3HWNA

Cathepsin l with az13010160
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
220
structure length
213
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of selective Cathepsin inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin L1
total genus 59
structure length 213
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hwnA00
3IOQA 2AUXA 1U9QX 2Y6EA 3OVXA 1NLJA 3BCNA 4I05A 3CH3X 2NQDB 1F2CA 4W4UA 2HD5A 2GHUA 1DF0A 5CHTA 2YJBA 3BPMA 2AYOA 1KXRA 3K9MA 1SP4B 3AI8A 2R9MA 4CDDB 3RVVA 4FK5A 4K7CA 3BOWA 1IWDA 3N3KA 3MHSA 1Y4HA 2PADA 1HUCB 2FT2A 1GECE 2AYNA 4MZOA 2DC8A 4YVAA 2E02A 1CVZA 1MDWA 2P7UA 4HWYA 1AYUA 4PP2E 1CV8A 1MHWA 4PI3A 1S4VA 1M6DA 3QSDA 2CB5A 3PBHA 3CH2X 2F1GA 3OF8A 1PIPA 2Y5BA 3LXSA 4BS5A 4OEMA 2WBFX 4N79A 3IMAA 5A24A 4Q8HA 3P5UA 3WXGA 1PPNA 2OP3A 1POPA 3H8CA 1MIRA 4WA6A 4AXMA 2PNSA 2G8EA 1YT7A 2AU1A 1EWLA 1VSNA 1U9XA 1O0EA 1AU2A 4X6HA 2IPPB 4W5CA 1AYVA 3HHAA 3D6SA 2HHNA 2YJCA 1GMYA 2ACTA 1NL6A 3H6SA 5CVMA 3ERVA 3M99A 3HWNA 1NB3A 1PE6A 1ME4A 1EWOA 2AIMA 2ATOA 3B79A 3P5VA 4CZWA 4N8WA 1AU4A 1EWMA 4CDFB 4QRVA 1YVBA 2G8JA 2AVWA 1U9WA 1XKGA 2JQFR 3PW3A 3QJ3A 1CQDA 3DF0A 1Y08A 1K3BB 1BQIA 3NHEA 3IEJA 3KWZA 2VHFA 1BP4A 2G6DA 3P5XA 3KWBX 4G54A 2R6NA 4CDCB 3H89A 1ME3A 1NB5A 2B1MA 2DC6A 1EWPA 1MS6A 2DCBA 1PPDA 4QRXA 3QT4A 2YJ2A 2C0YA 1QOLA 2JQGR 4DMXA 3KW9A 4YYUA 2NQGA 4ZUXU 1DEUA 1GLOA 1NPZA 3WXFA 4DMYA 2F7DA 4QBBA 2AUZA 2FYEA 2PBHA 3I3TA 1QMYA 3WXEA 3KFQA 1KFXL 2HXZA 1FH0A 7PCKA 3GCBA 3IUTA 1ITOA 1NQCA 1AECA 2PREA 2DJFB 2CIOA 3IHPA 2DCAA 2XU5A 1ATKA 5JH3A 2DJGB 4YV8A 4YYSA 1TU6A 3KSEA 3OF9A 3S3RA 2FQ9A 4X6IA 4BSQA 2G7YA 3BC3A 1PPPA 4BS6A 1AU0A 2DZZA 2IBIA 5CVOB 4AXLA 3MTNA 1CSBB 3O0UA 1AIMA 2VHSA 4YYRA 2BDLA 4W5BA 4QH6A 3O1GA 1X9YA 2XU3A 4BQVA 3K8UA 3MORA 3HHIA 1U9VA 2AS8A 2FUDA 1KHQA 4RY2A 3V6CA 4CDEB 3IV2A 1YK8A 2DZYA 3H7DA 4PP1A 1PCIA 1ZIVA 1PPOA 2BDZA 1A6RA 2FRQA 5EF4A 2XU4A 3PNRA 1VJVA 1U5IA 5EGWA 1GCBA 3OVZA 3E1ZB 2B1NA 2E00A 1KFUL 3TNXA 3USVA 4I04A 1F2AA 3OISA 3S3QA 3PDFA 2DCDA 3LFYA 1ICFA 1PBHA 1CB5A 1BGOA 5F02A 3C9EA 3P5WA 4P6EA 3N4CA 5J94A 5K16A 1MEGA 1CS8A 4Q8GA 3U8EA 1QDQA 4PADA 1AYWA 1PADA 2R9FA 3H8BA 1F29A 2R9NA 3ZUAA 2ARYA 4YYQA 2FO5A 4N4ZA 1TLOA 2NQAA 2DC9A 3K24A 1KHPA 2GFOA 1CJLA 5CHVA 2DCCA 2H7JA 4FIPA 2NQIA 1STFE 4P6GA 1CTEA 3F5VA 4BPVA 4QRGA 3N3GA 3V6EA 3BPFA 4OELA 3BWKA 1JQPA 4XR7A 1MEMA 4X6JA 2XU1A 4YYVA 1PXVA 3CBKA 2YJ8A 1F2BA 5JA7A 2R9OA 1BY8A 3RVXA 1QXPA 3I06A 2HH5A 2FTDA 3F75A 2R9CA 1EF7A 1CPJA 6PADA 4YYWA 1SNKA 2YJ9A 1THEA 3RVWA 2O6XA 5PADA 1ZCMA 4MZSA 4MSXA 3HD3A 3KX1A 8PCHA 5CVNB 2P0RA 9PAPA 4I07A 4FJCA 3KKUA 1YALA 2OULA 2OZ2A 4XUIA 2E03A 1AU3A 1TL9A 4KLBA 2FRAA 2P86A 1Q6KA 3CBJA 3MHHA 2DC7A 1YK7A 5FPWA 2E01A
chains in the Genus database with same CATH superfamily
4HXDB 3IOQA 2AUXA 1U9QX 2Y6EA 3OVXA 1NLJA 3BCNA 4I05A 3B21A 3CH3X 2NQDB 1F2CA 4BOUA 4W4UA 2HD5A 2GHUA 3PRPA 1DF0A 5CHTA 2YJBA 3BPMA 2AYOA 1KXRA 3K9MA 1SP4B 3AI8A 2R9MA 4CDDB 3RVVA 4FK5A 4K7CA 4D8BA 3BOWA 3C0RA 3W30A 1IWDA 3IFUA 3N3KA 3MHSA 1Y4HA 2PADA 1DKIA 4R3DA 1HUCB 2FT2A 1GECE 2AYNA 4MZOA 4A5UA 2DC8A 4BOQA 4YVAA 2E02A 1CVZA 1MDWA 2P7UA 4HWYA 1AYUA 4PP2E 3PT2A 1CV8A 1MHWA 4PI3A 1S4VA 1M6DA 3QSDA 2CB5A 3PBHA 3CH2X 2F1GA 2J7QC 3OF8A 1PIPA 2Y5BA 3LXSA 2JTCA 4BS5A 4OEMA 3TRKA 2WBFX 4RNAA 4N79A 3IMAA 5A24A 4Q8HA 3P5UA 5E6JA 3WXGA 1PPNA 2OP3A 3BB7A 1POPA 3H8CA 1MIRA 4WA6A 4AXMA 2PNSA 2G8EA 1YT7A 2AU1A 3PSEA 1EWLA 1VSNA 1U9XA 1O0EA 4RF1A 1AU2A 3BBAA 4X6HA 2IPPB 4W5CA 1AYVA 4RF0A 3HHAA 3D6SA 2HHNA 3PHXA 1YZBA 4WURA 2YJCA 1GMYA 2BTWA 2ACTA 1NL6A 3H6SA 5CVMA 3ERVA 3MTVA 3M99A 4ZTBA 3HWNA 4IP3A 1NB3A 1PE6A 2J7QA 1ME4A 1EWOA 2AIMA 2ATOA 3B79A 3P5VA 4CZWA 4N8WA 1AU4A 1EWMA 4CDFB 4QRVA 1YVBA 2G8JA 2AVWA 1U9WA 1XKGA 2JQFR 3PW3A 3QJ3A 1CQDA 3DF0A 1Y08A 2AGAA 1K3BB 1BQIA 3NHEA 3IEJA 4REZA 3KWZA 2VHFA 1BP4A 2G6DA 3P5XA 3KWBX 4G54A 2R6NA 4CDCB 4BOPA 3H89A 4D8EA 1ME3A 1NB5A 2B1MA 5KO3A 2DC6A 1EWPA 1MS6A 2DCBA 1PPDA 4QRXA 3QT4A 2YJ2A 2C0YA 1QOLA 2JQGR 4DMXA 3KW9A 4BOSA 4YYUA 2NQGA 4ZUXU 1DEUA 1GLOA 1NPZA 3WXFA 4DMYA 2F7DA 4QBBA 4OVZA 2AUZA 2FYEA 2PBHA 3I3TA 1QMYA 3WXEA 3KFQA 1KFXL 2HXZA 1FH0A 7PCKA 3GCBA 3IUTA 1ITOA 1NQCA 1AECA 2PREA 2DJFB 5EZQA 4RKXA 2CIOA 3IHPA 2DCAA 2XU5A 1ATKA 3MP2A 5JH3A 2DJGB 4YV8A 4YYSA 3MJ5A 1TU6A 3KSEA 4MI7A 2FE8A 3OF9A 2FQ9A 4X6IA 3S3RA 4BSQA 2UZJA 2G7YA 3BC3A 3PHUA 4D8IA 1PPPA 3O65A 4BS6A 1UKFA 1AU0A 2DZZA 2IBIA 5CVOB 4AXLA 3MTNA 4OW0A 1CSBB 3O0UA 1AIMA 3PHWA 2VHSA 4MM3B 4YYRA 4GUAA 4BOZA 2BDLA 4W5BA 4QH6A 3O1GA 1X9YA 2XU3A 2BU3A 4BQVA 3K8UA 5EZSA 3MORA 4OVZB 2HWKA 3HHIA 1U9VA 2AS8A 2FUDA 1KHQA 4RY2A 3V6CA 4CDEB 3IV2A 1YK8A 2DZYA 3H7DA 4PP1A 1PCIA 1ZIVA 1PPOA 2BDZA 1A6RA 2FRQA 5EF4A 2XU4A 3PNRA 1VJVA 1U5IA 5EGWA 1GCBA 3OVZA 3E1ZB 2B1NA 2E00A 1KFUL 3TNXA 3USVA 3PRMA 4I04A 1F2AA 3OISA 3S3QA 3PDFA 3W31A 3OQCA 2DCDA 3LFYA 1ICFA 4IUMA 1PBHA 1CB5A 1BGOA 5F02A 3ZNHA 3C9EA 3P5WA 4P6EA 3N4CA 5J94A 5K16A 1MEGA 1CS8A 4Q8GA 1PVJA 4P16A 4M0WA 3U8EA 1QDQA 4PADA 1AYWA 1PADA 2R9FA 3H8BA 1F29A 2R9NA 3ZUAA 2ARYA 4PT5A 4YYQA 2FO5A 4N4ZA 1TLOA 2NQAA 2DC9A 3K24A 1KHPA 2GFOA 1CJLA 5CHVA 2DCCA 2H7JA 4FIPA 2NQIA 1STFE 4P6GA 1CTEA 3E9SA 3F5VA 4BPVA 4QRGA 3N3GA 3V6EA 3BPFA 4OELA 3BWKA 1JQPA 4XR7A 1MEMA 4X6JA 2XU1A 4YYVA 1PXVA 3CBKA 2YJ8A 1F2BA 2Z84A 5JA7A 2R9OA 3TMPA 1BY8A 2JRIA 3RVXA 1QXPA 3I06A 2HH5A 2DOSA 2FTDA 3F75A 2R9CA 1EF7A 1CPJA 6PADA 4YYWA 1SNKA 2YJ9A 1THEA 3BY4A 3RVWA 2O6XA 5PADA 1ZCMA 4XZXA 4MZSA 4MSXA 3HD3A 3KX1A 8PCHA 5CVNB 2P0RA 9PAPA 4I07A 4FJCA 3KKUA 1YALA 2BTWB 2OULA 2OZ2A 4XUIA 2E03A 1AU3A 1TL9A 4KLBA 3RNVA 2FRAA 2P86A 1Q6KA 3CBJA 3MHHA 2DC7A 5JZEA 1YK7A 5FPWA 2E01A
chains in the Genus database with same CATH topology
3IOQA 2AUXA 1U9QX 2Y6EA 3OVXA 1NLJA 3BCNA 4I05A 3CH3X 2NQDB 1F2CA 4W4UA 2HD5A 2GHUA 1DF0A 5CHTA 2YJBA 3BPMA 2AYOA 1KXRA 3K9MA 1SP4B 3AI8A 2R9MA 4CDDB 3RVVA 4FK5A 4K7CA 3BOWA 1IWDA 3N3KA 3MHSA 1Y4HA 2PADA 1HUCB 2FT2A 1GECE 2AYNA 4MZOA 2DC8A 1E2TA 4YVAA 2E02A 1CVZA 1MDWA 2P7UA 4HWYA 1AYUA 4PP2E 1CV8A 1MHWA 4PI3A 1S4VA 1M6DA 3QSDA 2CB5A 3PBHA 3CH2X 2F1GA 3OF8A 1PIPA 2Y5BA 3LXSA 4BS5A 4OEMA 2WBFX 4N79A 3IMAA 5A24A 4Q8HA 3P5UA 3WXGA 1PPNA 2OP3A 1POPA 1W4TA 3H8CA 1MIRA 4WA6A 4AXMA 2PNSA 2G8EA 1YT7A 2AU1A 1EWLA 1VSNA 1U9XA 1O0EA 1AU2A 4X6HA 2IPPB 4W5CA 1AYVA 3HHAA 3D6SA 2HHNA 2YJCA 1GMYA 2ACTA 1NL6A 3H6SA 5CVMA 3ERVA 3M99A 3HWNA 1NB3A 1PE6A 1ME4A 1EWOA 2AIMA 1GX3A 2ATOA 3B79A 3P5VA 4CZWA 4N8WA 1AU4A 1EWMA 4CDFB 4QRVA 1YVBA 2G8JA 2AVWA 1U9WA 1XKGA 2JQFR 3PW3A 3QJ3A 1CQDA 3DF0A 1Y08A 1K3BB 1BQIA 3NHEA 3IEJA 3KWZA 4NV8A 2VHFA 1BP4A 2G6DA 3P5XA 3KWBX 1W6FA 4G54A 2R6NA 4CDCB 3H89A 1ME3A 1NB5A 2B1MA 2DC6A 1EWPA 1MS6A 2DCBA 1PPDA 4QRXA 3QT4A 2YJ2A 2C0YA 1QOLA 2JQGR 4NV7A 4DMXA 3KW9A 4YYUA 2NQGA 4ZUXU 1DEUA 1GLOA 1NPZA 3WXFA 4DMYA 2F7DA 4QBBA 2AUZA 2FYEA 2PBHA 3I3TA 1QMYA 3WXEA 3KFQA 1KFXL 2HXZA 1FH0A 4B55A 7PCKA 3GCBA 3IUTA 1ITOA 1NQCA 1AECA 2PREA 2DJFB 2CIOA 3IHPA 2DCAA 2XU5A 1ATKA 5JH3A 2DJGB 4YV8A 4YYSA 1TU6A 3KSEA 3OF9A 3S3RA 2FQ9A 4X6IA 4BSQA 2G7YA 3BC3A 1PPPA 3D9WA 4BS6A 1AU0A 2DZZA 2IBIA 5CVOB 4AXLA 3MTNA 1CSBB 3O0UA 1AIMA 2VHSA 4YYRA 2BDLA 4W5BA 4QH6A 3O1GA 1X9YA 2XU3A 4BQVA 3K8UA 3MORA 3HHIA 1U9VA 2AS8A 2FUDA 1KHQA 4RY2A 3V6CA 4CDEB 3IV2A 1YK8A 2DZYA 3H7DA 2BSZA 4PP1A 1PCIA 1ZIVA 1PPOA 2BDZA 1A6RA 2FRQA 5EF4A 2XU4A 3PNRA 1VJVA 1U5IA 5EGWA 1GCBA 3OVZA 3E1ZB 2B1NA 2E00A 1KFUL 3TNXA 3USVA 4I04A 1F2AA 3OISA 3S3QA 3PDFA 2DCDA 3LFYA 1ICFA 4BGFA 2VFCA 1PBHA 1CB5A 1BGOA 3LTWA 5F02A 3C9EA 3P5WA 4P6EA 3N4CA 5J94A 5K16A 1MEGA 1CS8A 4Q8GA 3U8EA 1QDQA 4PADA 1AYWA 1PADA 2R9FA 3H8BA 1F29A 2R9NA 3ZUAA 2ARYA 4YYQA 2FO5A 4N4ZA 1TLOA 2NQAA 2DC9A 3K24A 1KHPA 1W5RA 2GFOA 1CJLA 5CHVA 2DCCA 2H7JA 4FIPA 2NQIA 1STFE 4P6GA 1CTEA 3F5VA 4C5PA 4BPVA 4QRGA 3N3GA 3V6EA 3BPFA 4OELA 3BWKA 1JQPA 4XR7A 1MEMA 4X6JA 2XU1A 4YYVA 1PXVA 3CBKA 2YJ8A 1F2BA 5JA7A 2R9OA 1BY8A 3RVXA 1QXPA 3I06A 2HH5A 2FTDA 3F75A 2R9CA 1EF7A 1CPJA 6PADA 4YYWA 1SNKA 2YJ9A 1THEA 3RVWA 2O6XA 5PADA 1ZCMA 4MZSA 4MSXA 3HD3A 3KX1A 8PCHA 5CVNB 2P0RA 9PAPA 4I07A 4FJCA 3KKUA 1YALA 2OULA 2OZ2A 4GUZA 4XUIA 2E03A 1AU3A 1TL9A 4KLBA 2FRAA 2P86A 1Q6KA 3CBJA 3MHHA 2DC7A 1YK7A 2VFBA 5FPWA 2E01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IOQ A;  2AUX A;  1U9Q X;  2Y6E A;  3OVX A;  1NLJ A;  3BCN A;  4I05 A;  3CH3 X;  2NQD B;  1F2C A;  4W4U A;  2HD5 A;  2GHU A;  1DF0 A;  5CHT A;  2YJB A;  3BPM A;  2AYO A;  1KXR A;  3K9M A;  1SP4 B;  3AI8 A;  2R9M A;  4CDD B;  3RVV A;  4FK5 A;  4K7C A;  3BOW A;  1IWD A;  3N3K A;  3MHS A;  1Y4H A;  2PAD A;  1HUC B;  2FT2 A;  1GEC E;  2AYN A;  4MZO A;  2DC8 A;  4YVA A;  2E02 A;  1CVZ A;  1MDW A;  2P7U A;  4HWY A;  1AYU A;  4PP2 E;  1CV8 A;  1MHW A;  4PI3 A;  1S4V A;  1M6D A;  3QSD A;  2CB5 A;  3PBH A;  3CH2 X;  2F1G A;  3OF8 A;  1PIP A;  2Y5B A;  3LXS A;  4BS5 A;  4OEM A;  2WBF X;  4N79 A;  3IMA A;  5A24 A;  4Q8H A;  3P5U A;  3WXG A;  1PPN A;  2OP3 A;  1POP A;  3H8C A;  1MIR A;  4WA6 A;  4AXM A;  2PNS A;  2G8E A;  1YT7 A;  2AU1 A;  1EWL A;  1VSN A;  1U9X A;  1O0E A;  1AU2 A;  4X6H A;  2IPP B;  4W5C A;  1AYV A;  3HHA A;  3D6S A;  2HHN A;  2YJC A;  1GMY A;  2ACT A;  1NL6 A;  3H6S A;  5CVM A;  3ERV A;  3M99 A;  3HWN A;  1NB3 A;  1PE6 A;  1ME4 A;  1EWO A;  2AIM A;  2ATO A;  3B79 A;  3P5V A;  4CZW A;  4N8W A;  1AU4 A;  1EWM A;  4CDF B;  4QRV A;  1YVB A;  2G8J A;  2AVW A;  1U9W A;  1XKG A;  2JQF R;  3PW3 A;  3QJ3 A;  1CQD A;  3DF0 A;  1Y08 A;  1K3B B;  1BQI A;  3NHE A;  3IEJ A;  3KWZ A;  2VHF A;  1BP4 A;  2G6D A;  3P5X A;  3KWB X;  4G54 A;  2R6N A;  4CDC B;  3H89 A;  1ME3 A;  1NB5 A;  2B1M A;  2DC6 A;  1EWP A;  1MS6 A;  2DCB A;  1PPD A;  4QRX A;  3QT4 A;  2YJ2 A;  2C0Y A;  1QOL A;  2JQG R;  4DMX A;  3KW9 A;  4YYU A;  2NQG A;  4ZUX U;  1DEU A;  1GLO A;  1NPZ A;  3WXF A;  4DMY A;  2F7D A;  4QBB A;  2AUZ A;  2FYE A;  2PBH A;  3I3T A;  1QMY A;  3WXE A;  3KFQ A;  1KFX L;  2HXZ A;  1FH0 A;  7PCK A;  3GCB A;  3IUT A;  1ITO A;  1NQC A;  1AEC A;  2PRE A;  2DJF B;  2CIO A;  3IHP A;  2DCA A;  2XU5 A;  1ATK A;  5JH3 A;  2DJG B;  4YV8 A;  4YYS A;  1TU6 A;  3KSE A;  3OF9 A;  3S3R A;  2FQ9 A;  4X6I A;  4BSQ A;  2G7Y A;  3BC3 A;  1PPP A;  4BS6 A;  1AU0 A;  2DZZ A;  2IBI A;  5CVO B;  4AXL A;  3MTN A;  1CSB B;  3O0U A;  1AIM A;  2VHS A;  4YYR A;  2BDL A;  4W5B A;  4QH6 A;  3O1G A;  1X9Y A;  2XU3 A;  4BQV A;  3K8U A;  3MOR A;  3HHI A;  1U9V A;  2AS8 A;  2FUD A;  1KHQ A;  4RY2 A;  3V6C A;  4CDE B;  3IV2 A;  1YK8 A;  2DZY A;  3H7D A;  4PP1 A;  1PCI A;  1ZIV A;  1PPO A;  2BDZ A;  1A6R A;  2FRQ A;  5EF4 A;  2XU4 A;  3PNR A;  1VJV A;  1U5I A;  5EGW A;  1GCB A;  3OVZ A;  3E1Z B;  2B1N A;  2E00 A;  1KFU L;  3TNX A;  3USV A;  4I04 A;  1F2A A;  3OIS A;  3S3Q A;  3PDF A;  2DCD A;  3LFY A;  1ICF A;  1PBH A;  1CB5 A;  1BGO A;  5F02 A;  3C9E A;  3P5W A;  4P6E A;  3N4C A;  5J94 A;  5K16 A;  1MEG A;  1CS8 A;  4Q8G A;  3U8E A;  1QDQ A;  4PAD A;  1AYW A;  1PAD A;  2R9F A;  3H8B A;  1F29 A;  2R9N A;  3ZUA A;  2ARY A;  4YYQ A;  2FO5 A;  4N4Z A;  1TLO A;  2NQA A;  2DC9 A;  3K24 A;  1KHP A;  2GFO A;  1CJL A;  5CHV A;  2DCC A;  2H7J A;  4FIP A;  2NQI A;  1STF E;  4P6G A;  1CTE A;  3F5V A;  4BPV A;  4QRG A;  3N3G A;  3V6E A;  3BPF A;  4OEL A;  3BWK A;  1JQP A;  4XR7 A;  1MEM A;  4X6J A;  2XU1 A;  4YYV A;  1PXV A;  3CBK A;  2YJ8 A;  1F2B A;  5JA7 A;  2R9O A;  1BY8 A;  3RVX A;  1QXP A;  3I06 A;  2HH5 A;  2FTD A;  3F75 A;  2R9C A;  1EF7 A;  1CPJ A;  6PAD A;  4YYW A;  1SNK A;  2YJ9 A;  1THE A;  3RVW A;  2O6X A;  5PAD A;  1ZCM A;  4MZS A;  4MSX A;  3HD3 A;  3KX1 A;  8PCH A;  5CVN B;  2P0R A;  9PAP A;  4I07 A;  4FJC A;  3KKU A;  1YAL A;  2OUL A;  2OZ2 A;  4XUI A;  2E03 A;  1AU3 A;  1TL9 A;  4KLB A;  2FRA A;  2P86 A;  1Q6K A;  3CBJ A;  3MHH A;  2DC7 A;  1YK7 A;  5FPW A;  2E01 A; 
#chains in the Genus database with same CATH topology
 4HXD B;  3IOQ A;  2AUX A;  1U9Q X;  2Y6E A;  3OVX A;  1NLJ A;  3BCN A;  4I05 A;  3B21 A;  3CH3 X;  2NQD B;  1F2C A;  4BOU A;  4W4U A;  2HD5 A;  2GHU A;  3PRP A;  1DF0 A;  5CHT A;  2YJB A;  3BPM A;  2AYO A;  1KXR A;  3K9M A;  1SP4 B;  3AI8 A;  2R9M A;  4CDD B;  3RVV A;  4FK5 A;  4K7C A;  4D8B A;  3BOW A;  3C0R A;  3W30 A;  1IWD A;  3IFU A;  3N3K A;  3MHS A;  1Y4H A;  2PAD A;  1DKI A;  4R3D A;  1HUC B;  2FT2 A;  1GEC E;  2AYN A;  4MZO A;  4A5U A;  2DC8 A;  4BOQ A;  4YVA A;  2E02 A;  1CVZ A;  1MDW A;  2P7U A;  4HWY A;  1AYU A;  4PP2 E;  3PT2 A;  1CV8 A;  1MHW A;  4PI3 A;  1S4V A;  1M6D A;  3QSD A;  2CB5 A;  3PBH A;  3CH2 X;  2F1G A;  2J7Q C;  3OF8 A;  1PIP A;  2Y5B A;  3LXS A;  2JTC A;  4BS5 A;  4OEM A;  3TRK A;  2WBF X;  4RNA A;  4N79 A;  3IMA A;  5A24 A;  4Q8H A;  3P5U A;  5E6J A;  3WXG A;  1PPN A;  2OP3 A;  3BB7 A;  1POP A;  3H8C A;  1MIR A;  4WA6 A;  4AXM A;  2PNS A;  2G8E A;  1YT7 A;  2AU1 A;  3PSE A;  1EWL A;  1VSN A;  1U9X A;  1O0E A;  4RF1 A;  1AU2 A;  3BBA A;  4X6H A;  2IPP B;  4W5C A;  1AYV A;  4RF0 A;  3HHA A;  3D6S A;  2HHN A;  3PHX A;  1YZB A;  4WUR A;  2YJC A;  1GMY A;  2BTW A;  2ACT A;  1NL6 A;  3H6S A;  5CVM A;  3ERV A;  3MTV A;  3M99 A;  4ZTB A;  3HWN A;  4IP3 A;  1NB3 A;  1PE6 A;  2J7Q A;  1ME4 A;  1EWO A;  2AIM A;  2ATO A;  3B79 A;  3P5V A;  4CZW A;  4N8W A;  1AU4 A;  1EWM A;  4CDF B;  4QRV A;  1YVB A;  2G8J A;  2AVW A;  1U9W A;  1XKG A;  2JQF R;  3PW3 A;  3QJ3 A;  1CQD A;  3DF0 A;  1Y08 A;  2AGA A;  1K3B B;  1BQI A;  3NHE A;  3IEJ A;  4REZ A;  3KWZ A;  2VHF A;  1BP4 A;  2G6D A;  3P5X A;  3KWB X;  4G54 A;  2R6N A;  4CDC B;  4BOP A;  3H89 A;  4D8E A;  1ME3 A;  1NB5 A;  2B1M A;  5KO3 A;  2DC6 A;  1EWP A;  1MS6 A;  2DCB A;  1PPD A;  4QRX A;  3QT4 A;  2YJ2 A;  2C0Y A;  1QOL A;  2JQG R;  4DMX A;  3KW9 A;  4BOS A;  4YYU A;  2NQG A;  4ZUX U;  1DEU A;  1GLO A;  1NPZ A;  3WXF A;  4DMY A;  2F7D A;  4QBB A;  4OVZ A;  2AUZ A;  2FYE A;  2PBH A;  3I3T A;  1QMY A;  3WXE A;  3KFQ A;  1KFX L;  2HXZ A;  1FH0 A;  7PCK A;  3GCB A;  3IUT A;  1ITO A;  1NQC A;  1AEC A;  2PRE A;  2DJF B;  5EZQ A;  4RKX A;  2CIO A;  3IHP A;  2DCA A;  2XU5 A;  1ATK A;  3MP2 A;  5JH3 A;  2DJG B;  4YV8 A;  4YYS A;  3MJ5 A;  1TU6 A;  3KSE A;  4MI7 A;  2FE8 A;  3OF9 A;  2FQ9 A;  4X6I A;  3S3R A;  4BSQ A;  2UZJ A;  2G7Y A;  3BC3 A;  3PHU A;  4D8I A;  1PPP A;  3O65 A;  4BS6 A;  1UKF A;  1AU0 A;  2DZZ A;  2IBI A;  5CVO B;  4AXL A;  3MTN A;  4OW0 A;  1CSB B;  3O0U A;  1AIM A;  3PHW A;  2VHS A;  4MM3 B;  4YYR A;  4GUA A;  4BOZ A;  2BDL A;  4W5B A;  4QH6 A;  3O1G A;  1X9Y A;  2XU3 A;  2BU3 A;  4BQV A;  3K8U A;  5EZS A;  3MOR A;  4OVZ B;  2HWK A;  3HHI A;  1U9V A;  2AS8 A;  2FUD A;  1KHQ A;  4RY2 A;  3V6C A;  4CDE B;  3IV2 A;  1YK8 A;  2DZY A;  3H7D A;  4PP1 A;  1PCI A;  1ZIV A;  1PPO A;  2BDZ A;  1A6R A;  2FRQ A;  5EF4 A;  2XU4 A;  3PNR A;  1VJV A;  1U5I A;  5EGW A;  1GCB A;  3OVZ A;  3E1Z B;  2B1N A;  2E00 A;  1KFU L;  3TNX A;  3USV A;  3PRM A;  4I04 A;  1F2A A;  3OIS A;  3S3Q A;  3PDF A;  3W31 A;  3OQC A;  2DCD A;  3LFY A;  1ICF A;  4IUM A;  1PBH A;  1CB5 A;  1BGO A;  5F02 A;  3ZNH A;  3C9E A;  3P5W A;  4P6E A;  3N4C A;  5J94 A;  5K16 A;  1MEG A;  1CS8 A;  4Q8G A;  1PVJ A;  4P16 A;  4M0W A;  3U8E A;  1QDQ A;  4PAD A;  1AYW A;  1PAD A;  2R9F A;  3H8B A;  1F29 A;  2R9N A;  3ZUA A;  2ARY A;  4PT5 A;  4YYQ A;  2FO5 A;  4N4Z A;  1TLO A;  2NQA A;  2DC9 A;  3K24 A;  1KHP A;  2GFO A;  1CJL A;  5CHV A;  2DCC A;  2H7J A;  4FIP A;  2NQI A;  1STF E;  4P6G A;  1CTE A;  3E9S A;  3F5V A;  4BPV A;  4QRG A;  3N3G A;  3V6E A;  3BPF A;  4OEL A;  3BWK A;  1JQP A;  4XR7 A;  1MEM A;  4X6J A;  2XU1 A;  4YYV A;  1PXV A;  3CBK A;  2YJ8 A;  1F2B A;  2Z84 A;  5JA7 A;  2R9O A;  3TMP A;  1BY8 A;  2JRI A;  3RVX A;  1QXP A;  3I06 A;  2HH5 A;  2DOS A;  2FTD A;  3F75 A;  2R9C A;  1EF7 A;  1CPJ A;  6PAD A;  4YYW A;  1SNK A;  2YJ9 A;  1THE A;  3BY4 A;  3RVW A;  2O6X A;  5PAD A;  1ZCM A;  4XZX A;  4MZS A;  4MSX A;  3HD3 A;  3KX1 A;  8PCH A;  5CVN B;  2P0R A;  9PAP A;  4I07 A;  4FJC A;  3KKU A;  1YAL A;  2BTW B;  2OUL A;  2OZ2 A;  4XUI A;  2E03 A;  1AU3 A;  1TL9 A;  4KLB A;  3RNV A;  2FRA A;  2P86 A;  1Q6K A;  3CBJ A;  3MHH A;  2DC7 A;  5JZE A;  1YK7 A;  5FPW A;  2E01 A; 
#chains in the Genus database with same CATH homology
 3IOQ A;  2AUX A;  1U9Q X;  2Y6E A;  3OVX A;  1NLJ A;  3BCN A;  4I05 A;  3CH3 X;  2NQD B;  1F2C A;  4W4U A;  2HD5 A;  2GHU A;  1DF0 A;  5CHT A;  2YJB A;  3BPM A;  2AYO A;  1KXR A;  3K9M A;  1SP4 B;  3AI8 A;  2R9M A;  4CDD B;  3RVV A;  4FK5 A;  4K7C A;  3BOW A;  1IWD A;  3N3K A;  3MHS A;  1Y4H A;  2PAD A;  1HUC B;  2FT2 A;  1GEC E;  2AYN A;  4MZO A;  2DC8 A;  1E2T A;  4YVA A;  2E02 A;  1CVZ A;  1MDW A;  2P7U A;  4HWY A;  1AYU A;  4PP2 E;  1CV8 A;  1MHW A;  4PI3 A;  1S4V A;  1M6D A;  3QSD A;  2CB5 A;  3PBH A;  3CH2 X;  2F1G A;  3OF8 A;  1PIP A;  2Y5B A;  3LXS A;  4BS5 A;  4OEM A;  2WBF X;  4N79 A;  3IMA A;  5A24 A;  4Q8H A;  3P5U A;  3WXG A;  1PPN A;  2OP3 A;  1POP A;  1W4T A;  3H8C A;  1MIR A;  4WA6 A;  4AXM A;  2PNS A;  2G8E A;  1YT7 A;  2AU1 A;  1EWL A;  1VSN A;  1U9X A;  1O0E A;  1AU2 A;  4X6H A;  2IPP B;  4W5C A;  1AYV A;  3HHA A;  3D6S A;  2HHN A;  2YJC A;  1GMY A;  2ACT A;  1NL6 A;  3H6S A;  5CVM A;  3ERV A;  3M99 A;  3HWN A;  1NB3 A;  1PE6 A;  1ME4 A;  1EWO A;  2AIM A;  1GX3 A;  2ATO A;  3B79 A;  3P5V A;  4CZW A;  4N8W A;  1AU4 A;  1EWM A;  4CDF B;  4QRV A;  1YVB A;  2G8J A;  2AVW A;  1U9W A;  1XKG A;  2JQF R;  3PW3 A;  3QJ3 A;  1CQD A;  3DF0 A;  1Y08 A;  1K3B B;  1BQI A;  3NHE A;  3IEJ A;  3KWZ A;  4NV8 A;  2VHF A;  1BP4 A;  2G6D A;  3P5X A;  3KWB X;  1W6F A;  4G54 A;  2R6N A;  4CDC B;  3H89 A;  1ME3 A;  1NB5 A;  2B1M A;  2DC6 A;  1EWP A;  1MS6 A;  2DCB A;  1PPD A;  4QRX A;  3QT4 A;  2YJ2 A;  2C0Y A;  1QOL A;  2JQG R;  4NV7 A;  4DMX A;  3KW9 A;  4YYU A;  2NQG A;  4ZUX U;  1DEU A;  1GLO A;  1NPZ A;  3WXF A;  4DMY A;  2F7D A;  4QBB A;  2AUZ A;  2FYE A;  2PBH A;  3I3T A;  1QMY A;  3WXE A;  3KFQ A;  1KFX L;  2HXZ A;  1FH0 A;  4B55 A;  7PCK A;  3GCB A;  3IUT A;  1ITO A;  1NQC A;  1AEC A;  2PRE A;  2DJF B;  2CIO A;  3IHP A;  2DCA A;  2XU5 A;  1ATK A;  5JH3 A;  2DJG B;  4YV8 A;  4YYS A;  1TU6 A;  3KSE A;  3OF9 A;  3S3R A;  2FQ9 A;  4X6I A;  4BSQ A;  2G7Y A;  3BC3 A;  1PPP A;  3D9W A;  4BS6 A;  1AU0 A;  2DZZ A;  2IBI A;  5CVO B;  4AXL A;  3MTN A;  1CSB B;  3O0U A;  1AIM A;  2VHS A;  4YYR A;  2BDL A;  4W5B A;  4QH6 A;  3O1G A;  1X9Y A;  2XU3 A;  4BQV A;  3K8U A;  3MOR A;  3HHI A;  1U9V A;  2AS8 A;  2FUD A;  1KHQ A;  4RY2 A;  3V6C A;  4CDE B;  3IV2 A;  1YK8 A;  2DZY A;  3H7D A;  2BSZ A;  4PP1 A;  1PCI A;  1ZIV A;  1PPO A;  2BDZ A;  1A6R A;  2FRQ A;  5EF4 A;  2XU4 A;  3PNR A;  1VJV A;  1U5I A;  5EGW A;  1GCB A;  3OVZ A;  3E1Z B;  2B1N A;  2E00 A;  1KFU L;  3TNX A;  3USV A;  4I04 A;  1F2A A;  3OIS A;  3S3Q A;  3PDF A;  2DCD A;  3LFY A;  1ICF A;  4BGF A;  2VFC A;  1PBH A;  1CB5 A;  1BGO A;  3LTW A;  5F02 A;  3C9E A;  3P5W A;  4P6E A;  3N4C A;  5J94 A;  5K16 A;  1MEG A;  1CS8 A;  4Q8G A;  3U8E A;  1QDQ A;  4PAD A;  1AYW A;  1PAD A;  2R9F A;  3H8B A;  1F29 A;  2R9N A;  3ZUA A;  2ARY A;  4YYQ A;  2FO5 A;  4N4Z A;  1TLO A;  2NQA A;  2DC9 A;  3K24 A;  1KHP A;  1W5R A;  2GFO A;  1CJL A;  5CHV A;  2DCC A;  2H7J A;  4FIP A;  2NQI A;  1STF E;  4P6G A;  1CTE A;  3F5V A;  4C5P A;  4BPV A;  4QRG A;  3N3G A;  3V6E A;  3BPF A;  4OEL A;  3BWK A;  1JQP A;  4XR7 A;  1MEM A;  4X6J A;  2XU1 A;  4YYV A;  1PXV A;  3CBK A;  2YJ8 A;  1F2B A;  5JA7 A;  2R9O A;  1BY8 A;  3RVX A;  1QXP A;  3I06 A;  2HH5 A;  2FTD A;  3F75 A;  2R9C A;  1EF7 A;  1CPJ A;  6PAD A;  4YYW A;  1SNK A;  2YJ9 A;  1THE A;  3RVW A;  2O6X A;  5PAD A;  1ZCM A;  4MZS A;  4MSX A;  3HD3 A;  3KX1 A;  8PCH A;  5CVN B;  2P0R A;  9PAP A;  4I07 A;  4FJC A;  3KKU A;  1YAL A;  2OUL A;  2OZ2 A;  4GUZ A;  4XUI A;  2E03 A;  1AU3 A;  1TL9 A;  4KLB A;  2FRA A;  2P86 A;  1Q6K A;  3CBJ A;  3MHH A;  2DC7 A;  1YK7 A;  2VFB A;  5FPW A;  2E01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...