3HWNA

Cathepsin l with az13010160
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
220
structure length
213
Chain Sequence
b'APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L1
publication title Design of selective Cathepsin inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 213
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hwnA00
2R9OA 1NB3A 2AYOA 3ERVA 3N4CA 4W5BA 3OVXA 2FO5A 5F02A 2AUXA 2ATOA 3MHHA 3N3KA 4FJCA 4YYUA 1AU3A 2C0YA 3OF9A 1DEUA 3H8BA 4PP2E 2FYEA 9PAPA 4RY2A 1F29A 3OF8A 3WXFA 4YYWA 2IBIA 4CDCB 3BC3A 2AS8A 2XU5A 5K16A 1VSNA 2DC7A 1MDWA 1EF7A 2E01A 1PCIA 2G8JA 3MORA 4BPVA 2E03A 1KHPA 2DJFB 3IMAA 2XU1A 4XR7A 2AYNA 1GCBA 1KHQA 3HWNA 1EWPA 1MIRA 4BQVA 1CSBB 1EWLA 3P5VA 2DC8A 2XU3A 3PW3A 1VJVA 3KX1A 4QRGA 1QDQA 2E02A 4OELA 2AUZA 4N8WA 2Y6EA 3OVZA 2DZZA 1U9VA 1DF0A 2DCCA 4FK5A 1STFE 1F2BA 3HHIA 3P5XA 2B1MA 1Y08A 3S3QA 4QBBA 4CZWA 4I04A 3IOQA 1F2CA 2NQAA 2O6XA 3IV2A 3WXGA 1YK8A 3BOWA 4X6IA 3CBJA 3V6EA 3MHSA 2DC9A 4N4ZA 3RVVA 2DC6A 3TNXA 2FQ9A 2H7JA 3NHEA 1K3BB 2R9FA 4W4UA 3E1ZB 4KLBA 1PPPA 2OZ2A 4ZUXU 2F1GA 3KKUA 2G6DA 1F2AA 1ME4A 1YALA 1CJLA 2P0RA 3PDFA 2BDZA 1AU2A 5A24A 1KXRA 5CVOB 4DMYA 3KWZA 2PREA 4OEMA 1ICFA 1O0EA 3K8UA 3CH3X 1THEA 5EF4A 2P7UA 3H8CA 3MTNA 2VHFA 3KW9A 2DCDA 1NB5A 2DJGB 3D6SA 3O1GA 2FTDA 4I05A 3O0UA 3GCBA 3USVA 2HH5A 3WXEA 3K24A 1BQIA 2PBHA 2YJ2A 2YJBA 1PBHA 1PPDA 1CB5A 1AU4A 2ARYA 4WA6A 3P5WA 2R9NA 3AI8A 2R9MA 2GHUA 4P6EA 5EGWA 4N79A 4MSXA 1PE6A 1HUCB 3F5VA 4YYVA 3IHPA 3K9MA 1EWMA 3BWKA 1PADA 3IUTA 1ITOA 4YYSA 4QRXA 4DMXA 1S4VA 2WBFX 4K7CA 3P5UA 1AIMA 3C9EA 5CHTA 1SP4B 3QSDA 4MZSA 1ZIVA 2YJ8A 4CDDB 3HHAA 3OISA 1GLOA 2JQFR 3RVXA 3QJ3A 2ACTA 1JQPA 2G7YA 1NPZA 3I3TA 4MZOA 2XU4A 3CBKA 1X9YA 3H89A 2YJ9A 2CB5A 2OP3A 1KFUL 1GECE 3HD3A 3RVWA 1Q6KA 4BS6A 1KFXL 3BPFA 3KFQA 1FH0A 2NQIA 1NQCA 2AU1A 1A6RA 1U5IA 3ZUAA 4YV8A 1AECA 1NLJA 2DCAA 3H6SA 5CHVA 3PBHA 2F7DA 4X6HA 1MS6A 3IEJA 1NL6A 1CV8A 2JQGR 1TU6A 4CDFB 7PCKA 2HHNA 1M6DA 8PCHA 2HXZA 1QXPA 4G54A 2OULA 2BDLA 2FUDA 1YK7A 2VHSA 4X6JA 1QOLA 4FIPA 2NQDB 1EWOA 2YJCA 1U9QX 1Y4HA 1GMYA 2FRAA 2DCBA 3B79A 1ZCMA 4CDEB 2Y5BA 3N3GA 5JA7A 4PI3A 3I06A 1PPOA 2HD5A 3KWBX 1AYUA 2PNSA 3S3RA 4XUIA 1YT7A 4Q8HA 2FRQA 4AXMA 1U9WA 1PXVA 4YYQA 4PADA 3M99A 3CH2X 1AU0A 4I07A 2P86A 4Q8GA 2PADA 2IPPB 3BCNA 3LXSA 2AIMA 1CPJA 1POPA 4YVAA 1BGOA 4AXLA 4QH6A 5CVNB 1XKGA 3H7DA 2DZYA 2AVWA 3U8EA 1SNKA 1PIPA 4BS5A 2E00A 3KSEA 5FPWA 3F75A 3V6CA 1AYWA 4HWYA 3PNRA 6PADA 1ATKA 4BSQA 2B1NA 1QMYA 2G8EA 1TL9A 5PADA 3QT4A 4P6GA 1MEGA 1MHWA 2CIOA 1PPNA 1ME3A 1CTEA 2R6NA 1AYVA 4QRVA 1CQDA 1BY8A 3DF0A 3LFYA 1MEMA 1U9XA 2GFOA 1YVBA 2FT2A 1BP4A 4W5CA 2NQGA 1CS8A 5JH3A 1CVZA 5CVMA 1TLOA 2R9CA 4PP1A 3BPMA 4YYRA 5J94A 1IWDA
chains in the Genus database with same CATH superfamily
2R9OA 1NB3A 2AYOA 4IUMA 3ERVA 3N4CA 4W5BA 3OVXA 2FO5A 5F02A 2AUXA 2ATOA 3MHHA 3N3KA 4FJCA 4YYUA 1AU3A 3TRKA 2C0YA 3OF9A 1DEUA 5EZSA 3H8BA 4PP2E 2FYEA 9PAPA 4A5UA 4RY2A 1F29A 1YZBA 4BOSA 3OF8A 3WXFA 4YYWA 1PVJA 2IBIA 4CDCB 3BC3A 2AS8A 2XU5A 4GUAA 5K16A 1VSNA 2DC7A 1MDWA 1EF7A 2E01A 1PCIA 2G8JA 3MORA 4BPVA 2E03A 4HXDB 1KHPA 2BU3A 2DJFB 3IMAA 2XU1A 4XR7A 2AYNA 1GCBA 1KHQA 2J7QA 3HWNA 1EWPA 1MIRA 4BQVA 1CSBB 1EWLA 3P5VA 4M0WA 2DC8A 2XU3A 3PW3A 1VJVA 3KX1A 4QRGA 1QDQA 2E02A 4OELA 2AUZA 4N8WA 2Y6EA 3OVZA 2DZZA 1U9VA 4BOUA 5JZEA 1DF0A 2DCCA 4FK5A 1STFE 1F2BA 3HHIA 3P5XA 2B1MA 1Y08A 3S3QA 4QBBA 4CZWA 4I04A 3IOQA 4RNAA 3MP2A 1F2CA 2NQAA 2JTCA 2O6XA 3IV2A 3WXGA 1YK8A 3BOWA 4X6IA 3CBJA 3V6EA 3MHSA 2DC9A 4N4ZA 3RVVA 2DC6A 3TNXA 2FQ9A 2H7JA 3NHEA 1K3BB 2R9FA 4W4UA 3E1ZB 4KLBA 1PPPA 2OZ2A 2BTWB 4ZUXU 2F1GA 4OVZB 3KKUA 4R3DA 2G6DA 1F2AA 1ME4A 3ZNHA 1YALA 3W31A 1CJLA 2AGAA 2P0RA 3PDFA 4IP3A 2BDZA 1AU2A 5EZQA 5A24A 1KXRA 5CVOB 4DMYA 3KWZA 2PREA 4ZTBA 4OEMA 1ICFA 1O0EA 3K8UA 3CH3X 1THEA 5EF4A 2P7UA 3H8CA 3MTNA 2VHFA 4D8IA 3KW9A 2DCDA 3PRPA 1NB5A 2DJGB 3D6SA 3O1GA 2FTDA 4I05A 3O0UA 3GCBA 3USVA 2HH5A 3MTVA 3WXEA 3K24A 5KO3A 1BQIA 2PBHA 2YJ2A 2YJBA 1PBHA 1PPDA 1CB5A 1AU4A 2ARYA 4WA6A 3P5WA 2R9NA 3AI8A 4P16A 2BTWA 2R9MA 2GHUA 4P6EA 5EGWA 4OVZA 4N79A 4MSXA 3E9SA 1PE6A 1HUCB 3C0RA 3F5VA 4YYVA 3IHPA 4BOQA 3PSEA 3K9MA 1EWMA 5E6JA 3BWKA 1PADA 3IUTA 1ITOA 4YYSA 4QRXA 4DMXA 1S4VA 2WBFX 4K7CA 3P5UA 1AIMA 3OQCA 3C9EA 4D8EA 5CHTA 1SP4B 3QSDA 4MZSA 1ZIVA 3O65A 2YJ8A 3IFUA 4CDDB 4RKXA 3HHAA 3OISA 1GLOA 2JQFR 3RVXA 3QJ3A 2ACTA 1JQPA 2G7YA 1NPZA 3I3TA 4MZOA 2XU4A 3CBKA 2FE8A 1X9YA 3H89A 2YJ9A 2CB5A 2OP3A 1KFUL 1GECE 3HD3A 3RVWA 1Q6KA 4BS6A 1DKIA 1KFXL 3BPFA 3KFQA 1FH0A 4MI7A 2NQIA 1NQCA 2AU1A 1A6RA 1U5IA 3ZUAA 4YV8A 4BOZA 1AECA 3RNVA 1NLJA 4REZA 2UZJA 2DCAA 3H6SA 5CHVA 3MJ5A 3PBHA 2F7DA 4X6HA 1MS6A 3IEJA 4OW0A 1NL6A 1CV8A 2JQGR 1TU6A 4CDFB 7PCKA 2HHNA 1M6DA 8PCHA 2HXZA 3PT2A 3BB7A 1QXPA 4G54A 2OULA 2BDLA 2FUDA 1YK7A 2VHSA 4X6JA 1QOLA 4RF1A 4FIPA 2NQDB 1EWOA 2YJCA 1U9QX 1Y4HA 3PHUA 1GMYA 4BOPA 2FRAA 2DCBA 3B79A 1ZCMA 4PT5A 4CDEB 2HWKA 2Y5BA 4RF0A 3N3GA 3PHWA 5JA7A 4PI3A 3I06A 1PPOA 2HD5A 3KWBX 1AYUA 1UKFA 2PNSA 3S3RA 4XUIA 1YT7A 4Q8HA 2FRQA 4AXMA 1U9WA 1PXVA 4YYQA 4PADA 3M99A 3CH2X 1AU0A 4I07A 2P86A 4Q8GA 3TMPA 2PADA 2IPPB 3BCNA 3LXSA 2AIMA 1CPJA 1POPA 3PRMA 4YVAA 1BGOA 4WURA 4AXLA 3PHXA 4QH6A 5CVNB 1XKGA 3W30A 3H7DA 2DZYA 2AVWA 4XZXA 3U8EA 1SNKA 1PIPA 2Z84A 4BS5A 2E00A 2DOSA 3KSEA 5FPWA 4D8BA 2JRIA 3F75A 3V6CA 1AYWA 4HWYA 3PNRA 6PADA 1ATKA 4BSQA 2B1NA 1QMYA 2G8EA 1TL9A 5PADA 3QT4A 4P6GA 1MEGA 1MHWA 2CIOA 1PPNA 1ME3A 2J7QC 1CTEA 3BY4A 2R6NA 1AYVA 4QRVA 3B21A 1CQDA 4MM3B 1BY8A 3DF0A 3LFYA 1MEMA 1U9XA 2GFOA 1YVBA 2FT2A 1BP4A 4W5CA 2NQGA 1CS8A 5JH3A 1CVZA 5CVMA 1TLOA 3BBAA 2R9CA 4PP1A 3BPMA 4YYRA 5J94A 1IWDA
chains in the Genus database with same CATH topology
2R9OA 1NB3A 2AYOA 3ERVA 3N4CA 4W5BA 3OVXA 2FO5A 5F02A 2AUXA 2ATOA 3MHHA 3N3KA 4FJCA 4YYUA 1AU3A 2C0YA 4BGFA 3OF9A 1DEUA 3H8BA 4PP2E 2FYEA 9PAPA 4RY2A 1F29A 4GUZA 3OF8A 3WXFA 4YYWA 2IBIA 4CDCB 3BC3A 2AS8A 2XU5A 5K16A 1VSNA 2DC7A 1MDWA 1EF7A 2E01A 1PCIA 2G8JA 3MORA 4BPVA 2E03A 1KHPA 2DJFB 3IMAA 2XU1A 4XR7A 2AYNA 1GCBA 1KHQA 3HWNA 1EWPA 1MIRA 4BQVA 1CSBB 1EWLA 3P5VA 2DC8A 2XU3A 3PW3A 1VJVA 3KX1A 4QRGA 1QDQA 2E02A 4OELA 2AUZA 4N8WA 2Y6EA 3OVZA 2DZZA 1U9VA 1DF0A 2DCCA 4FK5A 1STFE 1F2BA 3HHIA 3P5XA 2B1MA 1Y08A 3S3QA 4QBBA 4CZWA 4I04A 3IOQA 1F2CA 2NQAA 2O6XA 3IV2A 3WXGA 1YK8A 3BOWA 4X6IA 3CBJA 3V6EA 3MHSA 2DC9A 4N4ZA 3RVVA 2DC6A 3TNXA 2FQ9A 2H7JA 3NHEA 1K3BB 2R9FA 4W4UA 3E1ZB 4KLBA 1PPPA 2OZ2A 4ZUXU 2BSZA 2F1GA 3KKUA 2G6DA 1F2AA 1ME4A 1YALA 1CJLA 1W5RA 2P0RA 3PDFA 2BDZA 4NV8A 1AU2A 5A24A 1KXRA 2VFCA 3LTWA 5CVOB 4DMYA 3KWZA 2PREA 1E2TA 4OEMA 1ICFA 4B55A 1O0EA 3K8UA 3CH3X 1THEA 5EF4A 2P7UA 3H8CA 3MTNA 2VHFA 3KW9A 2DCDA 1NB5A 2DJGB 3D6SA 3O1GA 2FTDA 4I05A 3O0UA 3GCBA 3USVA 2HH5A 3WXEA 3K24A 1BQIA 2PBHA 2YJ2A 2YJBA 1PBHA 1PPDA 1CB5A 1AU4A 2ARYA 4WA6A 3P5WA 2R9NA 3AI8A 2R9MA 2GHUA 4P6EA 5EGWA 4N79A 4MSXA 1PE6A 1HUCB 3F5VA 4YYVA 3IHPA 3K9MA 1EWMA 3BWKA 1PADA 3IUTA 1ITOA 4YYSA 4QRXA 4DMXA 1S4VA 2WBFX 4K7CA 3P5UA 1AIMA 3C9EA 5CHTA 1SP4B 3QSDA 4MZSA 1ZIVA 2YJ8A 4CDDB 3HHAA 3OISA 1GLOA 2JQFR 3RVXA 3QJ3A 2ACTA 1JQPA 2G7YA 1NPZA 3I3TA 4MZOA 2XU4A 3CBKA 1X9YA 3H89A 2YJ9A 2CB5A 2OP3A 1KFUL 1GECE 3HD3A 3RVWA 1Q6KA 4BS6A 4NV7A 1KFXL 3BPFA 3KFQA 1FH0A 2NQIA 1NQCA 2AU1A 1A6RA 1U5IA 3ZUAA 4YV8A 1AECA 1NLJA 2DCAA 3H6SA 5CHVA 3PBHA 2F7DA 4X6HA 1MS6A 3IEJA 1NL6A 1CV8A 2JQGR 1TU6A 4CDFB 7PCKA 2HHNA 1M6DA 8PCHA 2HXZA 1QXPA 4G54A 2OULA 2BDLA 2FUDA 1YK7A 2VHSA 4X6JA 1QOLA 4FIPA 2NQDB 1EWOA 2YJCA 1U9QX 1Y4HA 1GMYA 4C5PA 2FRAA 2DCBA 3B79A 1ZCMA 4CDEB 2Y5BA 3N3GA 5JA7A 4PI3A 3I06A 1PPOA 2HD5A 3KWBX 1AYUA 1W4TA 2PNSA 3S3RA 4XUIA 1YT7A 4Q8HA 2FRQA 4AXMA 1U9WA 1PXVA 4YYQA 4PADA 3M99A 3CH2X 1AU0A 4I07A 2P86A 4Q8GA 2PADA 2IPPB 3BCNA 3LXSA 2AIMA 1CPJA 1POPA 4YVAA 1BGOA 4AXLA 4QH6A 5CVNB 1XKGA 1GX3A 3H7DA 2DZYA 2AVWA 2VFBA 3U8EA 1SNKA 1PIPA 4BS5A 2E00A 3KSEA 5FPWA 3F75A 3V6CA 1AYWA 4HWYA 3PNRA 6PADA 1ATKA 4BSQA 2B1NA 1QMYA 2G8EA 1TL9A 5PADA 3QT4A 4P6GA 1MEGA 1MHWA 2CIOA 1PPNA 1ME3A 1CTEA 2R6NA 1AYVA 4QRVA 1CQDA 1BY8A 3DF0A 3LFYA 1MEMA 1U9XA 2GFOA 1YVBA 2FT2A 1BP4A 4W5CA 2NQGA 1CS8A 5JH3A 1CVZA 5CVMA 3D9WA 1TLOA 2R9CA 4PP1A 1W6FA 3BPMA 4YYRA 5J94A 1IWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9O A;  1NB3 A;  2AYO A;  3ERV A;  3N4C A;  4W5B A;  3OVX A;  2FO5 A;  5F02 A;  2AUX A;  2ATO A;  3MHH A;  3N3K A;  4FJC A;  4YYU A;  1AU3 A;  2C0Y A;  3OF9 A;  1DEU A;  3H8B A;  4PP2 E;  2FYE A;  9PAP A;  4RY2 A;  1F29 A;  3OF8 A;  3WXF A;  4YYW A;  2IBI A;  4CDC B;  3BC3 A;  2AS8 A;  2XU5 A;  5K16 A;  1VSN A;  2DC7 A;  1MDW A;  1EF7 A;  2E01 A;  1PCI A;  2G8J A;  3MOR A;  4BPV A;  2E03 A;  1KHP A;  2DJF B;  3IMA A;  2XU1 A;  4XR7 A;  2AYN A;  1GCB A;  1KHQ A;  3HWN A;  1EWP A;  1MIR A;  4BQV A;  1CSB B;  1EWL A;  3P5V A;  2DC8 A;  2XU3 A;  3PW3 A;  1VJV A;  3KX1 A;  4QRG A;  1QDQ A;  2E02 A;  4OEL A;  2AUZ A;  4N8W A;  2Y6E A;  3OVZ A;  2DZZ A;  1U9V A;  1DF0 A;  2DCC A;  4FK5 A;  1STF E;  1F2B A;  3HHI A;  3P5X A;  2B1M A;  1Y08 A;  3S3Q A;  4QBB A;  4CZW A;  4I04 A;  3IOQ A;  1F2C A;  2NQA A;  2O6X A;  3IV2 A;  3WXG A;  1YK8 A;  3BOW A;  4X6I A;  3CBJ A;  3V6E A;  3MHS A;  2DC9 A;  4N4Z A;  3RVV A;  2DC6 A;  3TNX A;  2FQ9 A;  2H7J A;  3NHE A;  1K3B B;  2R9F A;  4W4U A;  3E1Z B;  4KLB A;  1PPP A;  2OZ2 A;  4ZUX U;  2F1G A;  3KKU A;  2G6D A;  1F2A A;  1ME4 A;  1YAL A;  1CJL A;  2P0R A;  3PDF A;  2BDZ A;  1AU2 A;  5A24 A;  1KXR A;  5CVO B;  4DMY A;  3KWZ A;  2PRE A;  4OEM A;  1ICF A;  1O0E A;  3K8U A;  3CH3 X;  1THE A;  5EF4 A;  2P7U A;  3H8C A;  3MTN A;  2VHF A;  3KW9 A;  2DCD A;  1NB5 A;  2DJG B;  3D6S A;  3O1G A;  2FTD A;  4I05 A;  3O0U A;  3GCB A;  3USV A;  2HH5 A;  3WXE A;  3K24 A;  1BQI A;  2PBH A;  2YJ2 A;  2YJB A;  1PBH A;  1PPD A;  1CB5 A;  1AU4 A;  2ARY A;  4WA6 A;  3P5W A;  2R9N A;  3AI8 A;  2R9M A;  2GHU A;  4P6E A;  5EGW A;  4N79 A;  4MSX A;  1PE6 A;  1HUC B;  3F5V A;  4YYV A;  3IHP A;  3K9M A;  1EWM A;  3BWK A;  1PAD A;  3IUT A;  1ITO A;  4YYS A;  4QRX A;  4DMX A;  1S4V A;  2WBF X;  4K7C A;  3P5U A;  1AIM A;  3C9E A;  5CHT A;  1SP4 B;  3QSD A;  4MZS A;  1ZIV A;  2YJ8 A;  4CDD B;  3HHA A;  3OIS A;  1GLO A;  2JQF R;  3RVX A;  3QJ3 A;  2ACT A;  1JQP A;  2G7Y A;  1NPZ A;  3I3T A;  4MZO A;  2XU4 A;  3CBK A;  1X9Y A;  3H89 A;  2YJ9 A;  2CB5 A;  2OP3 A;  1KFU L;  1GEC E;  3HD3 A;  3RVW A;  1Q6K A;  4BS6 A;  1KFX L;  3BPF A;  3KFQ A;  1FH0 A;  2NQI A;  1NQC A;  2AU1 A;  1A6R A;  1U5I A;  3ZUA A;  4YV8 A;  1AEC A;  1NLJ A;  2DCA A;  3H6S A;  5CHV A;  3PBH A;  2F7D A;  4X6H A;  1MS6 A;  3IEJ A;  1NL6 A;  1CV8 A;  2JQG R;  1TU6 A;  4CDF B;  7PCK A;  2HHN A;  1M6D A;  8PCH A;  2HXZ A;  1QXP A;  4G54 A;  2OUL A;  2BDL A;  2FUD A;  1YK7 A;  2VHS A;  4X6J A;  1QOL A;  4FIP A;  2NQD B;  1EWO A;  2YJC A;  1U9Q X;  1Y4H A;  1GMY A;  2FRA A;  2DCB A;  3B79 A;  1ZCM A;  4CDE B;  2Y5B A;  3N3G A;  5JA7 A;  4PI3 A;  3I06 A;  1PPO A;  2HD5 A;  3KWB X;  1AYU A;  2PNS A;  3S3R A;  4XUI A;  1YT7 A;  4Q8H A;  2FRQ A;  4AXM A;  1U9W A;  1PXV A;  4YYQ A;  4PAD A;  3M99 A;  3CH2 X;  1AU0 A;  4I07 A;  2P86 A;  4Q8G A;  2PAD A;  2IPP B;  3BCN A;  3LXS A;  2AIM A;  1CPJ A;  1POP A;  4YVA A;  1BGO A;  4AXL A;  4QH6 A;  5CVN B;  1XKG A;  3H7D A;  2DZY A;  2AVW A;  3U8E A;  1SNK A;  1PIP A;  4BS5 A;  2E00 A;  3KSE A;  5FPW A;  3F75 A;  3V6C A;  1AYW A;  4HWY A;  3PNR A;  6PAD A;  1ATK A;  4BSQ A;  2B1N A;  1QMY A;  2G8E A;  1TL9 A;  5PAD A;  3QT4 A;  4P6G A;  1MEG A;  1MHW A;  2CIO A;  1PPN A;  1ME3 A;  1CTE A;  2R6N A;  1AYV A;  4QRV A;  1CQD A;  1BY8 A;  3DF0 A;  3LFY A;  1MEM A;  1U9X A;  2GFO A;  1YVB A;  2FT2 A;  1BP4 A;  4W5C A;  2NQG A;  1CS8 A;  5JH3 A;  1CVZ A;  5CVM A;  1TLO A;  2R9C A;  4PP1 A;  3BPM A;  4YYR A;  5J94 A;  1IWD A; 
#chains in the Genus database with same CATH topology
 2R9O A;  1NB3 A;  2AYO A;  4IUM A;  3ERV A;  3N4C A;  4W5B A;  3OVX A;  2FO5 A;  5F02 A;  2AUX A;  2ATO A;  3MHH A;  3N3K A;  4FJC A;  4YYU A;  1AU3 A;  3TRK A;  2C0Y A;  3OF9 A;  1DEU A;  5EZS A;  3H8B A;  4PP2 E;  2FYE A;  9PAP A;  4A5U A;  4RY2 A;  1F29 A;  1YZB A;  4BOS A;  3OF8 A;  3WXF A;  4YYW A;  1PVJ A;  2IBI A;  4CDC B;  3BC3 A;  2AS8 A;  2XU5 A;  4GUA A;  5K16 A;  1VSN A;  2DC7 A;  1MDW A;  1EF7 A;  2E01 A;  1PCI A;  2G8J A;  3MOR A;  4BPV A;  2E03 A;  4HXD B;  1KHP A;  2BU3 A;  2DJF B;  3IMA A;  2XU1 A;  4XR7 A;  2AYN A;  1GCB A;  1KHQ A;  2J7Q A;  3HWN A;  1EWP A;  1MIR A;  4BQV A;  1CSB B;  1EWL A;  3P5V A;  4M0W A;  2DC8 A;  2XU3 A;  3PW3 A;  1VJV A;  3KX1 A;  4QRG A;  1QDQ A;  2E02 A;  4OEL A;  2AUZ A;  4N8W A;  2Y6E A;  3OVZ A;  2DZZ A;  1U9V A;  4BOU A;  5JZE A;  1DF0 A;  2DCC A;  4FK5 A;  1STF E;  1F2B A;  3HHI A;  3P5X A;  2B1M A;  1Y08 A;  3S3Q A;  4QBB A;  4CZW A;  4I04 A;  3IOQ A;  4RNA A;  3MP2 A;  1F2C A;  2NQA A;  2JTC A;  2O6X A;  3IV2 A;  3WXG A;  1YK8 A;  3BOW A;  4X6I A;  3CBJ A;  3V6E A;  3MHS A;  2DC9 A;  4N4Z A;  3RVV A;  2DC6 A;  3TNX A;  2FQ9 A;  2H7J A;  3NHE A;  1K3B B;  2R9F A;  4W4U A;  3E1Z B;  4KLB A;  1PPP A;  2OZ2 A;  2BTW B;  4ZUX U;  2F1G A;  4OVZ B;  3KKU A;  4R3D A;  2G6D A;  1F2A A;  1ME4 A;  3ZNH A;  1YAL A;  3W31 A;  1CJL A;  2AGA A;  2P0R A;  3PDF A;  4IP3 A;  2BDZ A;  1AU2 A;  5EZQ A;  5A24 A;  1KXR A;  5CVO B;  4DMY A;  3KWZ A;  2PRE A;  4ZTB A;  4OEM A;  1ICF A;  1O0E A;  3K8U A;  3CH3 X;  1THE A;  5EF4 A;  2P7U A;  3H8C A;  3MTN A;  2VHF A;  4D8I A;  3KW9 A;  2DCD A;  3PRP A;  1NB5 A;  2DJG B;  3D6S A;  3O1G A;  2FTD A;  4I05 A;  3O0U A;  3GCB A;  3USV A;  2HH5 A;  3MTV A;  3WXE A;  3K24 A;  5KO3 A;  1BQI A;  2PBH A;  2YJ2 A;  2YJB A;  1PBH A;  1PPD A;  1CB5 A;  1AU4 A;  2ARY A;  4WA6 A;  3P5W A;  2R9N A;  3AI8 A;  4P16 A;  2BTW A;  2R9M A;  2GHU A;  4P6E A;  5EGW A;  4OVZ A;  4N79 A;  4MSX A;  3E9S A;  1PE6 A;  1HUC B;  3C0R A;  3F5V A;  4YYV A;  3IHP A;  4BOQ A;  3PSE A;  3K9M A;  1EWM A;  5E6J A;  3BWK A;  1PAD A;  3IUT A;  1ITO A;  4YYS A;  4QRX A;  4DMX A;  1S4V A;  2WBF X;  4K7C A;  3P5U A;  1AIM A;  3OQC A;  3C9E A;  4D8E A;  5CHT A;  1SP4 B;  3QSD A;  4MZS A;  1ZIV A;  3O65 A;  2YJ8 A;  3IFU A;  4CDD B;  4RKX A;  3HHA A;  3OIS A;  1GLO A;  2JQF R;  3RVX A;  3QJ3 A;  2ACT A;  1JQP A;  2G7Y A;  1NPZ A;  3I3T A;  4MZO A;  2XU4 A;  3CBK A;  2FE8 A;  1X9Y A;  3H89 A;  2YJ9 A;  2CB5 A;  2OP3 A;  1KFU L;  1GEC E;  3HD3 A;  3RVW A;  1Q6K A;  4BS6 A;  1DKI A;  1KFX L;  3BPF A;  3KFQ A;  1FH0 A;  4MI7 A;  2NQI A;  1NQC A;  2AU1 A;  1A6R A;  1U5I A;  3ZUA A;  4YV8 A;  4BOZ A;  1AEC A;  3RNV A;  1NLJ A;  4REZ A;  2UZJ A;  2DCA A;  3H6S A;  5CHV A;  3MJ5 A;  3PBH A;  2F7D A;  4X6H A;  1MS6 A;  3IEJ A;  4OW0 A;  1NL6 A;  1CV8 A;  2JQG R;  1TU6 A;  4CDF B;  7PCK A;  2HHN A;  1M6D A;  8PCH A;  2HXZ A;  3PT2 A;  3BB7 A;  1QXP A;  4G54 A;  2OUL A;  2BDL A;  2FUD A;  1YK7 A;  2VHS A;  4X6J A;  1QOL A;  4RF1 A;  4FIP A;  2NQD B;  1EWO A;  2YJC A;  1U9Q X;  1Y4H A;  3PHU A;  1GMY A;  4BOP A;  2FRA A;  2DCB A;  3B79 A;  1ZCM A;  4PT5 A;  4CDE B;  2HWK A;  2Y5B A;  4RF0 A;  3N3G A;  3PHW A;  5JA7 A;  4PI3 A;  3I06 A;  1PPO A;  2HD5 A;  3KWB X;  1AYU A;  1UKF A;  2PNS A;  3S3R A;  4XUI A;  1YT7 A;  4Q8H A;  2FRQ A;  4AXM A;  1U9W A;  1PXV A;  4YYQ A;  4PAD A;  3M99 A;  3CH2 X;  1AU0 A;  4I07 A;  2P86 A;  4Q8G A;  3TMP A;  2PAD A;  2IPP B;  3BCN A;  3LXS A;  2AIM A;  1CPJ A;  1POP A;  3PRM A;  4YVA A;  1BGO A;  4WUR A;  4AXL A;  3PHX A;  4QH6 A;  5CVN B;  1XKG A;  3W30 A;  3H7D A;  2DZY A;  2AVW A;  4XZX A;  3U8E A;  1SNK A;  1PIP A;  2Z84 A;  4BS5 A;  2E00 A;  2DOS A;  3KSE A;  5FPW A;  4D8B A;  2JRI A;  3F75 A;  3V6C A;  1AYW A;  4HWY A;  3PNR A;  6PAD A;  1ATK A;  4BSQ A;  2B1N A;  1QMY A;  2G8E A;  1TL9 A;  5PAD A;  3QT4 A;  4P6G A;  1MEG A;  1MHW A;  2CIO A;  1PPN A;  1ME3 A;  2J7Q C;  1CTE A;  3BY4 A;  2R6N A;  1AYV A;  4QRV A;  3B21 A;  1CQD A;  4MM3 B;  1BY8 A;  3DF0 A;  3LFY A;  1MEM A;  1U9X A;  2GFO A;  1YVB A;  2FT2 A;  1BP4 A;  4W5C A;  2NQG A;  1CS8 A;  5JH3 A;  1CVZ A;  5CVM A;  1TLO A;  3BBA A;  2R9C A;  4PP1 A;  3BPM A;  4YYR A;  5J94 A;  1IWD A; 
#chains in the Genus database with same CATH homology
 2R9O A;  1NB3 A;  2AYO A;  3ERV A;  3N4C A;  4W5B A;  3OVX A;  2FO5 A;  5F02 A;  2AUX A;  2ATO A;  3MHH A;  3N3K A;  4FJC A;  4YYU A;  1AU3 A;  2C0Y A;  4BGF A;  3OF9 A;  1DEU A;  3H8B A;  4PP2 E;  2FYE A;  9PAP A;  4RY2 A;  1F29 A;  4GUZ A;  3OF8 A;  3WXF A;  4YYW A;  2IBI A;  4CDC B;  3BC3 A;  2AS8 A;  2XU5 A;  5K16 A;  1VSN A;  2DC7 A;  1MDW A;  1EF7 A;  2E01 A;  1PCI A;  2G8J A;  3MOR A;  4BPV A;  2E03 A;  1KHP A;  2DJF B;  3IMA A;  2XU1 A;  4XR7 A;  2AYN A;  1GCB A;  1KHQ A;  3HWN A;  1EWP A;  1MIR A;  4BQV A;  1CSB B;  1EWL A;  3P5V A;  2DC8 A;  2XU3 A;  3PW3 A;  1VJV A;  3KX1 A;  4QRG A;  1QDQ A;  2E02 A;  4OEL A;  2AUZ A;  4N8W A;  2Y6E A;  3OVZ A;  2DZZ A;  1U9V A;  1DF0 A;  2DCC A;  4FK5 A;  1STF E;  1F2B A;  3HHI A;  3P5X A;  2B1M A;  1Y08 A;  3S3Q A;  4QBB A;  4CZW A;  4I04 A;  3IOQ A;  1F2C A;  2NQA A;  2O6X A;  3IV2 A;  3WXG A;  1YK8 A;  3BOW A;  4X6I A;  3CBJ A;  3V6E A;  3MHS A;  2DC9 A;  4N4Z A;  3RVV A;  2DC6 A;  3TNX A;  2FQ9 A;  2H7J A;  3NHE A;  1K3B B;  2R9F A;  4W4U A;  3E1Z B;  4KLB A;  1PPP A;  2OZ2 A;  4ZUX U;  2BSZ A;  2F1G A;  3KKU A;  2G6D A;  1F2A A;  1ME4 A;  1YAL A;  1CJL A;  1W5R A;  2P0R A;  3PDF A;  2BDZ A;  4NV8 A;  1AU2 A;  5A24 A;  1KXR A;  2VFC A;  3LTW A;  5CVO B;  4DMY A;  3KWZ A;  2PRE A;  1E2T A;  4OEM A;  1ICF A;  4B55 A;  1O0E A;  3K8U A;  3CH3 X;  1THE A;  5EF4 A;  2P7U A;  3H8C A;  3MTN A;  2VHF A;  3KW9 A;  2DCD A;  1NB5 A;  2DJG B;  3D6S A;  3O1G A;  2FTD A;  4I05 A;  3O0U A;  3GCB A;  3USV A;  2HH5 A;  3WXE A;  3K24 A;  1BQI A;  2PBH A;  2YJ2 A;  2YJB A;  1PBH A;  1PPD A;  1CB5 A;  1AU4 A;  2ARY A;  4WA6 A;  3P5W A;  2R9N A;  3AI8 A;  2R9M A;  2GHU A;  4P6E A;  5EGW A;  4N79 A;  4MSX A;  1PE6 A;  1HUC B;  3F5V A;  4YYV A;  3IHP A;  3K9M A;  1EWM A;  3BWK A;  1PAD A;  3IUT A;  1ITO A;  4YYS A;  4QRX A;  4DMX A;  1S4V A;  2WBF X;  4K7C A;  3P5U A;  1AIM A;  3C9E A;  5CHT A;  1SP4 B;  3QSD A;  4MZS A;  1ZIV A;  2YJ8 A;  4CDD B;  3HHA A;  3OIS A;  1GLO A;  2JQF R;  3RVX A;  3QJ3 A;  2ACT A;  1JQP A;  2G7Y A;  1NPZ A;  3I3T A;  4MZO A;  2XU4 A;  3CBK A;  1X9Y A;  3H89 A;  2YJ9 A;  2CB5 A;  2OP3 A;  1KFU L;  1GEC E;  3HD3 A;  3RVW A;  1Q6K A;  4BS6 A;  4NV7 A;  1KFX L;  3BPF A;  3KFQ A;  1FH0 A;  2NQI A;  1NQC A;  2AU1 A;  1A6R A;  1U5I A;  3ZUA A;  4YV8 A;  1AEC A;  1NLJ A;  2DCA A;  3H6S A;  5CHV A;  3PBH A;  2F7D A;  4X6H A;  1MS6 A;  3IEJ A;  1NL6 A;  1CV8 A;  2JQG R;  1TU6 A;  4CDF B;  7PCK A;  2HHN A;  1M6D A;  8PCH A;  2HXZ A;  1QXP A;  4G54 A;  2OUL A;  2BDL A;  2FUD A;  1YK7 A;  2VHS A;  4X6J A;  1QOL A;  4FIP A;  2NQD B;  1EWO A;  2YJC A;  1U9Q X;  1Y4H A;  1GMY A;  4C5P A;  2FRA A;  2DCB A;  3B79 A;  1ZCM A;  4CDE B;  2Y5B A;  3N3G A;  5JA7 A;  4PI3 A;  3I06 A;  1PPO A;  2HD5 A;  3KWB X;  1AYU A;  1W4T A;  2PNS A;  3S3R A;  4XUI A;  1YT7 A;  4Q8H A;  2FRQ A;  4AXM A;  1U9W A;  1PXV A;  4YYQ A;  4PAD A;  3M99 A;  3CH2 X;  1AU0 A;  4I07 A;  2P86 A;  4Q8G A;  2PAD A;  2IPP B;  3BCN A;  3LXS A;  2AIM A;  1CPJ A;  1POP A;  4YVA A;  1BGO A;  4AXL A;  4QH6 A;  5CVN B;  1XKG A;  1GX3 A;  3H7D A;  2DZY A;  2AVW A;  2VFB A;  3U8E A;  1SNK A;  1PIP A;  4BS5 A;  2E00 A;  3KSE A;  5FPW A;  3F75 A;  3V6C A;  1AYW A;  4HWY A;  3PNR A;  6PAD A;  1ATK A;  4BSQ A;  2B1N A;  1QMY A;  2G8E A;  1TL9 A;  5PAD A;  3QT4 A;  4P6G A;  1MEG A;  1MHW A;  2CIO A;  1PPN A;  1ME3 A;  1CTE A;  2R6N A;  1AYV A;  4QRV A;  1CQD A;  1BY8 A;  3DF0 A;  3LFY A;  1MEM A;  1U9X A;  2GFO A;  1YVB A;  2FT2 A;  1BP4 A;  4W5C A;  2NQG A;  1CS8 A;  5JH3 A;  1CVZ A;  5CVM A;  3D9W A;  1TLO A;  2R9C A;  4PP1 A;  1W6F A;  3BPM A;  4YYR A;  5J94 A;  1IWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...