2OULA

The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
b'QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
publication title The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of an inhibitor family.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 74
structure length 241
sequence length 241
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2oulA00
3CH2X 3F5VA 1YALA 1MHWA 5CHTA 4BPVA 3PDFA 3BPFA 4CDDB 4YYUA 3N3KA 4AXMA 2AYNA 4YYRA 1BP4A 1QMYA 4DMYA 7PCKA 3KX1A 4YYSA 2HHNA 2NQIA 4N8WA 4CZWA 3QJ3A 2Y6EA 3K8UA 1ZIVA 2FQ9A 3USVA 4MZOA 4CDCB 1CVZA 2Y5BA 1EF7A 4G54A 1NL6A 3HD3A 2AUZA 5K16A 4YVAA 4YYQA 2B1MA 1BGOA 3PW3A 4YV8A 2HH5A 2BDLA 1PPOA 1GCBA 2DCBA 3TNXA 2DC8A 4N79A 3E1ZB 2OZ2A 2HD5A 2AU1A 1ME3A 3P5XA 1YVBA 2G8EA 3NHEA 2R9OA 1AYWA 1DF0A 4DMXA 2DC9A 2OULA 3H8BA 2NQGA 3IOQA 3KFQA 4CDFB 4MSXA 4QBBA 4KLBA 2XU4A 1EWMA 3GCBA 3U8EA 2AYOA 8PCHA 2G7YA 3V6EA 2DC7A 4QH6A 2YJCA 4K7CA 3MTNA 1AU2A 1Y08A 3O0UA 1KXRA 2E02A 3KWZA 2DCAA 3KSEA 4YYWA 5PADA 2FRAA 3ZUAA 4QRXA 2R6NA 4I05A 2B1NA 4FIPA 2YJ9A 1POPA 4PP1A 2R9CA 3OVXA 1SNKA 4XUIA 2JQFR 2P86A 2VHSA 2G6DA 2H7JA 3B79A 2WBFX 1CS8A 3MHHA 2IPPB 3RVXA 3P5VA 3IUTA 3D6SA 1HUCB 3I06A 4PP2E 4X6JA 3V6CA 2JQGR 2FT2A 1QXPA 1CJLA 2P7UA 3KW9A 4WA6A 3PNRA 3H7DA 1KFXL 3OF9A 3WXEA 2FRQA 3CH3X 1NLJA 2AS8A 5JH3A 1DEUA 2PREA 2YJ8A 1U9VA 2C0YA 2E00A 1NB5A 2NQDB 3IV2A 3RVVA 2R9FA 1CV8A 2DCDA 1MIRA 3OVZA 3IMAA 1ICFA 2G8JA 2PNSA 3AI8A 4OEMA 1PPNA 4XR7A 2P0RA 2CB5A 1ITOA 1F2BA 2GFOA 3WXGA 4W4UA 2XU5A 5EF4A 2IBIA 5J94A 1NPZA 3I3TA 1CPJA 2O6XA 3K24A 1X9YA 4Q8GA 4CDEB 1KHQA 4ZUXU 3CBKA 1EWPA 3BOWA 1CQDA 1ATKA 1K3BB 3HWNA 3H6SA 3H8CA 3P5UA 5FPWA 1NB3A 1IWDA 1VJVA 1A6RA 3KWBX 1M6DA 2FO5A 2AIMA 1PXVA 3CBJA 1AU3A 4BS5A 3S3QA 1U9WA 1PBHA 2AUXA 4P6EA 1YK8A 4N4ZA 3IHPA 1STFE 2FTDA 2HXZA 2ATOA 5JA7A 4I07A 4BS6A 4YYVA 1AYUA 5A24A 1EWOA 1JQPA 3KKUA 4W5CA 4PI3A 2DZYA 1AU0A 1Y4HA 1GMYA 1AECA 3MHSA 4HWYA 3F75A 1U5IA 2E03A 3BPMA 5CHVA 1CTEA 1MDWA 4BQVA 4BSQA 1U9QX 1ZCMA 6PADA 1PIPA 3MORA 1F29A 2PADA 2DJFB 3K9MA 1ME4A 3LFYA 4X6HA 2FYEA 4MZSA 1FH0A 1KHPA 1QDQA 3BWKA 5CVMA 3N4CA 4I04A 1MS6A 1GECE 3S3RA 2BDZA 3QSDA 1XKGA 1CB5A 2DZZA 2DJGB 2R9NA 2FUDA 2F1GA 1THEA 1PADA 1BY8A 4X6IA 2YJ2A 3C9EA 2CIOA 2ACTA 1AIMA 2NQAA 3O1GA 4Q8HA 2OP3A 5F02A 3ERVA 2XU1A 1GLOA 1S4VA 3HHIA 1VSNA 3N3GA 9PAPA 1YK7A 1TLOA 3BCNA 1O0EA 4FJCA 1TU6A 1NQCA 3WXFA 1F2AA 1KFUL 2F7DA 2R9MA 3PBHA 5EGWA 3OF8A 1F2CA 1PPDA 1EWLA 3RVWA 5CVOB 3OISA 4PADA 2ARYA 1AU4A 1PE6A 3P5WA 1Q6KA 1U9XA 1MEMA 4RY2A 2GHUA 3QT4A 2PBHA 1MEGA 1YT7A 2E01A 3BC3A 1AYVA 2XU3A 4FK5A 4W5BA 1QOLA 3DF0A 4OELA 4QRGA 2DC6A 3IEJA 1PPPA 3HHAA 4P6GA 2DCCA 5CVNB 2YJBA 1TL9A 1SP4B 3H89A 4QRVA 2VHFA 3M99A 1CSBB 3LXSA 1PCIA 4AXLA 2AVWA 1BQIA
chains in the Genus database with same CATH superfamily
3CH2X 3F5VA 1YALA 1MHWA 5CHTA 4BPVA 3PDFA 4D8BA 2BU3A 3BPFA 4CDDB 4YYUA 3N3KA 4AXMA 4A5UA 2AYNA 4YYRA 4PT5A 1BP4A 1QMYA 4DMYA 4P16A 7PCKA 3KX1A 4YYSA 2HHNA 2NQIA 4N8WA 4CZWA 3QJ3A 2Y6EA 2JTCA 3K8UA 2J7QA 1ZIVA 2FQ9A 4RKXA 3BBAA 3USVA 4MZOA 4CDCB 1CVZA 2Y5BA 1EF7A 4G54A 5E6JA 1NL6A 3BB7A 3HD3A 2AUZA 5K16A 4YVAA 4YYQA 4D8EA 2B1MA 4XZXA 1BGOA 3PW3A 4YV8A 2HH5A 2BDLA 1PPOA 1GCBA 2DCBA 3TNXA 2DC8A 4N79A 3E1ZB 2OZ2A 2HD5A 2AU1A 1ME3A 3P5XA 1YVBA 2G8EA 3NHEA 2R9OA 1AYWA 1DF0A 4DMXA 2DC9A 2OULA 3H8BA 4WURA 2NQGA 3IOQA 3KFQA 4CDFB 4MSXA 4QBBA 4KLBA 2XU4A 4MI7A 1EWMA 3GCBA 4IUMA 3U8EA 2AYOA 8PCHA 2G7YA 3V6EA 2DC7A 4QH6A 2YJCA 4K7CA 3MTNA 1AU2A 1Y08A 3O0UA 1KXRA 2E02A 3KWZA 2DCAA 3KSEA 4YYWA 4M0WA 5PADA 2FRAA 3ZUAA 4QRXA 2R6NA 4I05A 2B1NA 4FIPA 2YJ9A 1POPA 3PHWA 4PP1A 2R9CA 3OVXA 1SNKA 4XUIA 2JQFR 2P86A 2VHSA 3W31A 3B21A 2G6DA 2H7JA 3B79A 2WBFX 1CS8A 3MHHA 2IPPB 3RVXA 3P5VA 3IUTA 3D6SA 3C0RA 1HUCB 3I06A 4PP2E 4X6JA 3V6CA 2JQGR 3MJ5A 3OQCA 2FT2A 1QXPA 1CJLA 2P7UA 3KW9A 4WA6A 3MP2A 4MM3B 3PNRA 3H7DA 1KFXL 3OF9A 3WXEA 2FRQA 3CH3X 1NLJA 2AS8A 1PVJA 5JH3A 3PHUA 3PRPA 1DEUA 2PREA 3MTVA 3BY4A 2YJ8A 1U9VA 5EZSA 4ZTBA 2C0YA 2E00A 1NB5A 2BTWA 2NQDB 3IV2A 3RVVA 2R9FA 2HWKA 1CV8A 4RF1A 2DCDA 1MIRA 3OVZA 3IMAA 1ICFA 2G8JA 2PNSA 3AI8A 4OEMA 1PPNA 4XR7A 2P0RA 2CB5A 1ITOA 1F2BA 2GFOA 3WXGA 4W4UA 2XU5A 5EF4A 2IBIA 2BTWB 5J94A 4IP3A 1NPZA 3I3TA 1CPJA 2O6XA 3K24A 1X9YA 4Q8GA 4CDEB 1KHQA 4ZUXU 3CBKA 1EWPA 3BOWA 3E9SA 1CQDA 1ATKA 1K3BB 3HWNA 3H6SA 3H8CA 3P5UA 5FPWA 1NB3A 1IWDA 1VJVA 1A6RA 3TRKA 3KWBX 4BOPA 1M6DA 2FO5A 2AIMA 1PXVA 3CBJA 1AU3A 4BS5A 3S3QA 1U9WA 1PBHA 3W30A 2AUXA 3O65A 4BOUA 4P6EA 1YK8A 4N4ZA 3IHPA 1STFE 2FTDA 2HXZA 2ATOA 5JA7A 4I07A 5EZQA 4BS6A 1UKFA 4YYVA 3PHXA 1AYUA 3TMPA 5A24A 1EWOA 1JQPA 3ZNHA 3KKUA 4D8IA 4W5CA 4PI3A 3PT2A 2DZYA 1AU0A 1Y4HA 1GMYA 1AECA 3MHSA 4HWYA 3F75A 1U5IA 2E03A 3BPMA 2DOSA 5CHVA 1CTEA 1MDWA 4BQVA 4BSQA 1U9QX 1ZCMA 6PADA 1PIPA 3MORA 4HXDB 1F29A 3IFUA 2PADA 2DJFB 2JRIA 3K9MA 1ME4A 3RNVA 3LFYA 4X6HA 4REZA 2FYEA 4MZSA 1FH0A 1KHPA 1QDQA 4RF0A 4BOQA 3BWKA 5CVMA 4OW0A 3N4CA 4I04A 1MS6A 3PRMA 1GECE 3S3RA 2BDZA 3QSDA 1XKGA 1CB5A 2DZZA 2J7QC 2DJGB 1DKIA 2R9NA 2FUDA 2F1GA 1THEA 1PADA 4R3DA 1BY8A 4X6IA 2YJ2A 3C9EA 2CIOA 2ACTA 1AIMA 2NQAA 3O1GA 4Q8HA 2OP3A 5F02A 3ERVA 2XU1A 1GLOA 1S4VA 3HHIA 1VSNA 3N3GA 9PAPA 1YK7A 1TLOA 3BCNA 2UZJA 1O0EA 4FJCA 1TU6A 1NQCA 2Z84A 3WXFA 1F2AA 1KFUL 2F7DA 4RNAA 2R9MA 3PBHA 1YZBA 5EGWA 3OF8A 1F2CA 5JZEA 1PPDA 1EWLA 4BOSA 3RVWA 5CVOB 3OISA 4PADA 2ARYA 4OVZA 1AU4A 1PE6A 3P5WA 1Q6KA 1U9XA 1MEMA 4RY2A 2GHUA 3QT4A 2PBHA 1MEGA 1YT7A 2E01A 3BC3A 4GUAA 1AYVA 2XU3A 4FK5A 4W5BA 1QOLA 3DF0A 4OELA 2FE8A 4QRGA 2DC6A 3IEJA 1PPPA 3HHAA 4BOZA 4P6GA 2DCCA 4OVZB 5CVNB 2YJBA 1TL9A 2AGAA 1SP4B 5KO3A 3PSEA 3H89A 4QRVA 2VHFA 3M99A 1CSBB 3LXSA 1PCIA 4AXLA 2AVWA 1BQIA
chains in the Genus database with same CATH topology
3CH2X 3F5VA 1YALA 1MHWA 1W6FA 5CHTA 4BPVA 3PDFA 3BPFA 4CDDB 4YYUA 3N3KA 4AXMA 3D9WA 2AYNA 4YYRA 1BP4A 1QMYA 4DMYA 7PCKA 3KX1A 4YYSA 2HHNA 2NQIA 4N8WA 4CZWA 3QJ3A 2Y6EA 3K8UA 1ZIVA 2FQ9A 3USVA 4MZOA 4CDCB 1CVZA 2Y5BA 1EF7A 4G54A 1NL6A 3HD3A 2AUZA 5K16A 4YVAA 4YYQA 4GUZA 2B1MA 4NV8A 1BGOA 3PW3A 4YV8A 2HH5A 2BDLA 1PPOA 1GCBA 2DCBA 3TNXA 2DC8A 4N79A 3E1ZB 2OZ2A 2HD5A 2AU1A 1ME3A 3P5XA 1YVBA 2G8EA 3NHEA 2R9OA 1AYWA 1DF0A 4DMXA 2DC9A 2OULA 3H8BA 2NQGA 3IOQA 3KFQA 4CDFB 4MSXA 4QBBA 4KLBA 2XU4A 1EWMA 3GCBA 3U8EA 2AYOA 8PCHA 2G7YA 3V6EA 2DC7A 4QH6A 2YJCA 4K7CA 3LTWA 3MTNA 1AU2A 1Y08A 3O0UA 1KXRA 2E02A 3KWZA 2DCAA 3KSEA 4YYWA 5PADA 2FRAA 3ZUAA 4QRXA 2R6NA 4I05A 2B1NA 4FIPA 2YJ9A 1POPA 4PP1A 2R9CA 3OVXA 1SNKA 4XUIA 2JQFR 2P86A 2VHSA 2G6DA 2H7JA 3B79A 2WBFX 1CS8A 3MHHA 2IPPB 3RVXA 3P5VA 3IUTA 3D6SA 1HUCB 3I06A 4PP2E 4X6JA 3V6CA 2JQGR 2FT2A 1QXPA 1CJLA 2P7UA 3KW9A 4WA6A 3PNRA 3H7DA 1KFXL 3OF9A 3WXEA 2FRQA 3CH3X 1NLJA 2AS8A 5JH3A 1DEUA 2PREA 1GX3A 4NV7A 4B55A 2YJ8A 1U9VA 2C0YA 2E00A 1NB5A 2NQDB 3IV2A 3RVVA 2R9FA 1CV8A 2VFCA 2DCDA 1MIRA 3OVZA 3IMAA 1ICFA 2G8JA 2PNSA 3AI8A 4OEMA 1PPNA 4XR7A 2P0RA 2CB5A 1ITOA 1F2BA 2GFOA 3WXGA 4W4UA 1W5RA 2XU5A 5EF4A 2IBIA 5J94A 1NPZA 3I3TA 1CPJA 2O6XA 3K24A 1X9YA 1E2TA 4Q8GA 4CDEB 1KHQA 4ZUXU 3CBKA 1EWPA 3BOWA 1CQDA 1ATKA 1K3BB 3HWNA 3H6SA 3H8CA 3P5UA 5FPWA 1NB3A 1IWDA 1VJVA 4C5PA 1A6RA 3KWBX 1M6DA 2FO5A 2AIMA 1PXVA 3CBJA 1AU3A 4BS5A 3S3QA 1U9WA 1PBHA 2AUXA 4P6EA 1YK8A 4N4ZA 3IHPA 1W4TA 1STFE 2FTDA 2HXZA 2ATOA 5JA7A 4I07A 4BS6A 4YYVA 1AYUA 5A24A 1EWOA 1JQPA 3KKUA 4W5CA 4PI3A 2DZYA 1AU0A 1Y4HA 1GMYA 1AECA 3MHSA 4HWYA 3F75A 1U5IA 2E03A 3BPMA 5CHVA 1CTEA 1MDWA 4BQVA 4BSQA 1U9QX 1ZCMA 6PADA 1PIPA 3MORA 1F29A 2PADA 2DJFB 3K9MA 1ME4A 3LFYA 4X6HA 2FYEA 4MZSA 1FH0A 1KHPA 1QDQA 2BSZA 3BWKA 5CVMA 3N4CA 4I04A 1MS6A 1GECE 3S3RA 2BDZA 3QSDA 1XKGA 4BGFA 1CB5A 2DZZA 2DJGB 2R9NA 2FUDA 2F1GA 1THEA 1PADA 1BY8A 4X6IA 2YJ2A 3C9EA 2CIOA 2ACTA 1AIMA 2NQAA 3O1GA 4Q8HA 2OP3A 5F02A 3ERVA 2XU1A 1GLOA 1S4VA 3HHIA 1VSNA 3N3GA 9PAPA 1YK7A 1TLOA 3BCNA 1O0EA 4FJCA 1TU6A 1NQCA 3WXFA 1F2AA 1KFUL 2F7DA 2R9MA 3PBHA 5EGWA 3OF8A 1F2CA 1PPDA 1EWLA 3RVWA 5CVOB 3OISA 4PADA 2ARYA 1AU4A 1PE6A 3P5WA 1Q6KA 1U9XA 2VFBA 1MEMA 4RY2A 2GHUA 3QT4A 2PBHA 1MEGA 1YT7A 2E01A 3BC3A 1AYVA 2XU3A 4FK5A 4W5BA 1QOLA 3DF0A 4OELA 4QRGA 2DC6A 3IEJA 1PPPA 3HHAA 4P6GA 2DCCA 5CVNB 2YJBA 1TL9A 1SP4B 3H89A 4QRVA 2VHFA 3M99A 1CSBB 3LXSA 1PCIA 4AXLA 2AVWA 1BQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CH2 X;  3F5V A;  1YAL A;  1MHW A;  5CHT A;  4BPV A;  3PDF A;  3BPF A;  4CDD B;  4YYU A;  3N3K A;  4AXM A;  2AYN A;  4YYR A;  1BP4 A;  1QMY A;  4DMY A;  7PCK A;  3KX1 A;  4YYS A;  2HHN A;  2NQI A;  4N8W A;  4CZW A;  3QJ3 A;  2Y6E A;  3K8U A;  1ZIV A;  2FQ9 A;  3USV A;  4MZO A;  4CDC B;  1CVZ A;  2Y5B A;  1EF7 A;  4G54 A;  1NL6 A;  3HD3 A;  2AUZ A;  5K16 A;  4YVA A;  4YYQ A;  2B1M A;  1BGO A;  3PW3 A;  4YV8 A;  2HH5 A;  2BDL A;  1PPO A;  1GCB A;  2DCB A;  3TNX A;  2DC8 A;  4N79 A;  3E1Z B;  2OZ2 A;  2HD5 A;  2AU1 A;  1ME3 A;  3P5X A;  1YVB A;  2G8E A;  3NHE A;  2R9O A;  1AYW A;  1DF0 A;  4DMX A;  2DC9 A;  2OUL A;  3H8B A;  2NQG A;  3IOQ A;  3KFQ A;  4CDF B;  4MSX A;  4QBB A;  4KLB A;  2XU4 A;  1EWM A;  3GCB A;  3U8E A;  2AYO A;  8PCH A;  2G7Y A;  3V6E A;  2DC7 A;  4QH6 A;  2YJC A;  4K7C A;  3MTN A;  1AU2 A;  1Y08 A;  3O0U A;  1KXR A;  2E02 A;  3KWZ A;  2DCA A;  3KSE A;  4YYW A;  5PAD A;  2FRA A;  3ZUA A;  4QRX A;  2R6N A;  4I05 A;  2B1N A;  4FIP A;  2YJ9 A;  1POP A;  4PP1 A;  2R9C A;  3OVX A;  1SNK A;  4XUI A;  2JQF R;  2P86 A;  2VHS A;  2G6D A;  2H7J A;  3B79 A;  2WBF X;  1CS8 A;  3MHH A;  2IPP B;  3RVX A;  3P5V A;  3IUT A;  3D6S A;  1HUC B;  3I06 A;  4PP2 E;  4X6J A;  3V6C A;  2JQG R;  2FT2 A;  1QXP A;  1CJL A;  2P7U A;  3KW9 A;  4WA6 A;  3PNR A;  3H7D A;  1KFX L;  3OF9 A;  3WXE A;  2FRQ A;  3CH3 X;  1NLJ A;  2AS8 A;  5JH3 A;  1DEU A;  2PRE A;  2YJ8 A;  1U9V A;  2C0Y A;  2E00 A;  1NB5 A;  2NQD B;  3IV2 A;  3RVV A;  2R9F A;  1CV8 A;  2DCD A;  1MIR A;  3OVZ A;  3IMA A;  1ICF A;  2G8J A;  2PNS A;  3AI8 A;  4OEM A;  1PPN A;  4XR7 A;  2P0R A;  2CB5 A;  1ITO A;  1F2B A;  2GFO A;  3WXG A;  4W4U A;  2XU5 A;  5EF4 A;  2IBI A;  5J94 A;  1NPZ A;  3I3T A;  1CPJ A;  2O6X A;  3K24 A;  1X9Y A;  4Q8G A;  4CDE B;  1KHQ A;  4ZUX U;  3CBK A;  1EWP A;  3BOW A;  1CQD A;  1ATK A;  1K3B B;  3HWN A;  3H6S A;  3H8C A;  3P5U A;  5FPW A;  1NB3 A;  1IWD A;  1VJV A;  1A6R A;  3KWB X;  1M6D A;  2FO5 A;  2AIM A;  1PXV A;  3CBJ A;  1AU3 A;  4BS5 A;  3S3Q A;  1U9W A;  1PBH A;  2AUX A;  4P6E A;  1YK8 A;  4N4Z A;  3IHP A;  1STF E;  2FTD A;  2HXZ A;  2ATO A;  5JA7 A;  4I07 A;  4BS6 A;  4YYV A;  1AYU A;  5A24 A;  1EWO A;  1JQP A;  3KKU A;  4W5C A;  4PI3 A;  2DZY A;  1AU0 A;  1Y4H A;  1GMY A;  1AEC A;  3MHS A;  4HWY A;  3F75 A;  1U5I A;  2E03 A;  3BPM A;  5CHV A;  1CTE A;  1MDW A;  4BQV A;  4BSQ A;  1U9Q X;  1ZCM A;  6PAD A;  1PIP A;  3MOR A;  1F29 A;  2PAD A;  2DJF B;  3K9M A;  1ME4 A;  3LFY A;  4X6H A;  2FYE A;  4MZS A;  1FH0 A;  1KHP A;  1QDQ A;  3BWK A;  5CVM A;  3N4C A;  4I04 A;  1MS6 A;  1GEC E;  3S3R A;  2BDZ A;  3QSD A;  1XKG A;  1CB5 A;  2DZZ A;  2DJG B;  2R9N A;  2FUD A;  2F1G A;  1THE A;  1PAD A;  1BY8 A;  4X6I A;  2YJ2 A;  3C9E A;  2CIO A;  2ACT A;  1AIM A;  2NQA A;  3O1G A;  4Q8H A;  2OP3 A;  5F02 A;  3ERV A;  2XU1 A;  1GLO A;  1S4V A;  3HHI A;  1VSN A;  3N3G A;  9PAP A;  1YK7 A;  1TLO A;  3BCN A;  1O0E A;  4FJC A;  1TU6 A;  1NQC A;  3WXF A;  1F2A A;  1KFU L;  2F7D A;  2R9M A;  3PBH A;  5EGW A;  3OF8 A;  1F2C A;  1PPD A;  1EWL A;  3RVW A;  5CVO B;  3OIS A;  4PAD A;  2ARY A;  1AU4 A;  1PE6 A;  3P5W A;  1Q6K A;  1U9X A;  1MEM A;  4RY2 A;  2GHU A;  3QT4 A;  2PBH A;  1MEG A;  1YT7 A;  2E01 A;  3BC3 A;  1AYV A;  2XU3 A;  4FK5 A;  4W5B A;  1QOL A;  3DF0 A;  4OEL A;  4QRG A;  2DC6 A;  3IEJ A;  1PPP A;  3HHA A;  4P6G A;  2DCC A;  5CVN B;  2YJB A;  1TL9 A;  1SP4 B;  3H89 A;  4QRV A;  2VHF A;  3M99 A;  1CSB B;  3LXS A;  1PCI A;  4AXL A;  2AVW A;  1BQI A; 
#chains in the Genus database with same CATH topology
 3CH2 X;  3F5V A;  1YAL A;  1MHW A;  5CHT A;  4BPV A;  3PDF A;  4D8B A;  2BU3 A;  3BPF A;  4CDD B;  4YYU A;  3N3K A;  4AXM A;  4A5U A;  2AYN A;  4YYR A;  4PT5 A;  1BP4 A;  1QMY A;  4DMY A;  4P16 A;  7PCK A;  3KX1 A;  4YYS A;  2HHN A;  2NQI A;  4N8W A;  4CZW A;  3QJ3 A;  2Y6E A;  2JTC A;  3K8U A;  2J7Q A;  1ZIV A;  2FQ9 A;  4RKX A;  3BBA A;  3USV A;  4MZO A;  4CDC B;  1CVZ A;  2Y5B A;  1EF7 A;  4G54 A;  5E6J A;  1NL6 A;  3BB7 A;  3HD3 A;  2AUZ A;  5K16 A;  4YVA A;  4YYQ A;  4D8E A;  2B1M A;  4XZX A;  1BGO A;  3PW3 A;  4YV8 A;  2HH5 A;  2BDL A;  1PPO A;  1GCB A;  2DCB A;  3TNX A;  2DC8 A;  4N79 A;  3E1Z B;  2OZ2 A;  2HD5 A;  2AU1 A;  1ME3 A;  3P5X A;  1YVB A;  2G8E A;  3NHE A;  2R9O A;  1AYW A;  1DF0 A;  4DMX A;  2DC9 A;  2OUL A;  3H8B A;  4WUR A;  2NQG A;  3IOQ A;  3KFQ A;  4CDF B;  4MSX A;  4QBB A;  4KLB A;  2XU4 A;  4MI7 A;  1EWM A;  3GCB A;  4IUM A;  3U8E A;  2AYO A;  8PCH A;  2G7Y A;  3V6E A;  2DC7 A;  4QH6 A;  2YJC A;  4K7C A;  3MTN A;  1AU2 A;  1Y08 A;  3O0U A;  1KXR A;  2E02 A;  3KWZ A;  2DCA A;  3KSE A;  4YYW A;  4M0W A;  5PAD A;  2FRA A;  3ZUA A;  4QRX A;  2R6N A;  4I05 A;  2B1N A;  4FIP A;  2YJ9 A;  1POP A;  3PHW A;  4PP1 A;  2R9C A;  3OVX A;  1SNK A;  4XUI A;  2JQF R;  2P86 A;  2VHS A;  3W31 A;  3B21 A;  2G6D A;  2H7J A;  3B79 A;  2WBF X;  1CS8 A;  3MHH A;  2IPP B;  3RVX A;  3P5V A;  3IUT A;  3D6S A;  3C0R A;  1HUC B;  3I06 A;  4PP2 E;  4X6J A;  3V6C A;  2JQG R;  3MJ5 A;  3OQC A;  2FT2 A;  1QXP A;  1CJL A;  2P7U A;  3KW9 A;  4WA6 A;  3MP2 A;  4MM3 B;  3PNR A;  3H7D A;  1KFX L;  3OF9 A;  3WXE A;  2FRQ A;  3CH3 X;  1NLJ A;  2AS8 A;  1PVJ A;  5JH3 A;  3PHU A;  3PRP A;  1DEU A;  2PRE A;  3MTV A;  3BY4 A;  2YJ8 A;  1U9V A;  5EZS A;  4ZTB A;  2C0Y A;  2E00 A;  1NB5 A;  2BTW A;  2NQD B;  3IV2 A;  3RVV A;  2R9F A;  2HWK A;  1CV8 A;  4RF1 A;  2DCD A;  1MIR A;  3OVZ A;  3IMA A;  1ICF A;  2G8J A;  2PNS A;  3AI8 A;  4OEM A;  1PPN A;  4XR7 A;  2P0R A;  2CB5 A;  1ITO A;  1F2B A;  2GFO A;  3WXG A;  4W4U A;  2XU5 A;  5EF4 A;  2IBI A;  2BTW B;  5J94 A;  4IP3 A;  1NPZ A;  3I3T A;  1CPJ A;  2O6X A;  3K24 A;  1X9Y A;  4Q8G A;  4CDE B;  1KHQ A;  4ZUX U;  3CBK A;  1EWP A;  3BOW A;  3E9S A;  1CQD A;  1ATK A;  1K3B B;  3HWN A;  3H6S A;  3H8C A;  3P5U A;  5FPW A;  1NB3 A;  1IWD A;  1VJV A;  1A6R A;  3TRK A;  3KWB X;  4BOP A;  1M6D A;  2FO5 A;  2AIM A;  1PXV A;  3CBJ A;  1AU3 A;  4BS5 A;  3S3Q A;  1U9W A;  1PBH A;  3W30 A;  2AUX A;  3O65 A;  4BOU A;  4P6E A;  1YK8 A;  4N4Z A;  3IHP A;  1STF E;  2FTD A;  2HXZ A;  2ATO A;  5JA7 A;  4I07 A;  5EZQ A;  4BS6 A;  1UKF A;  4YYV A;  3PHX A;  1AYU A;  3TMP A;  5A24 A;  1EWO A;  1JQP A;  3ZNH A;  3KKU A;  4D8I A;  4W5C A;  4PI3 A;  3PT2 A;  2DZY A;  1AU0 A;  1Y4H A;  1GMY A;  1AEC A;  3MHS A;  4HWY A;  3F75 A;  1U5I A;  2E03 A;  3BPM A;  2DOS A;  5CHV A;  1CTE A;  1MDW A;  4BQV A;  4BSQ A;  1U9Q X;  1ZCM A;  6PAD A;  1PIP A;  3MOR A;  4HXD B;  1F29 A;  3IFU A;  2PAD A;  2DJF B;  2JRI A;  3K9M A;  1ME4 A;  3RNV A;  3LFY A;  4X6H A;  4REZ A;  2FYE A;  4MZS A;  1FH0 A;  1KHP A;  1QDQ A;  4RF0 A;  4BOQ A;  3BWK A;  5CVM A;  4OW0 A;  3N4C A;  4I04 A;  1MS6 A;  3PRM A;  1GEC E;  3S3R A;  2BDZ A;  3QSD A;  1XKG A;  1CB5 A;  2DZZ A;  2J7Q C;  2DJG B;  1DKI A;  2R9N A;  2FUD A;  2F1G A;  1THE A;  1PAD A;  4R3D A;  1BY8 A;  4X6I A;  2YJ2 A;  3C9E A;  2CIO A;  2ACT A;  1AIM A;  2NQA A;  3O1G A;  4Q8H A;  2OP3 A;  5F02 A;  3ERV A;  2XU1 A;  1GLO A;  1S4V A;  3HHI A;  1VSN A;  3N3G A;  9PAP A;  1YK7 A;  1TLO A;  3BCN A;  2UZJ A;  1O0E A;  4FJC A;  1TU6 A;  1NQC A;  2Z84 A;  3WXF A;  1F2A A;  1KFU L;  2F7D A;  4RNA A;  2R9M A;  3PBH A;  1YZB A;  5EGW A;  3OF8 A;  1F2C A;  5JZE A;  1PPD A;  1EWL A;  4BOS A;  3RVW A;  5CVO B;  3OIS A;  4PAD A;  2ARY A;  4OVZ A;  1AU4 A;  1PE6 A;  3P5W A;  1Q6K A;  1U9X A;  1MEM A;  4RY2 A;  2GHU A;  3QT4 A;  2PBH A;  1MEG A;  1YT7 A;  2E01 A;  3BC3 A;  4GUA A;  1AYV A;  2XU3 A;  4FK5 A;  4W5B A;  1QOL A;  3DF0 A;  4OEL A;  2FE8 A;  4QRG A;  2DC6 A;  3IEJ A;  1PPP A;  3HHA A;  4BOZ A;  4P6G A;  2DCC A;  4OVZ B;  5CVN B;  2YJB A;  1TL9 A;  2AGA A;  1SP4 B;  5KO3 A;  3PSE A;  3H89 A;  4QRV A;  2VHF A;  3M99 A;  1CSB B;  3LXS A;  1PCI A;  4AXL A;  2AVW A;  1BQI A; 
#chains in the Genus database with same CATH homology
 3CH2 X;  3F5V A;  1YAL A;  1MHW A;  1W6F A;  5CHT A;  4BPV A;  3PDF A;  3BPF A;  4CDD B;  4YYU A;  3N3K A;  4AXM A;  3D9W A;  2AYN A;  4YYR A;  1BP4 A;  1QMY A;  4DMY A;  7PCK A;  3KX1 A;  4YYS A;  2HHN A;  2NQI A;  4N8W A;  4CZW A;  3QJ3 A;  2Y6E A;  3K8U A;  1ZIV A;  2FQ9 A;  3USV A;  4MZO A;  4CDC B;  1CVZ A;  2Y5B A;  1EF7 A;  4G54 A;  1NL6 A;  3HD3 A;  2AUZ A;  5K16 A;  4YVA A;  4YYQ A;  4GUZ A;  2B1M A;  4NV8 A;  1BGO A;  3PW3 A;  4YV8 A;  2HH5 A;  2BDL A;  1PPO A;  1GCB A;  2DCB A;  3TNX A;  2DC8 A;  4N79 A;  3E1Z B;  2OZ2 A;  2HD5 A;  2AU1 A;  1ME3 A;  3P5X A;  1YVB A;  2G8E A;  3NHE A;  2R9O A;  1AYW A;  1DF0 A;  4DMX A;  2DC9 A;  2OUL A;  3H8B A;  2NQG A;  3IOQ A;  3KFQ A;  4CDF B;  4MSX A;  4QBB A;  4KLB A;  2XU4 A;  1EWM A;  3GCB A;  3U8E A;  2AYO A;  8PCH A;  2G7Y A;  3V6E A;  2DC7 A;  4QH6 A;  2YJC A;  4K7C A;  3LTW A;  3MTN A;  1AU2 A;  1Y08 A;  3O0U A;  1KXR A;  2E02 A;  3KWZ A;  2DCA A;  3KSE A;  4YYW A;  5PAD A;  2FRA A;  3ZUA A;  4QRX A;  2R6N A;  4I05 A;  2B1N A;  4FIP A;  2YJ9 A;  1POP A;  4PP1 A;  2R9C A;  3OVX A;  1SNK A;  4XUI A;  2JQF R;  2P86 A;  2VHS A;  2G6D A;  2H7J A;  3B79 A;  2WBF X;  1CS8 A;  3MHH A;  2IPP B;  3RVX A;  3P5V A;  3IUT A;  3D6S A;  1HUC B;  3I06 A;  4PP2 E;  4X6J A;  3V6C A;  2JQG R;  2FT2 A;  1QXP A;  1CJL A;  2P7U A;  3KW9 A;  4WA6 A;  3PNR A;  3H7D A;  1KFX L;  3OF9 A;  3WXE A;  2FRQ A;  3CH3 X;  1NLJ A;  2AS8 A;  5JH3 A;  1DEU A;  2PRE A;  1GX3 A;  4NV7 A;  4B55 A;  2YJ8 A;  1U9V A;  2C0Y A;  2E00 A;  1NB5 A;  2NQD B;  3IV2 A;  3RVV A;  2R9F A;  1CV8 A;  2VFC A;  2DCD A;  1MIR A;  3OVZ A;  3IMA A;  1ICF A;  2G8J A;  2PNS A;  3AI8 A;  4OEM A;  1PPN A;  4XR7 A;  2P0R A;  2CB5 A;  1ITO A;  1F2B A;  2GFO A;  3WXG A;  4W4U A;  1W5R A;  2XU5 A;  5EF4 A;  2IBI A;  5J94 A;  1NPZ A;  3I3T A;  1CPJ A;  2O6X A;  3K24 A;  1X9Y A;  1E2T A;  4Q8G A;  4CDE B;  1KHQ A;  4ZUX U;  3CBK A;  1EWP A;  3BOW A;  1CQD A;  1ATK A;  1K3B B;  3HWN A;  3H6S A;  3H8C A;  3P5U A;  5FPW A;  1NB3 A;  1IWD A;  1VJV A;  4C5P A;  1A6R A;  3KWB X;  1M6D A;  2FO5 A;  2AIM A;  1PXV A;  3CBJ A;  1AU3 A;  4BS5 A;  3S3Q A;  1U9W A;  1PBH A;  2AUX A;  4P6E A;  1YK8 A;  4N4Z A;  3IHP A;  1W4T A;  1STF E;  2FTD A;  2HXZ A;  2ATO A;  5JA7 A;  4I07 A;  4BS6 A;  4YYV A;  1AYU A;  5A24 A;  1EWO A;  1JQP A;  3KKU A;  4W5C A;  4PI3 A;  2DZY A;  1AU0 A;  1Y4H A;  1GMY A;  1AEC A;  3MHS A;  4HWY A;  3F75 A;  1U5I A;  2E03 A;  3BPM A;  5CHV A;  1CTE A;  1MDW A;  4BQV A;  4BSQ A;  1U9Q X;  1ZCM A;  6PAD A;  1PIP A;  3MOR A;  1F29 A;  2PAD A;  2DJF B;  3K9M A;  1ME4 A;  3LFY A;  4X6H A;  2FYE A;  4MZS A;  1FH0 A;  1KHP A;  1QDQ A;  2BSZ A;  3BWK A;  5CVM A;  3N4C A;  4I04 A;  1MS6 A;  1GEC E;  3S3R A;  2BDZ A;  3QSD A;  1XKG A;  4BGF A;  1CB5 A;  2DZZ A;  2DJG B;  2R9N A;  2FUD A;  2F1G A;  1THE A;  1PAD A;  1BY8 A;  4X6I A;  2YJ2 A;  3C9E A;  2CIO A;  2ACT A;  1AIM A;  2NQA A;  3O1G A;  4Q8H A;  2OP3 A;  5F02 A;  3ERV A;  2XU1 A;  1GLO A;  1S4V A;  3HHI A;  1VSN A;  3N3G A;  9PAP A;  1YK7 A;  1TLO A;  3BCN A;  1O0E A;  4FJC A;  1TU6 A;  1NQC A;  3WXF A;  1F2A A;  1KFU L;  2F7D A;  2R9M A;  3PBH A;  5EGW A;  3OF8 A;  1F2C A;  1PPD A;  1EWL A;  3RVW A;  5CVO B;  3OIS A;  4PAD A;  2ARY A;  1AU4 A;  1PE6 A;  3P5W A;  1Q6K A;  1U9X A;  2VFB A;  1MEM A;  4RY2 A;  2GHU A;  3QT4 A;  2PBH A;  1MEG A;  1YT7 A;  2E01 A;  3BC3 A;  1AYV A;  2XU3 A;  4FK5 A;  4W5B A;  1QOL A;  3DF0 A;  4OEL A;  4QRG A;  2DC6 A;  3IEJ A;  1PPP A;  3HHA A;  4P6G A;  2DCC A;  5CVN B;  2YJB A;  1TL9 A;  1SP4 B;  3H89 A;  4QRV A;  2VHF A;  3M99 A;  1CSB B;  3LXS A;  1PCI A;  4AXL A;  2AVW A;  1BQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...