8E A;  1PPN A;  1U9Q X;  2DZZ A;  3IMA A;  2ATO A;  3K9M A;  3K24 A;  1KHQ A;  3BWK A;  5CVM A;  4BOZ A;  4QRG A;  3CH2 X;  4AXL A;  1THE A;  1NPZ A;  3I3T A;  4N4Z A;  4BS5 A;  2HXZ A;  1U9W A;  1XKG A;  3IHP A;  2ARY A;  1X9Y A;  1CTE A;  1FH0 A;  1AYW A;  2YJB A;  3RNV A;  2E00 A;  3MP2 A;  2H7J A;  4WUR A;  4OEM A;  1F2A A;  4D8E A;  1TL9 A;  2DZY A;  3KWB X;  4RY2 A;  4YV8 A;  1O0E A;  3D6S A;  1HUC B;  2BU3 A;  2J7Q C;  1QMY A;  2JQF R;  3P5V A;  1PXV A;  4Q8H A;  3LFY A;  5CVN B;  4XZX A;  3BOW A;  1UKF A;  1TLO A;  2G6D A;  4CZW A;  2B1M A;  5K16 A;  3IV2 A;  2R9M A;  3OF8 A;  2CB5 A;  3LXS A;  3WXG A;  1PCI A;  1BP4 A;  2YJ8 A;  1MEG A;  4WA6 A;  3PHW A;  2E01 A;  1ZIV A;  2HWK A;  2ACT A;  4OEL A;  4I05 A;  1POP A;  3MTN A;  4OVZ A;  2O6X A;  3KW9 A;  3WXF A;  1S4V A;  3W30 A;  3TRK A;  2E03 A;  1BQI A;  3ZUA A;  4W5B A;  3KFQ A;  2R6N A;  4BOQ A;  4IP3 A;  3BY4 A;  3WXE A;  2F7D A;  4W5C A;  3PT2 A;  4RNA A;  1DKI A;  2B1N A;  4YYW A;  4MSX A;  3MJ5 A;  1AIM A;  3C0R A;  4K7C A;  4A5U A;  4N79 A;  1GCB A;  5FPW A;  2Y6E A;  1EF7 A;  4OW0 A;  2BDL A;  5PAD A;  3P5U A;  3N4C A;  2FRQ A;  4YYQ A;  1A6R A;  1QOL A;  4CDD B;  4QH6 A;  4N8W A;  3H8C A;  3PHU A;  1MIR A;  4GUA A;  4X6H A;  2Y5B A;  4QRX A;  3HD3 A;  2HHN A;  1PIP A;  2XU5 A;  5EGW A;  1MEM A;  4MZS A;  1GEC E;  2R9O A;  3BBA A;  3K8U A;  1EWL A;  3O65 A;  2AYO A;  1MS6 A;  5KO3 A;  3E1Z B;  4RF0 A;  4PP1 A;  2DJG B;  3N3K A;  1AEC A;  3BPM A;  3O1G A;  2P0R A;  2FQ9 A;  3N3G A;  1YAL A;  5CHV A;  3B79 A;  1STF E;  2GHU A;  1PPO A;  1ICF A;  2C0Y A;  4PAD A;  1PE6 A;  1YZB A;  3PBH A;  1AYV A;  4BS6 A;  1DF0 A;  3V6E A;  1TU6 A;  1VJV A;  3B21 A;  4BSQ A;  1KFU L;  3P5X A;  1K3B B;  3MHH A;  4YYU A;  2R9F A;  4CDC B;  2DCB A;  5E6J A;  3HWN A;  5F02 A;  2PAD A;  4MZO A;  1Y08 A;  2NQA A;  1ME3 A;  3KKU A;  2FT2 A;  1Q6K A;  3BB7 A;  5JZE A;  3HHA A;  3PW3 A;  5CHT A;  1YK7 A;  1YT7 A;  2YJC A;  1IWD A;  2E02 A;  3GCB A;  1PPD A;  2JRI A;  1F2C A;  4FJC A;  3IFU A;  4IUM A;  2DOS A;  4FIP A;  3CH3 X;  2BTW B;  2P86 A;  1AU3 A;  4BOP A;  2IBI A;  4YYV A;  2NQI A;  1MHW A;  1M6D A;  2G7Y A;  5JH3 A;  3O0U A;  2PRE A;  4XUI A;  3MHS A;  4PI3 A;  2YJ2 A;  1AU4 A;  3P5W A;  3NHE A;  2R9C A;  1CS8 A;  3F5V A;  3I06 A;  1AU2 A;  2DCA A;  1NLJ A;  4QBB A;  3ZNH A;  4R3D A;  1CV8 A;  1QXP A;  2G8E A;  1NL6 A;  2AUX A;  4CDF B;  5JA7 A;  2GFO A;  1GLO A;  4D8B A;  2AUZ A;  3DF0 A;  4HXD B;  1SNK A;  3ERV A;  5EF4 A;  3BCN A;  3PRP A;  3HHI A;  1CVZ A;  3MOR A;  1U9V A;  9PAP A;  3PRM A;  1EWM A;  1U9X A;  2OZ2 A;  3QJ3 A;  3TNX A;  2WBF X;  4YVA A;  3F75 A;  2AS8 A;  4P6G A;  2DCC A;  1PAD A;  4W4U A;  3QSD A;  2XU1 A;  4YYS A;  1PBH A;  4D8I A;  4P6E A;  3OVX A;  4BPV A;  4QRV A;  3RVV A;  3QT4 A;  4CDE B;  2CIO A;  2FYE A;  2NQG A;  2AGA A;  5A24 A;  3W31 A;  1KFX L;  2AIM A;  3USV A;  2JTC A;  2DC6 A;  3KSE A;  4FK5 A;  3BC3 A;  4RF1 A;  4AXM A;  1CPJ A;  3IOQ A;  3IEJ A;  1ITO A;  2DJF B;  3S3Q A;  2Z84 A;  1AU0 A;  4BOS A;  3C9E A;  1VSN A;  1ME4 A;  2JQG R;  1QDQ A;  4G54 A;  4BOU A;  2J7Q A;  1CB5 A;  2VHF A;  5EZS A;  1AYU A;  3IUT A;  2DC8 A;  2AYN A;  4P16 A;  1NB5 A;  3PNR A;  4HWY A;  1BGO A;  2UZJ A;  3V6C A;  2DCD A;  4X6J A;  3TMP A;  4XR7 A;  3OQC A;  1CQD A;  1CSB B;  4PP2 E;  2FRA A;  2F1G A;  2FUD A;  2HH5 A;  5J94 A;  1PPP A;  3BPF A;  2FO5 A;  2P7U A;  2OP3 A;  4I07 A;  4OVZ B;  1PVJ A;  2VHS A; 
#chains in the Genus database with same CATH homology
 1MDW A;  2YJ9 A;  3OVZ A;  1CJL A;  2DC7 A;  1SP4 B;  1ATK A;  1ZCM A;  7PCK A;  4KLB A;  1YVB A;  2HD5 A;  3CBK A;  6PAD A;  2DC9 A;  2OUL A;  1KXR A;  2FTD A;  3RVX A;  1DEU A;  3KX1 A;  2XU3 A;  1F2B A;  4DMX A;  2AU1 A;  3KWZ A;  4BQV A;  4X6I A;  2PNS A;  4YYR A;  8PCH A;  4Q8G A;  5CVO B;  4ZUX U;  3PDF A;  1BY8 A;  1U5I A;  1YK8 A;  3H89 A;  1JQP A;  3M99 A;  3H8B A;  2R9N A;  3AI8 A;  2BDZ A;  1GMY A;  1EWP A;  2AVW A;  2XU4 A;  1F29 A;  3RVW A;  1EWO A;  3H6S A;  3OF9 A;  4C5P A;  3OIS A;  2IPP B;  1NQC A;  3H7D A;  1Y4H A;  4DMY A;  2NQD B;  2PBH A;  2G8J A;  3CBJ A;  1KHP A;  1NB3 A;  4I04 A;  3S3R A;  3U8E A;  1PPN A;  1U9Q X;  2DZZ A;  3IMA A;  2ATO A;  3K9M A;  3K24 A;  1KHQ A;  3BWK A;  5CVM A;  4QRG A;  3CH2 X;  4AXL A;  1THE A;  1NPZ A;  3I3T A;  4N4Z A;  4BS5 A;  2HXZ A;  1U9W A;  1XKG A;  3IHP A;  2ARY A;  1X9Y A;  1CTE A;  1FH0 A;  1AYW A;  2VFC A;  2YJB A;  2E00 A;  2H7J A;  4OEM A;  1F2A A;  1TL9 A;  2DZY A;  3KWB X;  4NV8 A;  4RY2 A;  4YV8 A;  1O0E A;  3D6S A;  1HUC B;  1QMY A;  2JQF R;  3P5V A;  1PXV A;  4Q8H A;  3LFY A;  5CVN B;  3BOW A;  1TLO A;  2G6D A;  4CZW A;  2B1M A;  5K16 A;  3IV2 A;  2R9M A;  3OF8 A;  2CB5 A;  3LXS A;  3WXG A;  1PCI A;  1BP4 A;  2YJ8 A;  3LTW A;  1MEG A;  4WA6 A;  2E01 A;  1ZIV A;  2ACT A;  4OEL A;  4I05 A;  1POP A;  3MTN A;  2O6X A;  3KW9 A;  3WXF A;  1S4V A;  4B55 A;  2E03 A;  1BQI A;  3ZUA A;  4W5B A;  3KFQ A;  2R6N A;  3D9W A;  3WXE A;  2F7D A;  4W5C A;  2B1N A;  4YYW A;  4MSX A;  1AIM A;  4K7C A;  4N79 A;  1GCB A;  5FPW A;  2Y6E A;  1EF7 A;  2BDL A;  5PAD A;  3P5U A;  3N4C A;  2FRQ A;  4YYQ A;  1A6R A;  1QOL A;  4CDD B;  4QH6 A;  1W5R A;  4N8W A;  3H8C A;  1GX3 A;  1W6F A;  1MIR A;  4X6H A;  2Y5B A;  4QRX A;  3HD3 A;  2HHN A;  1PIP A;  2XU5 A;  5EGW A;  1MEM A;  4MZS A;  1GEC E;  2R9O A;  3K8U A;  1EWL A;  2AYO A;  1MS6 A;  3E1Z B;  4PP1 A;  2DJG B;  3N3K A;  1AEC A;  3BPM A;  3O1G A;  2P0R A;  2FQ9 A;  3N3G A;  1YAL A;  5CHV A;  2BSZ A;  1STF E;  2GHU A;  1PPO A;  3B79 A;  1ICF A;  2C0Y A;  4PAD A;  1PE6 A;  3PBH A;  1AYV A;  1E2T A;  4BS6 A;  1DF0 A;  3V6E A;  1TU6 A;  1VJV A;  4BSQ A;  1KFU L;  3P5X A;  1K3B B;  3MHH A;  4YYU A;  2R9F A;  4CDC B;  2DCB A;  3HWN A;  5F02 A;  2PAD A;  4MZO A;  1Y08 A;  2NQA A;  1ME3 A;  3KKU A;  2FT2 A;  1Q6K A;  3HHA A;  3PW3 A;  5CHT A;  1YK7 A;  1YT7 A;  2YJC A;  1IWD A;  2E02 A;  3GCB A;  1PPD A;  1F2C A;  4FJC A;  4FIP A;  4BGF A;  1W4T A;  3CH3 X;  2P86 A;  1AU3 A;  2IBI A;  4YYV A;  2NQI A;  1MHW A;  1M6D A;  2G7Y A;  5JH3 A;  3O0U A;  2PRE A;  4XUI A;  3MHS A;  4PI3 A;  2YJ2 A;  1AU4 A;  3P5W A;  3NHE A;  4GUZ A;  2R9C A;  1CS8 A;  3F5V A;  3I06 A;  1AU2 A;  2DCA A;  1NLJ A;  4QBB A;  1CV8 A;  1QXP A;  2G8E A;  4NV7 A;  1NL6 A;  2AUX A;  4CDF B;  5JA7 A;  2VFB A;  2GFO A;  1GLO A;  2AUZ A;  3DF0 A;  1SNK A;  3ERV A;  5EF4 A;  3BCN A;  3HHI A;  1CVZ A;  3MOR A;  1U9V A;  9PAP A;  3QJ3 A;  1EWM A;  1U9X A;  2OZ2 A;  3TNX A;  2WBF X;  4YVA A;  3F75 A;  2AS8 A;  4P6G A;  2DCC A;  1PAD A;  4W4U A;  3QSD A;  2XU1 A;  4YYS A;  1PBH A;  4P6E A;  3OVX A;  4BPV A;  4QRV A;  3RVV A;  3QT4 A;  4CDE B;  2CIO A;  2FYE A;  2NQG A;  5A24 A;  1KFX L;  2AIM A;  3USV A;  2DC6 A;  3KSE A;  4FK5 A;  3BC3 A;  4AXM A;  1CPJ A;  3IOQ A;  3IEJ A;  1ITO A;  2DJF B;  3S3Q A;  1AU0 A;  3C9E A;  1VSN A;  1ME4 A;  2JQG R;  1QDQ A;  4G54 A;  1CB5 A;  2VHF A;  1AYU A;  3IUT A;  2DC8 A;  2AYN A;  1NB5 A;  3PNR A;  4HWY A;  1BGO A;  3V6C A;  2DCD A;  4X6J A;  4XR7 A;  1CQD A;  1CSB B;  4PP2 E;  2FRA A;  2F1G A;  2FUD A;  2HH5 A;  5J94 A;  1PPP A;  3BPF A;  2FO5 A;  2P7U A;  2OP3 A;  4I07 A;  2VHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...