3HWNA

Cathepsin l with az13010160
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
220
structure length
213
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of selective Cathepsin inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin L1
total genus 59
structure length 213
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hwnA00
1ICFA 1IWDA 3H7DA 4BS6A 2DCBA 2DC7A 2CB5A 3IHPA 2R9MA 3O0UA 7PCKA 3HHIA 1PADA 3V6EA 1M6DA 1YALA 3MORA 3QT4A 2NQGA 3KWBX 2DCCA 3BC3A 4N4ZA 2P86A 1ME4A 3HD3A 1PPOA 1CS8A 3DF0A 1QXPA 2IPPB 1TL9A 1U9WA 1NPZA 2F7DA 3N3KA 2FQ9A 3ERVA 4WA6A 2AU1A 5J94A 3KFQA 3U8EA 4QBBA 1ATKA 1KHQA 1PBHA 1THEA 4CDDB 2ARYA 3F5VA 1PXVA 4FIPA 1F29A 3USVA 4PADA 1MIRA 1EWOA 1NQCA 1MEMA 1AU0A 4N79A 1CPJA 3BPFA 4QRXA 1MEGA 2GFOA 4YYSA 1NLJA 4PP1A 8PCHA 2F1GA 2BDZA 1CSBB 1GMYA 1QDQA 2E03A 4X6HA 3I06A 5PADA 1DF0A 1VSNA 2ATOA 3OVXA 1GECE 1CTEA 3KKUA 4CDFB 3V6CA 2VHFA 1HUCB 3BCNA 4YYVA 3AI8A 1DEUA 3OF9A 2XU3A 3S3QA 5EF4A 2YJCA 4XUIA 2OP3A 1F2CA 6PADA 2G8JA 5CVMA 3KX1A 3P5UA 5JA7A 4FJCA 3RVWA 1U9VA 2AYNA 3QSDA 1U5IA 1FH0A 1AYUA 4DMYA 3CH2X 3S3RA 4YVAA 1GCBA 3K8UA 3K24A 1CJLA 2Y6EA 2AYOA 5FPWA 1AECA 2GHUA 1PIPA 1A6RA 1ME3A 1K3BB 5EGWA 3H89A 3LXSA 2JQGR 3PNRA 2E00A 1AU4A 2H7JA 4MZOA 4W5CA 4CDEB 3IEJA 1AYWA 4OEMA 3BWKA 2HH5A 2FT2A 1CVZA 3CBJA 1SP4B 2AVWA 2C0YA 4G54A 1YVBA 2B1MA 2FYEA 4AXMA 2FO5A 1Y08A 2DCAA 4N8WA 3GCBA 3F75A 3D6SA 3E1ZB 3BOWA 2B1NA 4FK5A 1ZCMA 4KLBA 4QRGA 2R9FA 2YJBA 1YT7A 1YK8A 2DJGB 3H8BA 4QRVA 1XKGA 2WBFX 4HWYA 3N3GA 3IUTA 1U9QX 1SNKA 2ACTA 3P5XA 2E01A 4P6EA 2FUDA 3NHEA 1MDWA 5CHVA 3O1GA 2VHSA 5JH3A 4QH6A 3HHAA 2Y5BA 4MSXA 4OELA 3LFYA 3BPMA 4PI3A 1NB3A 3C9EA 2YJ2A 1AYVA 5F02A 4RY2A 5CHTA 3PBHA 4YYWA 3IOQA 1STFE 3RVXA 2CIOA 1PE6A 1CQDA 1AU2A 1S4VA 1QOLA 1X9YA 4CDCB 1ZIVA 1CB5A 1KFXL 2P7UA 2G8EA 1ITOA 1EWLA 2AUZA 2OZ2A 2AUXA 4BSQA 9PAPA 1AU3A 2IBIA 2DC8A 1KFUL 2HXZA 2JQFR 1BP4A 3B79A 4W5BA 2DZZA 2NQAA 3OF8A 3RVVA 3KSEA 4YYQA 3H6SA 1YK7A 5K16A 3IMAA 2P0RA 2BDLA 3MHHA 2XU4A 3CH3X 3I3TA 4BPVA 1EWMA 3P5VA 2DCDA 2DC9A 4YYUA 1MS6A 4K7CA 2PREA 1TLOA 2R9NA 3IV2A 3MHSA 2O6XA 4YV8A 1PPPA 3M99A 2DZYA 4X6IA 2PBHA 4I05A 5CVNB 2AIMA 4W4UA 1O0EA 3OISA 3OVZA 2OULA 4P6GA 1VJVA 3KWZA 4AXLA 2YJ9A 4BQVA 2NQDB 4I07A 3MTNA 3P5WA 4MZSA 1CV8A 1GLOA 2XU5A 1Q6KA 3TNXA 3K9MA 1F2AA 2DJFB 5CVOB 4DMXA 3HWNA 4XR7A 2E02A 4Q8GA 1F2BA 3CBKA 2HHNA 1MHWA 2G7YA 1PCIA 2G6DA 4PP2E 1POPA 1NL6A 2FTDA 1QMYA 1BGOA 2DC6A 2FRQA 3KW9A 1BQIA 2R9CA 2PNSA 3WXFA 1KXRA 4Q8HA 2FRAA 2AS8A 1TU6A 1PPNA 3N4CA 2YJ8A 1PPDA 2XU1A 2R6NA 4I04A 3H8CA 2R9OA 1BY8A 4CZWA 4X6JA 2PADA 1EF7A 5A24A 2NQIA 1AIMA 1U9XA 1Y4HA 2HD5A 4ZUXU 3ZUAA 3QJ3A 1JQPA 1EWPA 4YYRA 3WXGA 1KHPA 1NB5A 3PW3A 3PDFA 4BS5A 3WXEA
chains in the Genus database with same CATH superfamily
1ICFA 1IWDA 3H7DA 3PHUA 4BS6A 2DCBA 2DC7A 2CB5A 3IHPA 2R9MA 3O0UA 7PCKA 3HHIA 1PADA 3V6EA 1M6DA 1YALA 3MORA 3QT4A 2NQGA 3PSEA 3KWBX 2DCCA 3BC3A 4N4ZA 4RNAA 2P86A 1ME4A 3HD3A 1PPOA 1CS8A 3DF0A 1QXPA 5E6JA 2IPPB 1TL9A 1U9WA 1NPZA 2F7DA 3N3KA 2FQ9A 3BY4A 3ERVA 4WA6A 2AU1A 4P16A 4ZTBA 5J94A 3KFQA 3U8EA 4D8IA 1YZBA 4QBBA 1ATKA 1KHQA 1PBHA 1THEA 4CDDB 3E9SA 2ARYA 4D8EA 3F5VA 1PXVA 4FIPA 1F29A 3USVA 2BU3A 4OVZB 4PADA 4R3DA 1MIRA 1EWOA 1NQCA 1MEMA 1AU0A 4N79A 1CPJA 3BPFA 4QRXA 1MEGA 2GFOA 4YYSA 1NLJA 3MP2A 4PP1A 8PCHA 2F1GA 2BDZA 1CSBB 1GMYA 1QDQA 2E03A 4X6HA 3I06A 5PADA 4RF1A 1DF0A 3OQCA 4A5UA 1VSNA 2ATOA 3OVXA 1GECE 1CTEA 3KKUA 4CDFB 2JRIA 3V6CA 2VHFA 1HUCB 3BCNA 4YYVA 3AI8A 2HWKA 2BTWA 1DEUA 5EZQA 3OF9A 2XU3A 3S3QA 5EF4A 2YJCA 4XUIA 2OP3A 1F2CA 6PADA 5KO3A 2G8JA 5CVMA 3KX1A 3P5UA 4MI7A 5JA7A 4FJCA 4BOPA 3RVWA 1U9VA 4MM3B 2AYNA 3QSDA 1U5IA 1FH0A 1AYUA 4DMYA 3CH2X 3S3RA 4YVAA 1GCBA 3K8UA 3K24A 1CJLA 2Y6EA 2AYOA 5FPWA 1AECA 2GHUA 3PRPA 4IP3A 1PIPA 1A6RA 1ME3A 1K3BB 5EGWA 4BOZA 3H89A 3LXSA 4PT5A 2JQGR 3PNRA 2E00A 4GUAA 1AU4A 2H7JA 4MZOA 4W5CA 4CDEB 3IEJA 1AYWA 4OEMA 3BWKA 4REZA 2HH5A 2FT2A 1CVZA 3CBJA 1SP4B 2AVWA 2C0YA 4G54A 1YVBA 2B1MA 2FYEA 4AXMA 2FO5A 1Y08A 2DCAA 4N8WA 3GCBA 3F75A 3D6SA 3E1ZB 3BOWA 2B1NA 3MTVA 4FK5A 1ZCMA 4KLBA 4QRGA 2R9FA 2YJBA 1YT7A 1YK8A 2DJGB 3H8BA 4QRVA 1DKIA 1XKGA 4BOQA 2WBFX 4HWYA 3N3GA 3IUTA 1U9QX 3RNVA 3B21A 3W30A 1SNKA 2ACTA 3P5XA 2E01A 2UZJA 4P6EA 3W31A 4D8BA 2FUDA 3BB7A 3NHEA 1MDWA 5CHVA 3O1GA 2VHSA 5JH3A 4QH6A 3HHAA 2DOSA 2Y5BA 4MSXA 3TMPA 4OELA 3LFYA 3BPMA 4PI3A 3PT2A 1NB3A 3C9EA 2YJ2A 1AYVA 5F02A 4RY2A 5CHTA 3PBHA 4YYWA 3IOQA 1STFE 3RVXA 2CIOA 1PE6A 4IUMA 2J7QA 1CQDA 1AU2A 1S4VA 1QOLA 1X9YA 4HXDB 4CDCB 1ZIVA 1CB5A 4BOUA 1KFXL 2P7UA 2G8EA 1ITOA 1EWLA 2AUZA 2J7QC 2OZ2A 2AUXA 3PHWA 4BSQA 9PAPA 1AU3A 4RF0A 2Z84A 2IBIA 2DC8A 1KFUL 2HXZA 2JQFR 2BTWB 1BP4A 3IFUA 3B79A 4W5BA 2DZZA 2NQAA 3OF8A 3RVVA 3KSEA 4YYQA 3H6SA 1YK7A 5K16A 3IMAA 2P0RA 2BDLA 3MHHA 2XU4A 3CH3X 3I3TA 4BPVA 1EWMA 3P5VA 2DCDA 2DC9A 4YYUA 1MS6A 4K7CA 2PREA 1TLOA 3TRKA 2R9NA 3IV2A 2JTCA 3PHXA 3MHSA 2O6XA 4YV8A 3C0RA 1PPPA 3M99A 2DZYA 4X6IA 2PBHA 4I05A 5CVNB 3PRMA 2AIMA 4W4UA 1O0EA 3OISA 3OVZA 2OULA 4P6GA 1VJVA 3KWZA 4AXLA 2YJ9A 4BQVA 2NQDB 4I07A 4M0WA 3MTNA 3P5WA 4OVZA 3BBAA 4MZSA 1CV8A 3ZNHA 1GLOA 2XU5A 3MJ5A 1Q6KA 3TNXA 3K9MA 1F2AA 4BOSA 2DJFB 1PVJA 5CVOB 4DMXA 3HWNA 4XR7A 2E02A 4Q8GA 1F2BA 3CBKA 2HHNA 1MHWA 2G7YA 1PCIA 2G6DA 4PP2E 4OW0A 1POPA 1NL6A 2FTDA 1QMYA 1BGOA 2DC6A 4RKXA 2FRQA 5JZEA 3KW9A 1BQIA 2R9CA 2PNSA 3WXFA 1KXRA 4Q8HA 2FRAA 2AS8A 1TU6A 1PPNA 4XZXA 3N4CA 4WURA 2YJ8A 1PPDA 2XU1A 2R6NA 4I04A 3H8CA 2R9OA 3O65A 5EZSA 1BY8A 4CZWA 4X6JA 2AGAA 2PADA 1EF7A 5A24A 2NQIA 1AIMA 1U9XA 1Y4HA 2HD5A 4ZUXU 1UKFA 2FE8A 3ZUAA 3QJ3A 1JQPA 1EWPA 4YYRA 3WXGA 1KHPA 1NB5A 3PW3A 3PDFA 4BS5A 3WXEA
chains in the Genus database with same CATH topology
1ICFA 1IWDA 3H7DA 4BS6A 2DCBA 2DC7A 2CB5A 3IHPA 2R9MA 3O0UA 7PCKA 3HHIA 1PADA 3V6EA 1M6DA 1YALA 3MORA 3QT4A 2NQGA 3KWBX 2DCCA 3BC3A 4N4ZA 2P86A 1ME4A 3HD3A 1PPOA 1CS8A 3DF0A 1QXPA 2IPPB 1TL9A 1U9WA 1NPZA 2F7DA 3N3KA 2FQ9A 3ERVA 4WA6A 2AU1A 5J94A 3KFQA 3U8EA 4QBBA 1ATKA 1KHQA 1PBHA 1THEA 4CDDB 2ARYA 1GX3A 3F5VA 1PXVA 4FIPA 1F29A 3USVA 4PADA 1MIRA 1EWOA 1NQCA 1MEMA 1AU0A 4N79A 1CPJA 1W4TA 3BPFA 4QRXA 1MEGA 2GFOA 4YYSA 1NLJA 4PP1A 8PCHA 2F1GA 2BDZA 1E2TA 1CSBB 1GMYA 1QDQA 2E03A 4X6HA 3I06A 5PADA 1DF0A 1VSNA 2ATOA 3OVXA 1GECE 1CTEA 3KKUA 4CDFB 3V6CA 2VHFA 1HUCB 3BCNA 4YYVA 3AI8A 1DEUA 3OF9A 4BGFA 2XU3A 3S3QA 5EF4A 2YJCA 4XUIA 2OP3A 1F2CA 6PADA 2G8JA 5CVMA 3KX1A 3P5UA 5JA7A 4FJCA 3RVWA 1U9VA 4C5PA 2AYNA 3QSDA 1U5IA 1FH0A 1AYUA 4DMYA 3CH2X 3S3RA 4YVAA 1GCBA 3K8UA 3K24A 1CJLA 2Y6EA 2AYOA 5FPWA 4NV7A 1AECA 2GHUA 1PIPA 1A6RA 1ME3A 1K3BB 5EGWA 3H89A 3LXSA 2JQGR 3PNRA 2E00A 1AU4A 2H7JA 4MZOA 4W5CA 4CDEB 3IEJA 1AYWA 4OEMA 3BWKA 2HH5A 2FT2A 1CVZA 3CBJA 1SP4B 2AVWA 2C0YA 4G54A 1YVBA 2B1MA 2FYEA 4AXMA 2FO5A 1Y08A 2BSZA 2DCAA 4N8WA 3GCBA 3F75A 3D6SA 3E1ZB 3BOWA 2B1NA 4FK5A 1ZCMA 4KLBA 4QRGA 2R9FA 2YJBA 1YT7A 1YK8A 2DJGB 3H8BA 4QRVA 3LTWA 1XKGA 2WBFX 4HWYA 3N3GA 3IUTA 1U9QX 1SNKA 2ACTA 3P5XA 2E01A 4P6EA 4GUZA 2FUDA 3NHEA 1MDWA 5CHVA 3O1GA 2VHSA 5JH3A 1W5RA 4QH6A 3HHAA 2Y5BA 4MSXA 4OELA 3LFYA 3D9WA 3BPMA 4PI3A 1NB3A 3C9EA 2YJ2A 1AYVA 5F02A 4RY2A 5CHTA 3PBHA 4YYWA 3IOQA 1STFE 3RVXA 2CIOA 1PE6A 1CQDA 1AU2A 1S4VA 1QOLA 1X9YA 4CDCB 1ZIVA 1CB5A 1KFXL 2P7UA 2G8EA 1ITOA 1EWLA 2AUZA 2OZ2A 2AUXA 4B55A 4BSQA 9PAPA 1AU3A 2IBIA 2DC8A 1KFUL 2HXZA 2JQFR 1BP4A 3B79A 4W5BA 2DZZA 2NQAA 3OF8A 3RVVA 3KSEA 4YYQA 3H6SA 1YK7A 5K16A 3IMAA 2P0RA 2BDLA 3MHHA 2XU4A 3CH3X 3I3TA 4BPVA 1EWMA 3P5VA 2DCDA 2DC9A 4YYUA 1MS6A 4K7CA 2PREA 1TLOA 2R9NA 3IV2A 3MHSA 2O6XA 4YV8A 1PPPA 3M99A 2DZYA 4X6IA 2PBHA 4I05A 5CVNB 2AIMA 4W4UA 1O0EA 3OISA 3OVZA 2OULA 4P6GA 1VJVA 3KWZA 4AXLA 2YJ9A 4BQVA 2NQDB 4I07A 3MTNA 3P5WA 4MZSA 1CV8A 1GLOA 2XU5A 1Q6KA 1W6FA 3TNXA 3K9MA 1F2AA 2DJFB 5CVOB 4DMXA 3HWNA 4XR7A 2E02A 4Q8GA 1F2BA 3CBKA 2HHNA 1MHWA 2G7YA 1PCIA 2G6DA 4PP2E 2VFBA 1POPA 1NL6A 2FTDA 1QMYA 1BGOA 2DC6A 2FRQA 3KW9A 1BQIA 2R9CA 2PNSA 2VFCA 3WXFA 1KXRA 4Q8HA 2FRAA 2AS8A 1TU6A 1PPNA 3N4CA 2YJ8A 1PPDA 2XU1A 2R6NA 4I04A 3H8CA 2R9OA 1BY8A 4CZWA 4X6JA 2PADA 1EF7A 5A24A 2NQIA 1AIMA 1U9XA 1Y4HA 2HD5A 4NV8A 4ZUXU 3ZUAA 3QJ3A 1JQPA 1EWPA 4YYRA 3WXGA 1KHPA 1NB5A 3PW3A 3PDFA 4BS5A 3WXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF A;  1IWD A;  3H7D A;  4BS6 A;  2DCB A;  2DC7 A;  2CB5 A;  3IHP A;  2R9M A;  3O0U A;  7PCK A;  3HHI A;  1PAD A;  3V6E A;  1M6D A;  1YAL A;  3MOR A;  3QT4 A;  2NQG A;  3KWB X;  2DCC A;  3BC3 A;  4N4Z A;  2P86 A;  1ME4 A;  3HD3 A;  1PPO A;  1CS8 A;  3DF0 A;  1QXP A;  2IPP B;  1TL9 A;  1U9W A;  1NPZ A;  2F7D A;  3N3K A;  2FQ9 A;  3ERV A;  4WA6 A;  2AU1 A;  5J94 A;  3KFQ A;  3U8E A;  4QBB A;  1ATK A;  1KHQ A;  1PBH A;  1THE A;  4CDD B;  2ARY A;  3F5V A;  1PXV A;  4FIP A;  1F29 A;  3USV A;  4PAD A;  1MIR A;  1EWO A;  1NQC A;  1MEM A;  1AU0 A;  4N79 A;  1CPJ A;  3BPF A;  4QRX A;  1MEG A;  2GFO A;  4YYS A;  1NLJ A;  4PP1 A;  8PCH A;  2F1G A;  2BDZ A;  1CSB B;  1GMY A;  1QDQ A;  2E03 A;  4X6H A;  3I06 A;  5PAD A;  1DF0 A;  1VSN A;  2ATO A;  3OVX A;  1GEC E;  1CTE A;  3KKU A;  4CDF B;  3V6C A;  2VHF A;  1HUC B;  3BCN A;  4YYV A;  3AI8 A;  1DEU A;  3OF9 A;  2XU3 A;  3S3Q A;  5EF4 A;  2YJC A;  4XUI A;  2OP3 A;  1F2C A;  6PAD A;  2G8J A;  5CVM A;  3KX1 A;  3P5U A;  5JA7 A;  4FJC A;  3RVW A;  1U9V A;  2AYN A;  3QSD A;  1U5I A;  1FH0 A;  1AYU A;  4DMY A;  3CH2 X;  3S3R A;  4YVA A;  1GCB A;  3K8U A;  3K24 A;  1CJL A;  2Y6E A;  2AYO A;  5FPW A;  1AEC A;  2GHU A;  1PIP A;  1A6R A;  1ME3 A;  1K3B B;  5EGW A;  3H89 A;  3LXS A;  2JQG R;  3PNR A;  2E00 A;  1AU4 A;  2H7J A;  4MZO A;  4W5C A;  4CDE B;  3IEJ A;  1AYW A;  4OEM A;  3BWK A;  2HH5 A;  2FT2 A;  1CVZ A;  3CBJ A;  1SP4 B;  2AVW A;  2C0Y A;  4G54 A;  1YVB A;  2B1M A;  2FYE A;  4AXM A;  2FO5 A;  1Y08 A;  2DCA A;  4N8W A;  3GCB A;  3F75 A;  3D6S A;  3E1Z B;  3BOW A;  2B1N A;  4FK5 A;  1ZCM A;  4KLB A;  4QRG A;  2R9F A;  2YJB A;  1YT7 A;  1YK8 A;  2DJG B;  3H8B A;  4QRV A;  1XKG A;  2WBF X;  4HWY A;  3N3G A;  3IUT A;  1U9Q X;  1SNK A;  2ACT A;  3P5X A;  2E01 A;  4P6E A;  2FUD A;  3NHE A;  1MDW A;  5CHV A;  3O1G A;  2VHS A;  5JH3 A;  4QH6 A;  3HHA A;  2Y5B A;  4MSX A;  4OEL A;  3LFY A;  3BPM A;  4PI3 A;  1NB3 A;  3C9E A;  2YJ2 A;  1AYV A;  5F02 A;  4RY2 A;  5CHT A;  3PBH A;  4YYW A;  3IOQ A;  1STF E;  3RVX A;  2CIO A;  1PE6 A;  1CQD A;  1AU2 A;  1S4V A;  1QOL A;  1X9Y A;  4CDC B;  1ZIV A;  1CB5 A;  1KFX L;  2P7U A;  2G8E A;  1ITO A;  1EWL A;  2AUZ A;  2OZ2 A;  2AUX A;  4BSQ A;  9PAP A;  1AU3 A;  2IBI A;  2DC8 A;  1KFU L;  2HXZ A;  2JQF R;  1BP4 A;  3B79 A;  4W5B A;  2DZZ A;  2NQA A;  3OF8 A;  3RVV A;  3KSE A;  4YYQ A;  3H6S A;  1YK7 A;  5K16 A;  3IMA A;  2P0R A;  2BDL A;  3MHH A;  2XU4 A;  3CH3 X;  3I3T A;  4BPV A;  1EWM A;  3P5V A;  2DCD A;  2DC9 A;  4YYU A;  1MS6 A;  4K7C A;  2PRE A;  1TLO A;  2R9N A;  3IV2 A;  3MHS A;  2O6X A;  4YV8 A;  1PPP A;  3M99 A;  2DZY A;  4X6I A;  2PBH A;  4I05 A;  5CVN B;  2AIM A;  4W4U A;  1O0E A;  3OIS A;  3OVZ A;  2OUL A;  4P6G A;  1VJV A;  3KWZ A;  4AXL A;  2YJ9 A;  4BQV A;  2NQD B;  4I07 A;  3MTN A;  3P5W A;  4MZS A;  1CV8 A;  1GLO A;  2XU5 A;  1Q6K A;  3TNX A;  3K9M A;  1F2A A;  2DJF B;  5CVO B;  4DMX A;  3HWN A;  4XR7 A;  2E02 A;  4Q8G A;  1F2B A;  3CBK A;  2HHN A;  1MHW A;  2G7Y A;  1PCI A;  2G6D A;  4PP2 E;  1POP A;  1NL6 A;  2FTD A;  1QMY A;  1BGO A;  2DC6 A;  2FRQ A;  3KW9 A;  1BQI A;  2R9C A;  2PNS A;  3WXF A;  1KXR A;  4Q8H A;  2FRA A;  2AS8 A;  1TU6 A;  1PPN A;  3N4C A;  2YJ8 A;  1PPD A;  2XU1 A;  2R6N A;  4I04 A;  3H8C A;  2R9O A;  1BY8 A;  4CZW A;  4X6J A;  2PAD A;  1EF7 A;  5A24 A;  2NQI A;  1AIM A;  1U9X A;  1Y4H A;  2HD5 A;  4ZUX U;  3ZUA A;  3QJ3 A;  1JQP A;  1EWP A;  4YYR A;  3WXG A;  1KHP A;  1NB5 A;  3PW3 A;  3PDF A;  4BS5 A;  3WXE A; 
#chains in the Genus database with same CATH topology
 1ICF A;  1IWD A;  3H7D A;  3PHU A;  4BS6 A;  2DCB A;  2DC7 A;  2CB5 A;  3IHP A;  2R9M A;  3O0U A;  7PCK A;  3HHI A;  1PAD A;  3V6E A;  1M6D A;  1YAL A;  3MOR A;  3QT4 A;  2NQG A;  3PSE A;  3KWB X;  2DCC A;  3BC3 A;  4N4Z A;  4RNA A;  2P86 A;  1ME4 A;  3HD3 A;  1PPO A;  1CS8 A;  3DF0 A;  1QXP A;  5E6J A;  2IPP B;  1TL9 A;  1U9W A;  1NPZ A;  2F7D A;  3N3K A;  2FQ9 A;  3BY4 A;  3ERV A;  4WA6 A;  2AU1 A;  4P16 A;  4ZTB A;  5J94 A;  3KFQ A;  3U8E A;  4D8I A;  1YZB A;  4QBB A;  1ATK A;  1KHQ A;  1PBH A;  1THE A;  4CDD B;  3E9S A;  2ARY A;  4D8E A;  3F5V A;  1PXV A;  4FIP A;  1F29 A;  3USV A;  2BU3 A;  4OVZ B;  4PAD A;  4R3D A;  1MIR A;  1EWO A;  1NQC A;  1MEM A;  1AU0 A;  4N79 A;  1CPJ A;  3BPF A;  4QRX A;  1MEG A;  2GFO A;  4YYS A;  1NLJ A;  3MP2 A;  4PP1 A;  8PCH A;  2F1G A;  2BDZ A;  1CSB B;  1GMY A;  1QDQ A;  2E03 A;  4X6H A;  3I06 A;  5PAD A;  4RF1 A;  1DF0 A;  3OQC A;  4A5U A;  1VSN A;  2ATO A;  3OVX A;  1GEC E;  1CTE A;  3KKU A;  4CDF B;  2JRI A;  3V6C A;  2VHF A;  1HUC B;  3BCN A;  4YYV A;  3AI8 A;  2HWK A;  2BTW A;  1DEU A;  5EZQ A;  3OF9 A;  2XU3 A;  3S3Q A;  5EF4 A;  2YJC A;  4XUI A;  2OP3 A;  1F2C A;  6PAD A;  5KO3 A;  2G8J A;  5CVM A;  3KX1 A;  3P5U A;  4MI7 A;  5JA7 A;  4FJC A;  4BOP A;  3RVW A;  1U9V A;  4MM3 B;  2AYN A;  3QSD A;  1U5I A;  1FH0 A;  1AYU A;  4DMY A;  3CH2 X;  3S3R A;  4YVA A;  1GCB A;  3K8U A;  3K24 A;  1CJL A;  2Y6E A;  2AYO A;  5FPW A;  1AEC A;  2GHU A;  3PRP A;  4IP3 A;  1PIP A;  1A6R A;  1ME3 A;  1K3B B;  5EGW A;  4BOZ A;  3H89 A;  3LXS A;  4PT5 A;  2JQG R;  3PNR A;  2E00 A;  4GUA A;  1AU4 A;  2H7J A;  4MZO A;  4W5C A;  4CDE B;  3IEJ A;  1AYW A;  4OEM A;  3BWK A;  4REZ A;  2HH5 A;  2FT2 A;  1CVZ A;  3CBJ A;  1SP4 B;  2AVW A;  2C0Y A;  4G54 A;  1YVB A;  2B1M A;  2FYE A;  4AXM A;  2FO5 A;  1Y08 A;  2DCA A;  4N8W A;  3GCB A;  3F75 A;  3D6S A;  3E1Z B;  3BOW A;  2B1N A;  3MTV A;  4FK5 A;  1ZCM A;  4KLB A;  4QRG A;  2R9F A;  2YJB A;  1YT7 A;  1YK8 A;  2DJG B;  3H8B A;  4QRV A;  1DKI A;  1XKG A;  4BOQ A;  2WBF X;  4HWY A;  3N3G A;  3IUT A;  1U9Q X;  3RNV A;  3B21 A;  3W30 A;  1SNK A;  2ACT A;  3P5X A;  2E01 A;  2UZJ A;  4P6E A;  3W31 A;  4D8B A;  2FUD A;  3BB7 A;  3NHE A;  1MDW A;  5CHV A;  3O1G A;  2VHS A;  5JH3 A;  4QH6 A;  3HHA A;  2DOS A;  2Y5B A;  4MSX A;  3TMP A;  4OEL A;  3LFY A;  3BPM A;  4PI3 A;  3PT2 A;  1NB3 A;  3C9E A;  2YJ2 A;  1AYV A;  5F02 A;  4RY2 A;  5CHT A;  3PBH A;  4YYW A;  3IOQ A;  1STF E;  3RVX A;  2CIO A;  1PE6 A;  4IUM A;  2J7Q A;  1CQD A;  1AU2 A;  1S4V A;  1QOL A;  1X9Y A;  4HXD B;  4CDC B;  1ZIV A;  1CB5 A;  4BOU A;  1KFX L;  2P7U A;  2G8E A;  1ITO A;  1EWL A;  2AUZ A;  2J7Q C;  2OZ2 A;  2AUX A;  3PHW A;  4BSQ A;  9PAP A;  1AU3 A;  4RF0 A;  2Z84 A;  2IBI A;  2DC8 A;  1KFU L;  2HXZ A;  2JQF R;  2BTW B;  1BP4 A;  3IFU A;  3B79 A;  4W5B A;  2DZZ A;  2NQA A;  3OF8 A;  3RVV A;  3KSE A;  4YYQ A;  3H6S A;  1YK7 A;  5K16 A;  3IMA A;  2P0R A;  2BDL A;  3MHH A;  2XU4 A;  3CH3 X;  3I3T A;  4BPV A;  1EWM A;  3P5V A;  2DCD A;  2DC9 A;  4YYU A;  1MS6 A;  4K7C A;  2PRE A;  1TLO A;  3TRK A;  2R9N A;  3IV2 A;  2JTC A;  3PHX A;  3MHS A;  2O6X A;  4YV8 A;  3C0R A;  1PPP A;  3M99 A;  2DZY A;  4X6I A;  2PBH A;  4I05 A;  5CVN B;  3PRM A;  2AIM A;  4W4U A;  1O0E A;  3OIS A;  3OVZ A;  2OUL A;  4P6G A;  1VJV A;  3KWZ A;  4AXL A;  2YJ9 A;  4BQV A;  2NQD B;  4I07 A;  4M0W A;  3MTN A;  3P5W A;  4OVZ A;  3BBA A;  4MZS A;  1CV8 A;  3ZNH A;  1GLO A;  2XU5 A;  3MJ5 A;  1Q6K A;  3TNX A;  3K9M A;  1F2A A;  4BOS A;  2DJF B;  1PVJ A;  5CVO B;  4DMX A;  3HWN A;  4XR7 A;  2E02 A;  4Q8G A;  1F2B A;  3CBK A;  2HHN A;  1MHW A;  2G7Y A;  1PCI A;  2G6D A;  4PP2 E;  4OW0 A;  1POP A;  1NL6 A;  2FTD A;  1QMY A;  1BGO A;  2DC6 A;  4RKX A;  2FRQ A;  5JZE A;  3KW9 A;  1BQI A;  2R9C A;  2PNS A;  3WXF A;  1KXR A;  4Q8H A;  2FRA A;  2AS8 A;  1TU6 A;  1PPN A;  4XZX A;  3N4C A;  4WUR A;  2YJ8 A;  1PPD A;  2XU1 A;  2R6N A;  4I04 A;  3H8C A;  2R9O A;  3O65 A;  5EZS A;  1BY8 A;  4CZW A;  4X6J A;  2AGA A;  2PAD A;  1EF7 A;  5A24 A;  2NQI A;  1AIM A;  1U9X A;  1Y4H A;  2HD5 A;  4ZUX U;  1UKF A;  2FE8 A;  3ZUA A;  3QJ3 A;  1JQP A;  1EWP A;  4YYR A;  3WXG A;  1KHP A;  1NB5 A;  3PW3 A;  3PDF A;  4BS5 A;  3WXE A; 
#chains in the Genus database with same CATH homology
 1ICF A;  1IWD A;  3H7D A;  4BS6 A;  2DCB A;  2DC7 A;  2CB5 A;  3IHP A;  2R9M A;  3O0U A;  7PCK A;  3HHI A;  1PAD A;  3V6E A;  1M6D A;  1YAL A;  3MOR A;  3QT4 A;  2NQG A;  3KWB X;  2DCC A;  3BC3 A;  4N4Z A;  2P86 A;  1ME4 A;  3HD3 A;  1PPO A;  1CS8 A;  3DF0 A;  1QXP A;  2IPP B;  1TL9 A;  1U9W A;  1NPZ A;  2F7D A;  3N3K A;  2FQ9 A;  3ERV A;  4WA6 A;  2AU1 A;  5J94 A;  3KFQ A;  3U8E A;  4QBB A;  1ATK A;  1KHQ A;  1PBH A;  1THE A;  4CDD B;  2ARY A;  1GX3 A;  3F5V A;  1PXV A;  4FIP A;  1F29 A;  3USV A;  4PAD A;  1MIR A;  1EWO A;  1NQC A;  1MEM A;  1AU0 A;  4N79 A;  1CPJ A;  1W4T A;  3BPF A;  4QRX A;  1MEG A;  2GFO A;  4YYS A;  1NLJ A;  4PP1 A;  8PCH A;  2F1G A;  2BDZ A;  1E2T A;  1CSB B;  1GMY A;  1QDQ A;  2E03 A;  4X6H A;  3I06 A;  5PAD A;  1DF0 A;  1VSN A;  2ATO A;  3OVX A;  1GEC E;  1CTE A;  3KKU A;  4CDF B;  3V6C A;  2VHF A;  1HUC B;  3BCN A;  4YYV A;  3AI8 A;  1DEU A;  3OF9 A;  4BGF A;  2XU3 A;  3S3Q A;  5EF4 A;  2YJC A;  4XUI A;  2OP3 A;  1F2C A;  6PAD A;  2G8J A;  5CVM A;  3KX1 A;  3P5U A;  5JA7 A;  4FJC A;  3RVW A;  1U9V A;  4C5P A;  2AYN A;  3QSD A;  1U5I A;  1FH0 A;  1AYU A;  4DMY A;  3CH2 X;  3S3R A;  4YVA A;  1GCB A;  3K8U A;  3K24 A;  1CJL A;  2Y6E A;  2AYO A;  5FPW A;  4NV7 A;  1AEC A;  2GHU A;  1PIP A;  1A6R A;  1ME3 A;  1K3B B;  5EGW A;  3H89 A;  3LXS A;  2JQG R;  3PNR A;  2E00 A;  1AU4 A;  2H7J A;  4MZO A;  4W5C A;  4CDE B;  3IEJ A;  1AYW A;  4OEM A;  3BWK A;  2HH5 A;  2FT2 A;  1CVZ A;  3CBJ A;  1SP4 B;  2AVW A;  2C0Y A;  4G54 A;  1YVB A;  2B1M A;  2FYE A;  4AXM A;  2FO5 A;  1Y08 A;  2BSZ A;  2DCA A;  4N8W A;  3GCB A;  3F75 A;  3D6S A;  3E1Z B;  3BOW A;  2B1N A;  4FK5 A;  1ZCM A;  4KLB A;  4QRG A;  2R9F A;  2YJB A;  1YT7 A;  1YK8 A;  2DJG B;  3H8B A;  4QRV A;  3LTW A;  1XKG A;  2WBF X;  4HWY A;  3N3G A;  3IUT A;  1U9Q X;  1SNK A;  2ACT A;  3P5X A;  2E01 A;  4P6E A;  4GUZ A;  2FUD A;  3NHE A;  1MDW A;  5CHV A;  3O1G A;  2VHS A;  5JH3 A;  1W5R A;  4QH6 A;  3HHA A;  2Y5B A;  4MSX A;  4OEL A;  3LFY A;  3D9W A;  3BPM A;  4PI3 A;  1NB3 A;  3C9E A;  2YJ2 A;  1AYV A;  5F02 A;  4RY2 A;  5CHT A;  3PBH A;  4YYW A;  3IOQ A;  1STF E;  3RVX A;  2CIO A;  1PE6 A;  1CQD A;  1AU2 A;  1S4V A;  1QOL A;  1X9Y A;  4CDC B;  1ZIV A;  1CB5 A;  1KFX L;  2P7U A;  2G8E A;  1ITO A;  1EWL A;  2AUZ A;  2OZ2 A;  2AUX A;  4B55 A;  4BSQ A;  9PAP A;  1AU3 A;  2IBI A;  2DC8 A;  1KFU L;  2HXZ A;  2JQF R;  1BP4 A;  3B79 A;  4W5B A;  2DZZ A;  2NQA A;  3OF8 A;  3RVV A;  3KSE A;  4YYQ A;  3H6S A;  1YK7 A;  5K16 A;  3IMA A;  2P0R A;  2BDL A;  3MHH A;  2XU4 A;  3CH3 X;  3I3T A;  4BPV A;  1EWM A;  3P5V A;  2DCD A;  2DC9 A;  4YYU A;  1MS6 A;  4K7C A;  2PRE A;  1TLO A;  2R9N A;  3IV2 A;  3MHS A;  2O6X A;  4YV8 A;  1PPP A;  3M99 A;  2DZY A;  4X6I A;  2PBH A;  4I05 A;  5CVN B;  2AIM A;  4W4U A;  1O0E A;  3OIS A;  3OVZ A;  2OUL A;  4P6G A;  1VJV A;  3KWZ A;  4AXL A;  2YJ9 A;  4BQV A;  2NQD B;  4I07 A;  3MTN A;  3P5W A;  4MZS A;  1CV8 A;  1GLO A;  2XU5 A;  1Q6K A;  1W6F A;  3TNX A;  3K9M A;  1F2A A;  2DJF B;  5CVO B;  4DMX A;  3HWN A;  4XR7 A;  2E02 A;  4Q8G A;  1F2B A;  3CBK A;  2HHN A;  1MHW A;  2G7Y A;  1PCI A;  2G6D A;  4PP2 E;  2VFB A;  1POP A;  1NL6 A;  2FTD A;  1QMY A;  1BGO A;  2DC6 A;  2FRQ A;  3KW9 A;  1BQI A;  2R9C A;  2PNS A;  2VFC A;  3WXF A;  1KXR A;  4Q8H A;  2FRA A;  2AS8 A;  1TU6 A;  1PPN A;  3N4C A;  2YJ8 A;  1PPD A;  2XU1 A;  2R6N A;  4I04 A;  3H8C A;  2R9O A;  1BY8 A;  4CZW A;  4X6J A;  2PAD A;  1EF7 A;  5A24 A;  2NQI A;  1AIM A;  1U9X A;  1Y4H A;  2HD5 A;  4NV8 A;  4ZUX U;  3ZUA A;  3QJ3 A;  1JQP A;  1EWP A;  4YYR A;  3WXG A;  1KHP A;  1NB5 A;  3PW3 A;  3PDF A;  4BS5 A;  3WXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...