3HWNA

Cathepsin l with az13010160
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
220
structure length
213
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L1
publication title Design of selective Cathepsin inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 213
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hwnA00
4RY2A 2AYOA 1ZIVA 1CVZA 2R9OA 3PNRA 4I05A 2Y6EA 4DMYA 2ATOA 3N3GA 1TU6A 2DCCA 1U9VA 5PADA 2DJFB 1SNKA 1STFE 2DJGB 1CJLA 3HWNA 2PADA 2F7DA 2R6NA 4OEMA 4CZWA 3IOQA 1AYWA 4QH6A 2R9FA 4I07A 4PP1A 1MEGA 3OF8A 3K24A 1F2AA 3H8BA 1QMYA 1MDWA 1VSNA 1BQIA 4YYQA 2AS8A 1K3BB 3U8EA 5CVNB 2P7UA 2XU1A 3M99A 3CH3X 1IWDA 1VJVA 3BCNA 3F5VA 2G7YA 3IHPA 2O6XA 5CHVA 1MEMA 2XU3A 1EF7A 2PBHA 3V6CA 4MZOA 2PNSA 4PADA 1POPA 4G54A 3CBKA 1THEA 2E03A 3QT4A 4XUIA 3S3QA 4N8WA 1SP4B 4OELA 2FTDA 3H6SA 1AU4A 2CIOA 3N3KA 1PPOA 2JQGR 3OISA 1U9WA 2GHUA 3BPMA 1F2BA 3RVXA 2E01A 3PW3A 1PIPA 1DF0A 1AU0A 2B1MA 4FK5A 4CDEB 2JQFR 1ME4A 2DCBA 1PE6A 4BS5A 3P5XA 2F1GA 3V6EA 5K16A 1U5IA 2FO5A 3BOWA 4X6HA 1ICFA 3ZUAA 2FQ9A 3KX1A 1JQPA 1GMYA 5FPWA 2AUXA 1QXPA 2AIMA 1YT7A 3OVXA 1HUCB 1X9YA 3MORA 2FRQA 3OF9A 3C9EA 5EF4A 4BPVA 2AUZA 4X6IA 3D6SA 3KKUA 2NQDB 4W4UA 4W5CA 3IUTA 2HD5A 3KSEA 4HWYA 1CS8A 3HD3A 2OP3A 5CVMA 3AI8A 1TLOA 4YYUA 2YJ8A 1MS6A 1U9QX 3KWZA 3F75A 3I06A 2BDLA 4K7CA 4BQVA 1O0EA 4P6EA 2DCDA 3I3TA 1KHPA 2YJ9A 1KHQA 3CH2X 3HHIA 4PI3A 4YYRA 2P0RA 2YJ2A 1NQCA 2PREA 3OVZA 1Y4HA 3K9MA 3B79A 1XKGA 1BP4A 1YK7A 4BS6A 1MIRA 4FJCA 2G8JA 3WXEA 2YJBA 4N79A 3RVWA 4DMXA 2B1NA 4QRXA 2NQGA 2BDZA 1CB5A 1ATKA 4I04A 1TL9A 2DC6A 8PCHA 4QRGA 1AIMA 4XR7A 2R9MA 3BPFA 1PADA 1Y08A 6PADA 3LFYA 9PAPA 3N4CA 1CSBB 1Q6KA 2XU5A 2Y5BA 5J94A 1U9XA 3PBHA 4W5BA 1DEUA 3MHSA 3WXGA 1CV8A 1KFUL 2FUDA 1MHWA 4Q8HA 1NB3A 2DC9A 1PPPA 2DZYA 4CDFB 2XU4A 2G8EA 3KWBX 2OZ2A 2AU1A 3IMAA 3O1GA 3BC3A 1NL6A 3E1ZB 3MHHA 4CDDB 1PXVA 2AYNA 1BGOA 3PDFA 1PBHA 2P86A 2DC8A 1PCIA 2FRAA 3WXFA 3IV2A 1FH0A 3LXSA 1ME3A 3KFQA 2NQIA 2R9CA 3IEJA 4QBBA 3CBJA 3MTNA 2HHNA 2FYEA 3TNXA 1PPNA 5EGWA 1ITOA 2HXZA 1EWMA 1QDQA 2H7JA 3NHEA 2ARYA 1S4VA 2E02A 3K8UA 5CVOB 2DZZA 2E00A 3QSDA 1NLJA 4FIPA 1AU2A 2HH5A 1BY8A 1KFXL 2ACTA 3H89A 1M6DA 1F2CA 2G6DA 3P5VA 2CB5A 2WBFX 3P5WA 1A6RA 1F29A 2VHSA 3HHAA 2R9NA 1ZCMA 1NPZA 1EWOA 4X6JA 1CQDA 1YK8A 3O0UA 1YVBA 1AECA 4MZSA 5JA7A 3RVVA 4Q8GA 1QOLA 4KLBA 4AXMA 4YYSA 1GECE 1GCBA 4WA6A 4BSQA 1AYVA 3H7DA 4PP2E 3KW9A 3USVA 4YVAA 2FT2A 1AYUA 4AXLA 3ERVA 1PPDA 4CDCB 3S3RA 1EWLA 3GCBA 2GFOA 2IBIA 7PCKA 4YV8A 2IPPB 3QJ3A 1AU3A 1EWPA 1YALA 5JH3A 2AVWA 4N4ZA 2YJCA 1CPJA 5CHTA 4QRVA 1GLOA 3P5UA 1CTEA 3BWKA 4ZUXU 4YYWA 4P6GA 2OULA 1NB5A 2DCAA 2VHFA 3DF0A 2C0YA 5A24A 4MSXA 3H8CA 1KXRA 4YYVA 2NQAA 2DC7A 5F02A
chains in the Genus database with same CATH superfamily
4RY2A 2AYOA 1ZIVA 1CVZA 2R9OA 3PNRA 4I05A 3PRPA 2Y6EA 4DMYA 2ATOA 3N3GA 1TU6A 2DCCA 1U9VA 5PADA 2DJFB 1SNKA 5EZQA 1STFE 2DOSA 2DJGB 1UKFA 1CJLA 3HWNA 2PADA 3TMPA 4MI7A 2F7DA 2R6NA 4OEMA 4CZWA 3IOQA 1AYWA 4QH6A 2R9FA 4I07A 4PP1A 1MEGA 1DKIA 3OF8A 3K24A 4IUMA 1F2AA 3H8BA 1QMYA 1MDWA 2Z84A 1VSNA 1BQIA 4YYQA 2AS8A 1K3BB 3U8EA 5CVNB 2P7UA 2XU1A 3M99A 3CH3X 4OVZB 1IWDA 2BU3A 1VJVA 4OW0A 3BCNA 2JTCA 2G7YA 3F5VA 2O6XA 3IHPA 5CHVA 1MEMA 2XU3A 1EF7A 2PBHA 3V6CA 4MZOA 2PNSA 4PADA 1POPA 3C0RA 4G54A 3CBKA 2J7QA 1THEA 2E03A 3QT4A 4XUIA 3S3QA 3E9SA 4N8WA 1SP4B 4OELA 2FTDA 3H6SA 1AU4A 2CIOA 4ZTBA 3RNVA 3N3KA 1PPOA 4PT5A 2JQGR 3BY4A 2BTWB 3OISA 1U9WA 2GHUA 4BOUA 4WURA 3MTVA 3BPMA 1F2BA 3RVXA 4M0WA 2E01A 3PW3A 1PIPA 1DF0A 5E6JA 1AU0A 2B1MA 4FK5A 4R3DA 4CDEB 2JQFR 1ME4A 2DCBA 1PE6A 4BS5A 4OVZA 3PSEA 3P5XA 2F1GA 4D8EA 3V6EA 5K16A 1U5IA 2FO5A 3BOWA 4X6HA 1ICFA 3ZUAA 4HXDB 2FQ9A 3KX1A 1JQPA 1GMYA 5FPWA 5JZEA 2AUXA 1QXPA 3BBAA 2AIMA 1YT7A 4A5UA 3OVXA 1HUCB 1X9YA 3MORA 2FRQA 3OF9A 3C9EA 5EF4A 4BPVA 2AUZA 4X6IA 3D6SA 3KKUA 2NQDB 4W4UA 4RKXA 4W5CA 3IUTA 3MP2A 2HD5A 3KSEA 2BTWA 4HWYA 1CS8A 4P16A 3HD3A 2OP3A 5CVMA 3AI8A 1TLOA 2FE8A 4YYUA 2YJ8A 1MS6A 1U9QX 3KWZA 3F75A 3PRMA 3I06A 2BDLA 4K7CA 4BQVA 3OQCA 1O0EA 4P6EA 2DCDA 3I3TA 1KHPA 3ZNHA 2YJ9A 3PHWA 1KHQA 3CH2X 3HHIA 4PI3A 4YYRA 2P0RA 2YJ2A 1NQCA 2PREA 4REZA 3OVZA 1Y4HA 4GUAA 3K9MA 3B79A 1XKGA 1BP4A 5EZSA 1YK7A 4BS6A 1MIRA 4FJCA 2G8JA 3WXEA 2YJBA 4N79A 3RVWA 4DMXA 2B1NA 4QRXA 2NQGA 2BDZA 2J7QC 1CB5A 1ATKA 4I04A 1TL9A 2DC6A 8PCHA 4QRGA 1AIMA 4XR7A 2R9MA 3BPFA 1PADA 1Y08A 6PADA 3LFYA 9PAPA 3N4CA 1CSBB 1Q6KA 2XU5A 2Y5BA 5J94A 1U9XA 4RF0A 3PBHA 4W5BA 1DEUA 3MHSA 3WXGA 1CV8A 1KFUL 2FUDA 1MHWA 4Q8HA 4IP3A 1NB3A 2DC9A 1PPPA 2DZYA 4CDFB 2XU4A 2G8EA 3KWBX 2OZ2A 2AU1A 3IMAA 3O1GA 3BC3A 1NL6A 3E1ZB 3MHHA 4CDDB 1PXVA 3IFUA 2AYNA 1BGOA 3PDFA 1PBHA 2P86A 2DC8A 2UZJA 1PCIA 2FRAA 3WXFA 3IV2A 2HWKA 1FH0A 3LXSA 1ME3A 3KFQA 2NQIA 2R9CA 3IEJA 4QBBA 3CBJA 3MTNA 2HHNA 2FYEA 3TNXA 1PPNA 5EGWA 3TRKA 1ITOA 2HXZA 4D8IA 1EWMA 1QDQA 2H7JA 3NHEA 2ARYA 4BOZA 4BOSA 1S4VA 2E02A 3W30A 3K8UA 5CVOB 4BOPA 2DZZA 2E00A 3QSDA 1NLJA 4FIPA 1AU2A 2HH5A 1BY8A 1KFXL 3B21A 2ACTA 3H89A 1M6DA 1F2CA 2G6DA 3P5VA 2CB5A 2WBFX 3P5WA 5KO3A 1A6RA 1F29A 2VHSA 4RNAA 3HHAA 2R9NA 1ZCMA 1NPZA 1EWOA 4X6JA 1CQDA 4D8BA 1YK8A 3O0UA 4XZXA 1YVBA 1AECA 4MZSA 5JA7A 3RVVA 4Q8GA 1QOLA 4KLBA 4AXMA 4YYSA 1GECE 1GCBA 4WA6A 4BSQA 1AYVA 1PVJA 3H7DA 3PT2A 4PP2E 3KW9A 3USVA 4MM3B 4YVAA 2FT2A 1AYUA 4AXLA 3ERVA 1PPDA 4CDCB 3S3RA 1EWLA 3PHUA 3GCBA 2GFOA 2AGAA 2IBIA 3BB7A 7PCKA 4YV8A 2IPPB 3QJ3A 1AU3A 1EWPA 1YALA 5JH3A 2AVWA 4N4ZA 2YJCA 1YZBA 3W31A 1CPJA 5CHTA 2JRIA 4QRVA 3PHXA 1GLOA 3P5UA 1CTEA 3BWKA 4ZUXU 4YYWA 4P6GA 2OULA 4BOQA 1NB5A 2DCAA 2VHFA 3MJ5A 3DF0A 2C0YA 5A24A 4MSXA 3H8CA 1KXRA 4RF1A 4YYVA 2NQAA 2DC7A 5F02A 3O65A
chains in the Genus database with same CATH topology
4RY2A 2AYOA 1ZIVA 1CVZA 2R9OA 3PNRA 4I05A 1W6FA 2Y6EA 4DMYA 2ATOA 3N3GA 1TU6A 2DCCA 1U9VA 5PADA 2DJFB 1SNKA 1STFE 2DJGB 4NV7A 1CJLA 3HWNA 2PADA 2F7DA 2BSZA 2R6NA 4OEMA 4CZWA 3IOQA 1AYWA 4QH6A 2R9FA 4I07A 4PP1A 1MEGA 3OF8A 3K24A 1F2AA 3H8BA 1QMYA 1MDWA 1VSNA 3LTWA 1BQIA 4YYQA 2AS8A 1K3BB 3U8EA 5CVNB 2P7UA 2XU1A 3M99A 3CH3X 1IWDA 4NV8A 1VJVA 3BCNA 3F5VA 2G7YA 3IHPA 2O6XA 5CHVA 1MEMA 2XU3A 1EF7A 2PBHA 3V6CA 4MZOA 2PNSA 4PADA 1POPA 4G54A 3CBKA 1THEA 2E03A 3QT4A 4XUIA 3S3QA 4N8WA 1SP4B 4OELA 2FTDA 3H6SA 1AU4A 2CIOA 3N3KA 1PPOA 4B55A 2JQGR 3OISA 1U9WA 2GHUA 3BPMA 1F2BA 3RVXA 2E01A 3PW3A 1PIPA 1DF0A 1AU0A 2B1MA 4FK5A 4CDEB 2JQFR 1ME4A 2DCBA 1PE6A 4BS5A 3P5XA 2F1GA 3V6EA 5K16A 1U5IA 2FO5A 3BOWA 4X6HA 1ICFA 3ZUAA 2FQ9A 3KX1A 1JQPA 1GMYA 5FPWA 2AUXA 1QXPA 2VFBA 2AIMA 1YT7A 3OVXA 1HUCB 1X9YA 3MORA 2FRQA 3OF9A 3C9EA 5EF4A 4BPVA 2AUZA 4X6IA 3D6SA 3KKUA 2NQDB 4W4UA 4W5CA 3IUTA 2HD5A 3KSEA 4HWYA 1CS8A 3HD3A 2OP3A 5CVMA 3AI8A 1TLOA 4YYUA 2YJ8A 1MS6A 4BGFA 1U9QX 3KWZA 3F75A 3I06A 2BDLA 4K7CA 4BQVA 1O0EA 4P6EA 2DCDA 3I3TA 1KHPA 2YJ9A 1KHQA 3CH2X 3HHIA 4PI3A 4YYRA 2P0RA 2YJ2A 1NQCA 2PREA 3OVZA 1W5RA 1Y4HA 3K9MA 3B79A 1XKGA 1BP4A 1YK7A 4BS6A 1MIRA 4FJCA 2G8JA 3WXEA 2YJBA 4N79A 3RVWA 4DMXA 2B1NA 4QRXA 2NQGA 2BDZA 1CB5A 1ATKA 4I04A 1TL9A 2DC6A 8PCHA 1W4TA 4QRGA 1AIMA 4XR7A 2R9MA 3BPFA 1PADA 1Y08A 6PADA 3LFYA 9PAPA 3N4CA 1CSBB 1Q6KA 2XU5A 2Y5BA 5J94A 1U9XA 3PBHA 4W5BA 2VFCA 1DEUA 3MHSA 3WXGA 1CV8A 1KFUL 2FUDA 1MHWA 4Q8HA 1NB3A 2DC9A 1PPPA 2DZYA 4CDFB 2XU4A 2G8EA 3KWBX 2OZ2A 1GX3A 2AU1A 3IMAA 3O1GA 3BC3A 1NL6A 3E1ZB 3MHHA 4CDDB 1PXVA 2AYNA 1BGOA 3PDFA 1PBHA 3D9WA 2P86A 2DC8A 4GUZA 1PCIA 2FRAA 3WXFA 3IV2A 1FH0A 3LXSA 1ME3A 3KFQA 2NQIA 2R9CA 3IEJA 4QBBA 3CBJA 3MTNA 2HHNA 2FYEA 3TNXA 1PPNA 5EGWA 1ITOA 2HXZA 1EWMA 1QDQA 2H7JA 3NHEA 2ARYA 1S4VA 2E02A 3K8UA 5CVOB 2DZZA 2E00A 3QSDA 1NLJA 4FIPA 1AU2A 2HH5A 1BY8A 1KFXL 4C5PA 2ACTA 3H89A 1M6DA 1F2CA 2G6DA 3P5VA 2CB5A 2WBFX 3P5WA 1A6RA 1F29A 2VHSA 3HHAA 2R9NA 1ZCMA 1NPZA 1EWOA 4X6JA 1CQDA 1YK8A 3O0UA 1YVBA 1AECA 4MZSA 5JA7A 3RVVA 4Q8GA 1QOLA 4KLBA 4AXMA 4YYSA 1GECE 1GCBA 4WA6A 4BSQA 1AYVA 3H7DA 4PP2E 3KW9A 3USVA 1E2TA 4YVAA 2FT2A 1AYUA 4AXLA 3ERVA 1PPDA 4CDCB 3S3RA 1EWLA 3GCBA 2GFOA 2IBIA 7PCKA 4YV8A 2IPPB 3QJ3A 1AU3A 1EWPA 1YALA 5JH3A 2AVWA 4N4ZA 2YJCA 1CPJA 5CHTA 4QRVA 1GLOA 3P5UA 1CTEA 3BWKA 4ZUXU 4YYWA 4P6GA 2OULA 1NB5A 2DCAA 2VHFA 3DF0A 2C0YA 5A24A 4MSXA 3H8CA 1KXRA 4YYVA 2NQAA 2DC7A 5F02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RY2 A;  2AYO A;  1ZIV A;  1CVZ A;  2R9O A;  3PNR A;  4I05 A;  2Y6E A;  4DMY A;  2ATO A;  3N3G A;  1TU6 A;  2DCC A;  1U9V A;  5PAD A;  2DJF B;  1SNK A;  1STF E;  2DJG B;  1CJL A;  3HWN A;  2PAD A;  2F7D A;  2R6N A;  4OEM A;  4CZW A;  3IOQ A;  1AYW A;  4QH6 A;  2R9F A;  4I07 A;  4PP1 A;  1MEG A;  3OF8 A;  3K24 A;  1F2A A;  3H8B A;  1QMY A;  1MDW A;  1VSN A;  1BQI A;  4YYQ A;  2AS8 A;  1K3B B;  3U8E A;  5CVN B;  2P7U A;  2XU1 A;  3M99 A;  3CH3 X;  1IWD A;  1VJV A;  3BCN A;  3F5V A;  2G7Y A;  3IHP A;  2O6X A;  5CHV A;  1MEM A;  2XU3 A;  1EF7 A;  2PBH A;  3V6C A;  4MZO A;  2PNS A;  4PAD A;  1POP A;  4G54 A;  3CBK A;  1THE A;  2E03 A;  3QT4 A;  4XUI A;  3S3Q A;  4N8W A;  1SP4 B;  4OEL A;  2FTD A;  3H6S A;  1AU4 A;  2CIO A;  3N3K A;  1PPO A;  2JQG R;  3OIS A;  1U9W A;  2GHU A;  3BPM A;  1F2B A;  3RVX A;  2E01 A;  3PW3 A;  1PIP A;  1DF0 A;  1AU0 A;  2B1M A;  4FK5 A;  4CDE B;  2JQF R;  1ME4 A;  2DCB A;  1PE6 A;  4BS5 A;  3P5X A;  2F1G A;  3V6E A;  5K16 A;  1U5I A;  2FO5 A;  3BOW A;  4X6H A;  1ICF A;  3ZUA A;  2FQ9 A;  3KX1 A;  1JQP A;  1GMY A;  5FPW A;  2AUX A;  1QXP A;  2AIM A;  1YT7 A;  3OVX A;  1HUC B;  1X9Y A;  3MOR A;  2FRQ A;  3OF9 A;  3C9E A;  5EF4 A;  4BPV A;  2AUZ A;  4X6I A;  3D6S A;  3KKU A;  2NQD B;  4W4U A;  4W5C A;  3IUT A;  2HD5 A;  3KSE A;  4HWY A;  1CS8 A;  3HD3 A;  2OP3 A;  5CVM A;  3AI8 A;  1TLO A;  4YYU A;  2YJ8 A;  1MS6 A;  1U9Q X;  3KWZ A;  3F75 A;  3I06 A;  2BDL A;  4K7C A;  4BQV A;  1O0E A;  4P6E A;  2DCD A;  3I3T A;  1KHP A;  2YJ9 A;  1KHQ A;  3CH2 X;  3HHI A;  4PI3 A;  4YYR A;  2P0R A;  2YJ2 A;  1NQC A;  2PRE A;  3OVZ A;  1Y4H A;  3K9M A;  3B79 A;  1XKG A;  1BP4 A;  1YK7 A;  4BS6 A;  1MIR A;  4FJC A;  2G8J A;  3WXE A;  2YJB A;  4N79 A;  3RVW A;  4DMX A;  2B1N A;  4QRX A;  2NQG A;  2BDZ A;  1CB5 A;  1ATK A;  4I04 A;  1TL9 A;  2DC6 A;  8PCH A;  4QRG A;  1AIM A;  4XR7 A;  2R9M A;  3BPF A;  1PAD A;  1Y08 A;  6PAD A;  3LFY A;  9PAP A;  3N4C A;  1CSB B;  1Q6K A;  2XU5 A;  2Y5B A;  5J94 A;  1U9X A;  3PBH A;  4W5B A;  1DEU A;  3MHS A;  3WXG A;  1CV8 A;  1KFU L;  2FUD A;  1MHW A;  4Q8H A;  1NB3 A;  2DC9 A;  1PPP A;  2DZY A;  4CDF B;  2XU4 A;  2G8E A;  3KWB X;  2OZ2 A;  2AU1 A;  3IMA A;  3O1G A;  3BC3 A;  1NL6 A;  3E1Z B;  3MHH A;  4CDD B;  1PXV A;  2AYN A;  1BGO A;  3PDF A;  1PBH A;  2P86 A;  2DC8 A;  1PCI A;  2FRA A;  3WXF A;  3IV2 A;  1FH0 A;  3LXS A;  1ME3 A;  3KFQ A;  2NQI A;  2R9C A;  3IEJ A;  4QBB A;  3CBJ A;  3MTN A;  2HHN A;  2FYE A;  3TNX A;  1PPN A;  5EGW A;  1ITO A;  2HXZ A;  1EWM A;  1QDQ A;  2H7J A;  3NHE A;  2ARY A;  1S4V A;  2E02 A;  3K8U A;  5CVO B;  2DZZ A;  2E00 A;  3QSD A;  1NLJ A;  4FIP A;  1AU2 A;  2HH5 A;  1BY8 A;  1KFX L;  2ACT A;  3H89 A;  1M6D A;  1F2C A;  2G6D A;  3P5V A;  2CB5 A;  2WBF X;  3P5W A;  1A6R A;  1F29 A;  2VHS A;  3HHA A;  2R9N A;  1ZCM A;  1NPZ A;  1EWO A;  4X6J A;  1CQD A;  1YK8 A;  3O0U A;  1YVB A;  1AEC A;  4MZS A;  5JA7 A;  3RVV A;  4Q8G A;  1QOL A;  4KLB A;  4AXM A;  4YYS A;  1GEC E;  1GCB A;  4WA6 A;  4BSQ A;  1AYV A;  3H7D A;  4PP2 E;  3KW9 A;  3USV A;  4YVA A;  2FT2 A;  1AYU A;  4AXL A;  3ERV A;  1PPD A;  4CDC B;  3S3R A;  1EWL A;  3GCB A;  2GFO A;  2IBI A;  7PCK A;  4YV8 A;  2IPP B;  3QJ3 A;  1AU3 A;  1EWP A;  1YAL A;  5JH3 A;  2AVW A;  4N4Z A;  2YJC A;  1CPJ A;  5CHT A;  4QRV A;  1GLO A;  3P5U A;  1CTE A;  3BWK A;  4ZUX U;  4YYW A;  4P6G A;  2OUL A;  1NB5 A;  2DCA A;  2VHF A;  3DF0 A;  2C0Y A;  5A24 A;  4MSX A;  3H8C A;  1KXR A;  4YYV A;  2NQA A;  2DC7 A;  5F02 A; 
#chains in the Genus database with same CATH topology
 4RY2 A;  2AYO A;  1ZIV A;  1CVZ A;  2R9O A;  3PNR A;  4I05 A;  3PRP A;  2Y6E A;  4DMY A;  2ATO A;  3N3G A;  1TU6 A;  2DCC A;  1U9V A;  5PAD A;  2DJF B;  1SNK A;  5EZQ A;  1STF E;  2DOS A;  2DJG B;  1UKF A;  1CJL A;  3HWN A;  2PAD A;  3TMP A;  4MI7 A;  2F7D A;  2R6N A;  4OEM A;  4CZW A;  3IOQ A;  1AYW A;  4QH6 A;  2R9F A;  4I07 A;  4PP1 A;  1MEG A;  1DKI A;  3OF8 A;  3K24 A;  4IUM A;  1F2A A;  3H8B A;  1QMY A;  1MDW A;  2Z84 A;  1VSN A;  1BQI A;  4YYQ A;  2AS8 A;  1K3B B;  3U8E A;  5CVN B;  2P7U A;  2XU1 A;  3M99 A;  3CH3 X;  4OVZ B;  1IWD A;  2BU3 A;  1VJV A;  4OW0 A;  3BCN A;  2JTC A;  2G7Y A;  3F5V A;  2O6X A;  3IHP A;  5CHV A;  1MEM A;  2XU3 A;  1EF7 A;  2PBH A;  3V6C A;  4MZO A;  2PNS A;  4PAD A;  1POP A;  3C0R A;  4G54 A;  3CBK A;  2J7Q A;  1THE A;  2E03 A;  3QT4 A;  4XUI A;  3S3Q A;  3E9S A;  4N8W A;  1SP4 B;  4OEL A;  2FTD A;  3H6S A;  1AU4 A;  2CIO A;  4ZTB A;  3RNV A;  3N3K A;  1PPO A;  4PT5 A;  2JQG R;  3BY4 A;  2BTW B;  3OIS A;  1U9W A;  2GHU A;  4BOU A;  4WUR A;  3MTV A;  3BPM A;  1F2B A;  3RVX A;  4M0W A;  2E01 A;  3PW3 A;  1PIP A;  1DF0 A;  5E6J A;  1AU0 A;  2B1M A;  4FK5 A;  4R3D A;  4CDE B;  2JQF R;  1ME4 A;  2DCB A;  1PE6 A;  4BS5 A;  4OVZ A;  3PSE A;  3P5X A;  2F1G A;  4D8E A;  3V6E A;  5K16 A;  1U5I A;  2FO5 A;  3BOW A;  4X6H A;  1ICF A;  3ZUA A;  4HXD B;  2FQ9 A;  3KX1 A;  1JQP A;  1GMY A;  5FPW A;  5JZE A;  2AUX A;  1QXP A;  3BBA A;  2AIM A;  1YT7 A;  4A5U A;  3OVX A;  1HUC B;  1X9Y A;  3MOR A;  2FRQ A;  3OF9 A;  3C9E A;  5EF4 A;  4BPV A;  2AUZ A;  4X6I A;  3D6S A;  3KKU A;  2NQD B;  4W4U A;  4RKX A;  4W5C A;  3IUT A;  3MP2 A;  2HD5 A;  3KSE A;  2BTW A;  4HWY A;  1CS8 A;  4P16 A;  3HD3 A;  2OP3 A;  5CVM A;  3AI8 A;  1TLO A;  2FE8 A;  4YYU A;  2YJ8 A;  1MS6 A;  1U9Q X;  3KWZ A;  3F75 A;  3PRM A;  3I06 A;  2BDL A;  4K7C A;  4BQV A;  3OQC A;  1O0E A;  4P6E A;  2DCD A;  3I3T A;  1KHP A;  3ZNH A;  2YJ9 A;  3PHW A;  1KHQ A;  3CH2 X;  3HHI A;  4PI3 A;  4YYR A;  2P0R A;  2YJ2 A;  1NQC A;  2PRE A;  4REZ A;  3OVZ A;  1Y4H A;  4GUA A;  3K9M A;  3B79 A;  1XKG A;  1BP4 A;  5EZS A;  1YK7 A;  4BS6 A;  1MIR A;  4FJC A;  2G8J A;  3WXE A;  2YJB A;  4N79 A;  3RVW A;  4DMX A;  2B1N A;  4QRX A;  2NQG A;  2BDZ A;  2J7Q C;  1CB5 A;  1ATK A;  4I04 A;  1TL9 A;  2DC6 A;  8PCH A;  4QRG A;  1AIM A;  4XR7 A;  2R9M A;  3BPF A;  1PAD A;  1Y08 A;  6PAD A;  3LFY A;  9PAP A;  3N4C A;  1CSB B;  1Q6K A;  2XU5 A;  2Y5B A;  5J94 A;  1U9X A;  4RF0 A;  3PBH A;  4W5B A;  1DEU A;  3MHS A;  3WXG A;  1CV8 A;  1KFU L;  2FUD A;  1MHW A;  4Q8H A;  4IP3 A;  1NB3 A;  2DC9 A;  1PPP A;  2DZY A;  4CDF B;  2XU4 A;  2G8E A;  3KWB X;  2OZ2 A;  2AU1 A;  3IMA A;  3O1G A;  3BC3 A;  1NL6 A;  3E1Z B;  3MHH A;  4CDD B;  1PXV A;  3IFU A;  2AYN A;  1BGO A;  3PDF A;  1PBH A;  2P86 A;  2DC8 A;  2UZJ A;  1PCI A;  2FRA A;  3WXF A;  3IV2 A;  2HWK A;  1FH0 A;  3LXS A;  1ME3 A;  3KFQ A;  2NQI A;  2R9C A;  3IEJ A;  4QBB A;  3CBJ A;  3MTN A;  2HHN A;  2FYE A;  3TNX A;  1PPN A;  5EGW A;  3TRK A;  1ITO A;  2HXZ A;  4D8I A;  1EWM A;  1QDQ A;  2H7J A;  3NHE A;  2ARY A;  4BOZ A;  4BOS A;  1S4V A;  2E02 A;  3W30 A;  3K8U A;  5CVO B;  4BOP A;  2DZZ A;  2E00 A;  3QSD A;  1NLJ A;  4FIP A;  1AU2 A;  2HH5 A;  1BY8 A;  1KFX L;  3B21 A;  2ACT A;  3H89 A;  1M6D A;  1F2C A;  2G6D A;  3P5V A;  2CB5 A;  2WBF X;  3P5W A;  5KO3 A;  1A6R A;  1F29 A;  2VHS A;  4RNA A;  3HHA A;  2R9N A;  1ZCM A;  1NPZ A;  1EWO A;  4X6J A;  1CQD A;  4D8B A;  1YK8 A;  3O0U A;  4XZX A;  1YVB A;  1AEC A;  4MZS A;  5JA7 A;  3RVV A;  4Q8G A;  1QOL A;  4KLB A;  4AXM A;  4YYS A;  1GEC E;  1GCB A;  4WA6 A;  4BSQ A;  1AYV A;  1PVJ A;  3H7D A;  3PT2 A;  4PP2 E;  3KW9 A;  3USV A;  4MM3 B;  4YVA A;  2FT2 A;  1AYU A;  4AXL A;  3ERV A;  1PPD A;  4CDC B;  3S3R A;  1EWL A;  3PHU A;  3GCB A;  2GFO A;  2AGA A;  2IBI A;  3BB7 A;  7PCK A;  4YV8 A;  2IPP B;  3QJ3 A;  1AU3 A;  1EWP A;  1YAL A;  5JH3 A;  2AVW A;  4N4Z A;  2YJC A;  1YZB A;  3W31 A;  1CPJ A;  5CHT A;  2JRI A;  4QRV A;  3PHX A;  1GLO A;  3P5U A;  1CTE A;  3BWK A;  4ZUX U;  4YYW A;  4P6G A;  2OUL A;  4BOQ A;  1NB5 A;  2DCA A;  2VHF A;  3MJ5 A;  3DF0 A;  2C0Y A;  5A24 A;  4MSX A;  3H8C A;  1KXR A;  4RF1 A;  4YYV A;  2NQA A;  2DC7 A;  5F02 A;  3O65 A; 
#chains in the Genus database with same CATH homology
 4RY2 A;  2AYO A;  1ZIV A;  1CVZ A;  2R9O A;  3PNR A;  4I05 A;  1W6F A;  2Y6E A;  4DMY A;  2ATO A;  3N3G A;  1TU6 A;  2DCC A;  1U9V A;  5PAD A;  2DJF B;  1SNK A;  1STF E;  2DJG B;  4NV7 A;  1CJL A;  3HWN A;  2PAD A;  2F7D A;  2BSZ A;  2R6N A;  4OEM A;  4CZW A;  3IOQ A;  1AYW A;  4QH6 A;  2R9F A;  4I07 A;  4PP1 A;  1MEG A;  3OF8 A;  3K24 A;  1F2A A;  3H8B A;  1QMY A;  1MDW A;  1VSN A;  3LTW A;  1BQI A;  4YYQ A;  2AS8 A;  1K3B B;  3U8E A;  5CVN B;  2P7U A;  2XU1 A;  3M99 A;  3CH3 X;  1IWD A;  4NV8 A;  1VJV A;  3BCN A;  3F5V A;  2G7Y A;  3IHP A;  2O6X A;  5CHV A;  1MEM A;  2XU3 A;  1EF7 A;  2PBH A;  3V6C A;  4MZO A;  2PNS A;  4PAD A;  1POP A;  4G54 A;  3CBK A;  1THE A;  2E03 A;  3QT4 A;  4XUI A;  3S3Q A;  4N8W A;  1SP4 B;  4OEL A;  2FTD A;  3H6S A;  1AU4 A;  2CIO A;  3N3K A;  1PPO A;  4B55 A;  2JQG R;  3OIS A;  1U9W A;  2GHU A;  3BPM A;  1F2B A;  3RVX A;  2E01 A;  3PW3 A;  1PIP A;  1DF0 A;  1AU0 A;  2B1M A;  4FK5 A;  4CDE B;  2JQF R;  1ME4 A;  2DCB A;  1PE6 A;  4BS5 A;  3P5X A;  2F1G A;  3V6E A;  5K16 A;  1U5I A;  2FO5 A;  3BOW A;  4X6H A;  1ICF A;  3ZUA A;  2FQ9 A;  3KX1 A;  1JQP A;  1GMY A;  5FPW A;  2AUX A;  1QXP A;  2VFB A;  2AIM A;  1YT7 A;  3OVX A;  1HUC B;  1X9Y A;  3MOR A;  2FRQ A;  3OF9 A;  3C9E A;  5EF4 A;  4BPV A;  2AUZ A;  4X6I A;  3D6S A;  3KKU A;  2NQD B;  4W4U A;  4W5C A;  3IUT A;  2HD5 A;  3KSE A;  4HWY A;  1CS8 A;  3HD3 A;  2OP3 A;  5CVM A;  3AI8 A;  1TLO A;  4YYU A;  2YJ8 A;  1MS6 A;  4BGF A;  1U9Q X;  3KWZ A;  3F75 A;  3I06 A;  2BDL A;  4K7C A;  4BQV A;  1O0E A;  4P6E A;  2DCD A;  3I3T A;  1KHP A;  2YJ9 A;  1KHQ A;  3CH2 X;  3HHI A;  4PI3 A;  4YYR A;  2P0R A;  2YJ2 A;  1NQC A;  2PRE A;  3OVZ A;  1W5R A;  1Y4H A;  3K9M A;  3B79 A;  1XKG A;  1BP4 A;  1YK7 A;  4BS6 A;  1MIR A;  4FJC A;  2G8J A;  3WXE A;  2YJB A;  4N79 A;  3RVW A;  4DMX A;  2B1N A;  4QRX A;  2NQG A;  2BDZ A;  1CB5 A;  1ATK A;  4I04 A;  1TL9 A;  2DC6 A;  8PCH A;  1W4T A;  4QRG A;  1AIM A;  4XR7 A;  2R9M A;  3BPF A;  1PAD A;  1Y08 A;  6PAD A;  3LFY A;  9PAP A;  3N4C A;  1CSB B;  1Q6K A;  2XU5 A;  2Y5B A;  5J94 A;  1U9X A;  3PBH A;  4W5B A;  2VFC A;  1DEU A;  3MHS A;  3WXG A;  1CV8 A;  1KFU L;  2FUD A;  1MHW A;  4Q8H A;  1NB3 A;  2DC9 A;  1PPP A;  2DZY A;  4CDF B;  2XU4 A;  2G8E A;  3KWB X;  2OZ2 A;  1GX3 A;  2AU1 A;  3IMA A;  3O1G A;  3BC3 A;  1NL6 A;  3E1Z B;  3MHH A;  4CDD B;  1PXV A;  2AYN A;  1BGO A;  3PDF A;  1PBH A;  3D9W A;  2P86 A;  2DC8 A;  4GUZ A;  1PCI A;  2FRA A;  3WXF A;  3IV2 A;  1FH0 A;  3LXS A;  1ME3 A;  3KFQ A;  2NQI A;  2R9C A;  3IEJ A;  4QBB A;  3CBJ A;  3MTN A;  2HHN A;  2FYE A;  3TNX A;  1PPN A;  5EGW A;  1ITO A;  2HXZ A;  1EWM A;  1QDQ A;  2H7J A;  3NHE A;  2ARY A;  1S4V A;  2E02 A;  3K8U A;  5CVO B;  2DZZ A;  2E00 A;  3QSD A;  1NLJ A;  4FIP A;  1AU2 A;  2HH5 A;  1BY8 A;  1KFX L;  4C5P A;  2ACT A;  3H89 A;  1M6D A;  1F2C A;  2G6D A;  3P5V A;  2CB5 A;  2WBF X;  3P5W A;  1A6R A;  1F29 A;  2VHS A;  3HHA A;  2R9N A;  1ZCM A;  1NPZ A;  1EWO A;  4X6J A;  1CQD A;  1YK8 A;  3O0U A;  1YVB A;  1AEC A;  4MZS A;  5JA7 A;  3RVV A;  4Q8G A;  1QOL A;  4KLB A;  4AXM A;  4YYS A;  1GEC E;  1GCB A;  4WA6 A;  4BSQ A;  1AYV A;  3H7D A;  4PP2 E;  3KW9 A;  3USV A;  1E2T A;  4YVA A;  2FT2 A;  1AYU A;  4AXL A;  3ERV A;  1PPD A;  4CDC B;  3S3R A;  1EWL A;  3GCB A;  2GFO A;  2IBI A;  7PCK A;  4YV8 A;  2IPP B;  3QJ3 A;  1AU3 A;  1EWP A;  1YAL A;  5JH3 A;  2AVW A;  4N4Z A;  2YJC A;  1CPJ A;  5CHT A;  4QRV A;  1GLO A;  3P5U A;  1CTE A;  3BWK A;  4ZUX U;  4YYW A;  4P6G A;  2OUL A;  1NB5 A;  2DCA A;  2VHF A;  3DF0 A;  2C0Y A;  5A24 A;  4MSX A;  3H8C A;  1KXR A;  4YYV A;  2NQA A;  2DC7 A;  5F02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...