2OULA

The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Falcipain 2
publication title The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of an inhibitor family.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 74
structure length 241
sequence length 241
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2oulA00
1PBHA 3CBJA 4YYRA 3KKUA 3IEJA 3OVXA 1O0EA 1PCIA 3K9MA 4X6JA 5PADA 3I06A 3P5WA 3KFQA 4P6EA 2XU1A 2DC6A 4CZWA 4N4ZA 1EWLA 3QJ3A 1MS6A 4QRXA 1ICFA 2JQFR 5CVOB 3OVZA 3K8UA 4BS6A 2BDLA 4YYQA 3DF0A 2AU1A 4YYWA 3ERVA 2R9MA 3KWZA 4YVAA 5J94A 1CB5A 1ZIVA 3LXSA 5EGWA 3D6SA 3OF8A 2DCBA 2NQDB 5CHVA 1DEUA 5JH3A 4WA6A 1K3BB 1KHPA 1MEGA 1MHWA 1TL9A 4PI3A 3H89A 1NPZA 3C9EA 3RVVA 1PPOA 1VJVA 3N3KA 4BQVA 2NQGA 2AUXA 4HWYA 4I04A 1SNKA 1DF0A 2VHFA 3BPFA 2PADA 2C0YA 3P5XA 5CVMA 5F02A 3O1GA 2Y5BA 2DCAA 4OEMA 4RY2A 2R6NA 1AECA 4CDDB 1AU3A 2XU5A 4AXLA 4DMYA 4Q8HA 4I05A 3IV2A 3GCBA 2VHSA 4YYUA 2PBHA 2B1NA 1CS8A 4X6IA 3I3TA 4BS5A 5JA7A 2FUDA 7PCKA 4ZUXU 1YK8A 1ATKA 1MEMA 1AU0A 5A24A 2G8EA 1MIRA 1F29A 1TU6A 2HH5A 4XR7A 4CDCB 2P7UA 1AIMA 1YALA 3KSEA 3OF9A 5EF4A 1THEA 3N4CA 3H8CA 4QH6A 2DC7A 2CB5A 3U8EA 1F2CA 4KLBA 4CDEB 2P86A 5CVNB 1NQCA 3MORA 2NQAA 3KWBX 1HUCB 2E02A 1KFUL 2Y6EA 1NB5A 1A6RA 3HHAA 2HD5A 1PPDA 2R9CA 2FO5A 3AI8A 1AU4A 2DCCA 2PNSA 1QOLA 3QSDA 2DZYA 3LFYA 4N79A 3TNXA 1PIPA 3V6EA 1EWOA 2YJ2A 1BGOA 2AIMA 4OELA 3O0UA 3H7DA 1VSNA 4QBBA 4PADA 1GCBA 1PPNA 4MSXA 3CBKA 1EF7A 3BOWA 4FIPA 3M99A 2G8JA 4QRGA 1ME4A 2R9NA 1KXRA 1U9WA 2YJ9A 3OISA 2DCDA 4G54A 3WXFA 1Y08A 1QDQA 3CH2X 2E01A 1Y4HA 2WBFX 3BCNA 1BQIA 2IPPB 1AYUA 2YJBA 2GFOA 3MHSA 3CH3X 2ATOA 3QT4A 1CJLA 2AUZA 2R9OA 3F5VA 1YK7A 3HHIA 2FTDA 2PREA 4K7CA 1YVBA 1PPPA 1F2AA 3RVXA 1JQPA 2BDZA 2HHNA 2XU3A 1TLOA 2DJFB 2E00A 1NB3A 1ITOA 3USVA 1ZCMA 2G6DA 1CTEA 2YJ8A 4AXMA 8PCHA 3K24A 4P6GA 3B79A 3V6CA 1CQDA 4PP1A 4I07A 2B1MA 4MZOA 3P5UA 4CDFB 4BSQA 2NQIA 2R9FA 4PP2E 2DC9A 1AYVA 4X6HA 1KFXL 1ME3A 2FRAA 3ZUAA 2OP3A 2OULA 3S3RA 3HWNA 3PNRA 1BP4A 2ACTA 2P0RA 1M6DA 1X9YA 4FJCA 2AS8A 1YT7A 6PADA 1POPA 3BC3A 3BWKA 2AYNA 1KHQA 3H8BA 3NHEA 2HXZA 1PE6A 1AU2A 1PXVA 5K16A 1CSBB 2ARYA 2G7YA 2GHUA 3IUTA 1AYWA 1U9XA 2FQ9A 5FPWA 2DZZA 4DMXA 4Q8GA 2YJCA 3WXEA 1GMYA 2E03A 2FYEA 1MDWA 4YYSA 1BY8A 4W5CA 3H6SA 3PDFA 3E1ZB 1GECE 3IMAA 1NL6A 3P5VA 4W5BA 5CHTA 3KX1A 2DC8A 3PW3A 9PAPA 3IHPA 4QRVA 1CPJA 1CVZA 3F75A 3BPMA 3RVWA 1GLOA 2O6XA 1SP4B 1CV8A 2AVWA 2H7JA 1F2BA 1FH0A 4FK5A 4N8WA 4BPVA 3N3GA 3PBHA 2F7DA 2OZ2A 2CIOA 3MTNA 2IBIA 2AYOA 1U9VA 4XUIA 1Q6KA 1EWPA 3HD3A 2F1GA 1QXPA 3WXGA 2DJGB 3KW9A 2JQGR 2XU4A 1XKGA 1STFE 1IWDA 3MHHA 4W4UA 2FT2A 1QMYA 1S4VA 3S3QA 4YYVA 2FRQA 4YV8A 1U9QX 1PADA 4MZSA 1NLJA 3IOQA 1EWMA 1U5IA
chains in the Genus database with same CATH superfamily
1PBHA 3CBJA 4YYRA 3KKUA 3IEJA 3W30A 3OVXA 1O0EA 1PCIA 3K9MA 4X6JA 1UKFA 5PADA 3I06A 3P5WA 3KFQA 4P6EA 2XU1A 2DC6A 4CZWA 4N4ZA 1EWLA 3QJ3A 1MS6A 4QRXA 1ICFA 2JQFR 5CVOB 3OVZA 3BB7A 3K8UA 3MJ5A 4BS6A 2BDLA 4YYQA 3DF0A 3IFUA 2AU1A 4YYWA 3ERVA 2R9MA 3KWZA 4YVAA 5J94A 1CB5A 1ZIVA 3LXSA 5EGWA 3BBAA 3D6SA 3OF8A 2DCBA 2NQDB 5CHVA 1DEUA 4RF1A 5JH3A 4WA6A 4PT5A 1K3BB 1KHPA 1MEGA 1MHWA 1TL9A 4PI3A 3H89A 1NPZA 3C9EA 3RVVA 1PPOA 1VJVA 3N3KA 4BQVA 2NQGA 2AUXA 4HWYA 4I04A 1SNKA 1DF0A 4BOSA 2VHFA 3BPFA 3W31A 2PADA 2C0YA 3O65A 3E9SA 3P5XA 2Z84A 5CVMA 5F02A 3O1GA 2Y5BA 2DCAA 4OEMA 4RY2A 2R6NA 1AECA 4CDDB 1AU3A 2XU5A 4AXLA 4DMYA 3PHWA 4Q8HA 4REZA 4I05A 3IV2A 3GCBA 2VHSA 4YYUA 2PBHA 2B1NA 1CS8A 4X6IA 3I3TA 4BS5A 4OVZA 5JA7A 4OW0A 2FUDA 7PCKA 4ZUXU 1YK8A 1ATKA 1MEMA 1AU0A 5A24A 2G8EA 1MIRA 2JTCA 1F29A 1TU6A 2HH5A 1DKIA 4XR7A 2FE8A 4CDCB 2P7UA 4M0WA 1AIMA 4HXDB 1YALA 3B21A 3KSEA 3OF9A 5EF4A 1THEA 5EZSA 3N4CA 3H8CA 4QH6A 2DC7A 4RF0A 5JZEA 2CB5A 2BTWA 3U8EA 1F2CA 4KLBA 4CDEB 2P86A 5CVNB 1NQCA 3MORA 2NQAA 3KWBX 1HUCB 2E02A 1KFUL 2Y6EA 3PSEA 3PRMA 1A6RA 1NB5A 3HHAA 3ZNHA 2HD5A 1PPDA 2R9CA 2FO5A 3AI8A 1AU4A 2J7QC 2DCCA 2PNSA 1QOLA 3TRKA 3QSDA 2DZYA 3LFYA 4BOUA 4N79A 4OVZB 3TNXA 1PIPA 3V6EA 1EWOA 2YJ2A 1BGOA 2AIMA 4OELA 2JRIA 2DOSA 3O0UA 3H7DA 1VSNA 4QBBA 4PADA 3PHXA 1GCBA 1PPNA 4MSXA 3CBKA 1EF7A 3BOWA 4FIPA 3M99A 2G8JA 4QRGA 4D8IA 1ME4A 2R9NA 1KXRA 1U9WA 2YJ9A 3OISA 2DCDA 4G54A 5E6JA 3RNVA 3WXFA 1Y08A 1QDQA 3CH2X 2BTWB 1Y4HA 2E01A 2WBFX 3BCNA 4ZTBA 1BQIA 2IPPB 1AYUA 2YJBA 2GFOA 3OQCA 3MHSA 3CH3X 4RNAA 2ATOA 3QT4A 1CJLA 4GUAA 2AUZA 2R9OA 3F5VA 1YK7A 3HHIA 2FTDA 2PREA 4XZXA 4K7CA 1YVBA 1PPPA 1F2AA 3RVXA 1JQPA 2BDZA 2HHNA 2XU3A 1TLOA 2DJFB 2E00A 4D8BA 1NB3A 4RKXA 1ITOA 3USVA 1ZCMA 2G6DA 1CTEA 2YJ8A 4AXMA 2AGAA 8PCHA 3K24A 4P6GA 3B79A 3V6CA 1CQDA 4PP1A 4I07A 2B1MA 4MZOA 3P5UA 4CDFB 4BSQA 2NQIA 2R9FA 4PP2E 2DC9A 1AYVA 4X6HA 1KFXL 1ME3A 2FRAA 3ZUAA 2OP3A 5KO3A 4WURA 2OULA 3S3RA 4IUMA 3HWNA 3PNRA 1BP4A 2ACTA 3PHUA 2P0RA 1M6DA 1X9YA 4FJCA 2HWKA 2AS8A 1YT7A 6PADA 4BOZA 1POPA 3BC3A 3BWKA 2AYNA 1KHQA 3C0RA 3H8BA 4D8EA 3NHEA 2HXZA 1PE6A 1AU2A 1PXVA 5K16A 1CSBB 2ARYA 3MTVA 2G7YA 2GHUA 3IUTA 4IP3A 1AYWA 1U9XA 2FQ9A 3MP2A 5FPWA 2DZZA 4DMXA 4Q8GA 3PT2A 2YJCA 3WXEA 1GMYA 2E03A 2FYEA 1MDWA 4YYSA 4A5UA 1BY8A 4W5CA 3H6SA 3PDFA 3E1ZB 4P16A 1GECE 3IMAA 1NL6A 3P5VA 4W5BA 5CHTA 3KX1A 2DC8A 3PW3A 9PAPA 3IHPA 4QRVA 1CPJA 1CVZA 3F75A 3BPMA 3TMPA 3RVWA 1GLOA 4R3DA 2O6XA 1SP4B 1CV8A 2AVWA 2H7JA 1F2BA 1FH0A 4FK5A 4N8WA 4BPVA 3N3GA 3PBHA 2BU3A 2F7DA 2OZ2A 2CIOA 3MTNA 2IBIA 4BOQA 5EZQA 4MM3B 2AYOA 1U9VA 4XUIA 1Q6KA 1EWPA 3HD3A 2F1GA 1QXPA 3WXGA 2DJGB 1PVJA 4BOPA 3KW9A 4MI7A 2JQGR 2UZJA 2XU4A 1XKGA 1STFE 1IWDA 3BY4A 2J7QA 3MHHA 4W4UA 1YZBA 2FT2A 1QMYA 1S4VA 3S3QA 4YYVA 2FRQA 4YV8A 1U9QX 1PADA 4MZSA 1NLJA 3IOQA 1EWMA 3PRPA 1U5IA
chains in the Genus database with same CATH topology
1PBHA 3CBJA 4YYRA 1GX3A 3KKUA 3IEJA 4B55A 3OVXA 1O0EA 1PCIA 3K9MA 4X6JA 4NV8A 5PADA 3I06A 3P5WA 3KFQA 4P6EA 2XU1A 2DC6A 4CZWA 4N4ZA 1EWLA 3QJ3A 1MS6A 4QRXA 1ICFA 2JQFR 5CVOB 3OVZA 3K8UA 4BS6A 2BDLA 4YYQA 3DF0A 2AU1A 4YYWA 3ERVA 2R9MA 1W6FA 3KWZA 4YVAA 5J94A 1CB5A 1ZIVA 3LXSA 5EGWA 3D6SA 3OF8A 2DCBA 2NQDB 5CHVA 1DEUA 5JH3A 4WA6A 1W4TA 1K3BB 1KHPA 1MEGA 1MHWA 1TL9A 4PI3A 3H89A 1NPZA 3C9EA 3RVVA 1PPOA 1VJVA 3N3KA 4BQVA 2NQGA 2AUXA 4HWYA 4I04A 1SNKA 1DF0A 2VHFA 3BPFA 2PADA 2C0YA 1W5RA 3P5XA 5CVMA 1E2TA 5F02A 3O1GA 2Y5BA 2DCAA 4OEMA 4RY2A 2R6NA 1AECA 4CDDB 4BGFA 1AU3A 2VFCA 2XU5A 4AXLA 4DMYA 4Q8HA 4I05A 3IV2A 3GCBA 2VHSA 4YYUA 2VFBA 2PBHA 2B1NA 1CS8A 4C5PA 4X6IA 3I3TA 4BS5A 5JA7A 2FUDA 7PCKA 4ZUXU 1YK8A 1ATKA 1MEMA 1AU0A 5A24A 2G8EA 1MIRA 1F29A 1TU6A 2HH5A 4XR7A 4CDCB 2P7UA 2BSZA 1AIMA 1YALA 3KSEA 3OF9A 5EF4A 1THEA 3N4CA 3H8CA 4QH6A 2DC7A 2CB5A 3U8EA 1F2CA 4KLBA 4CDEB 2P86A 5CVNB 1NQCA 3MORA 2NQAA 3KWBX 1HUCB 2E02A 1KFUL 2Y6EA 1NB5A 1A6RA 3HHAA 2HD5A 1PPDA 2R9CA 2FO5A 3AI8A 1AU4A 3D9WA 2DCCA 2PNSA 1QOLA 3QSDA 2DZYA 3LFYA 4N79A 3TNXA 1PIPA 3V6EA 1EWOA 2YJ2A 1BGOA 2AIMA 4OELA 3O0UA 3H7DA 1VSNA 4QBBA 4PADA 1GCBA 1PPNA 4MSXA 3CBKA 1EF7A 3BOWA 4FIPA 3M99A 2G8JA 4QRGA 1ME4A 2R9NA 1KXRA 1U9WA 2YJ9A 3OISA 2DCDA 4G54A 3WXFA 1Y08A 1QDQA 3CH2X 2E01A 1Y4HA 2WBFX 3BCNA 1BQIA 2IPPB 1AYUA 2YJBA 2GFOA 3MHSA 3CH3X 2ATOA 3QT4A 1CJLA 2AUZA 2R9OA 3F5VA 1YK7A 3HHIA 2FTDA 2PREA 4K7CA 1YVBA 1PPPA 1F2AA 3RVXA 1JQPA 2BDZA 2HHNA 2XU3A 1TLOA 2DJFB 2E00A 1NB3A 1ITOA 3USVA 1ZCMA 2G6DA 1CTEA 2YJ8A 4AXMA 8PCHA 3K24A 4P6GA 3B79A 3V6CA 1CQDA 4PP1A 4I07A 2B1MA 4MZOA 3P5UA 4CDFB 4BSQA 2NQIA 2R9FA 4PP2E 2DC9A 1AYVA 4X6HA 1KFXL 1ME3A 2FRAA 3ZUAA 2OP3A 2OULA 3S3RA 3HWNA 3PNRA 1BP4A 2ACTA 2P0RA 1M6DA 1X9YA 4FJCA 2AS8A 1YT7A 6PADA 1POPA 3BC3A 3BWKA 2AYNA 1KHQA 3H8BA 3NHEA 2HXZA 1PE6A 4GUZA 1AU2A 1PXVA 5K16A 1CSBB 2ARYA 2G7YA 2GHUA 3IUTA 1AYWA 1U9XA 2FQ9A 5FPWA 2DZZA 4DMXA 4Q8GA 2YJCA 3WXEA 1GMYA 2E03A 2FYEA 1MDWA 4YYSA 1BY8A 4W5CA 3H6SA 3PDFA 3E1ZB 1GECE 3IMAA 1NL6A 3P5VA 4W5BA 5CHTA 3KX1A 2DC8A 3PW3A 9PAPA 3IHPA 4QRVA 1CPJA 1CVZA 3F75A 3BPMA 3RVWA 1GLOA 2O6XA 1SP4B 1CV8A 2AVWA 2H7JA 1F2BA 1FH0A 4FK5A 4N8WA 4BPVA 3N3GA 3PBHA 2F7DA 2OZ2A 2CIOA 3MTNA 2IBIA 2AYOA 1U9VA 4XUIA 1Q6KA 1EWPA 3HD3A 2F1GA 1QXPA 3WXGA 2DJGB 3KW9A 2JQGR 2XU4A 1XKGA 1STFE 1IWDA 3MHHA 4W4UA 2FT2A 1QMYA 1S4VA 3LTWA 3S3QA 4YYVA 2FRQA 4YV8A 4NV7A 1U9QX 1PADA 4MZSA 1NLJA 3IOQA 1EWMA 1U5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBH A;  3CBJ A;  4YYR A;  3KKU A;  3IEJ A;  3OVX A;  1O0E A;  1PCI A;  3K9M A;  4X6J A;  5PAD A;  3I06 A;  3P5W A;  3KFQ A;  4P6E A;  2XU1 A;  2DC6 A;  4CZW A;  4N4Z A;  1EWL A;  3QJ3 A;  1MS6 A;  4QRX A;  1ICF A;  2JQF R;  5CVO B;  3OVZ A;  3K8U A;  4BS6 A;  2BDL A;  4YYQ A;  3DF0 A;  2AU1 A;  4YYW A;  3ERV A;  2R9M A;  3KWZ A;  4YVA A;  5J94 A;  1CB5 A;  1ZIV A;  3LXS A;  5EGW A;  3D6S A;  3OF8 A;  2DCB A;  2NQD B;  5CHV A;  1DEU A;  5JH3 A;  4WA6 A;  1K3B B;  1KHP A;  1MEG A;  1MHW A;  1TL9 A;  4PI3 A;  3H89 A;  1NPZ A;  3C9E A;  3RVV A;  1PPO A;  1VJV A;  3N3K A;  4BQV A;  2NQG A;  2AUX A;  4HWY A;  4I04 A;  1SNK A;  1DF0 A;  2VHF A;  3BPF A;  2PAD A;  2C0Y A;  3P5X A;  5CVM A;  5F02 A;  3O1G A;  2Y5B A;  2DCA A;  4OEM A;  4RY2 A;  2R6N A;  1AEC A;  4CDD B;  1AU3 A;  2XU5 A;  4AXL A;  4DMY A;  4Q8H A;  4I05 A;  3IV2 A;  3GCB A;  2VHS A;  4YYU A;  2PBH A;  2B1N A;  1CS8 A;  4X6I A;  3I3T A;  4BS5 A;  5JA7 A;  2FUD A;  7PCK A;  4ZUX U;  1YK8 A;  1ATK A;  1MEM A;  1AU0 A;  5A24 A;  2G8E A;  1MIR A;  1F29 A;  1TU6 A;  2HH5 A;  4XR7 A;  4CDC B;  2P7U A;  1AIM A;  1YAL A;  3KSE A;  3OF9 A;  5EF4 A;  1THE A;  3N4C A;  3H8C A;  4QH6 A;  2DC7 A;  2CB5 A;  3U8E A;  1F2C A;  4KLB A;  4CDE B;  2P86 A;  5CVN B;  1NQC A;  3MOR A;  2NQA A;  3KWB X;  1HUC B;  2E02 A;  1KFU L;  2Y6E A;  1NB5 A;  1A6R A;  3HHA A;  2HD5 A;  1PPD A;  2R9C A;  2FO5 A;  3AI8 A;  1AU4 A;  2DCC A;  2PNS A;  1QOL A;  3QSD A;  2DZY A;  3LFY A;  4N79 A;  3TNX A;  1PIP A;  3V6E A;  1EWO A;  2YJ2 A;  1BGO A;  2AIM A;  4OEL A;  3O0U A;  3H7D A;  1VSN A;  4QBB A;  4PAD A;  1GCB A;  1PPN A;  4MSX A;  3CBK A;  1EF7 A;  3BOW A;  4FIP A;  3M99 A;  2G8J A;  4QRG A;  1ME4 A;  2R9N A;  1KXR A;  1U9W A;  2YJ9 A;  3OIS A;  2DCD A;  4G54 A;  3WXF A;  1Y08 A;  1QDQ A;  3CH2 X;  2E01 A;  1Y4H A;  2WBF X;  3BCN A;  1BQI A;  2IPP B;  1AYU A;  2YJB A;  2GFO A;  3MHS A;  3CH3 X;  2ATO A;  3QT4 A;  1CJL A;  2AUZ A;  2R9O A;  3F5V A;  1YK7 A;  3HHI A;  2FTD A;  2PRE A;  4K7C A;  1YVB A;  1PPP A;  1F2A A;  3RVX A;  1JQP A;  2BDZ A;  2HHN A;  2XU3 A;  1TLO A;  2DJF B;  2E00 A;  1NB3 A;  1ITO A;  3USV A;  1ZCM A;  2G6D A;  1CTE A;  2YJ8 A;  4AXM A;  8PCH A;  3K24 A;  4P6G A;  3B79 A;  3V6C A;  1CQD A;  4PP1 A;  4I07 A;  2B1M A;  4MZO A;  3P5U A;  4CDF B;  4BSQ A;  2NQI A;  2R9F A;  4PP2 E;  2DC9 A;  1AYV A;  4X6H A;  1KFX L;  1ME3 A;  2FRA A;  3ZUA A;  2OP3 A;  2OUL A;  3S3R A;  3HWN A;  3PNR A;  1BP4 A;  2ACT A;  2P0R A;  1M6D A;  1X9Y A;  4FJC A;  2AS8 A;  1YT7 A;  6PAD A;  1POP A;  3BC3 A;  3BWK A;  2AYN A;  1KHQ A;  3H8B A;  3NHE A;  2HXZ A;  1PE6 A;  1AU2 A;  1PXV A;  5K16 A;  1CSB B;  2ARY A;  2G7Y A;  2GHU A;  3IUT A;  1AYW A;  1U9X A;  2FQ9 A;  5FPW A;  2DZZ A;  4DMX A;  4Q8G A;  2YJC A;  3WXE A;  1GMY A;  2E03 A;  2FYE A;  1MDW A;  4YYS A;  1BY8 A;  4W5C A;  3H6S A;  3PDF A;  3E1Z B;  1GEC E;  3IMA A;  1NL6 A;  3P5V A;  4W5B A;  5CHT A;  3KX1 A;  2DC8 A;  3PW3 A;  9PAP A;  3IHP A;  4QRV A;  1CPJ A;  1CVZ A;  3F75 A;  3BPM A;  3RVW A;  1GLO A;  2O6X A;  1SP4 B;  1CV8 A;  2AVW A;  2H7J A;  1F2B A;  1FH0 A;  4FK5 A;  4N8W A;  4BPV A;  3N3G A;  3PBH A;  2F7D A;  2OZ2 A;  2CIO A;  3MTN A;  2IBI A;  2AYO A;  1U9V A;  4XUI A;  1Q6K A;  1EWP A;  3HD3 A;  2F1G A;  1QXP A;  3WXG A;  2DJG B;  3KW9 A;  2JQG R;  2XU4 A;  1XKG A;  1STF E;  1IWD A;  3MHH A;  4W4U A;  2FT2 A;  1QMY A;  1S4V A;  3S3Q A;  4YYV A;  2FRQ A;  4YV8 A;  1U9Q X;  1PAD A;  4MZS A;  1NLJ A;  3IOQ A;  1EWM A;  1U5I A; 
#chains in the Genus database with same CATH topology
 1PBH A;  3CBJ A;  4YYR A;  3KKU A;  3IEJ A;  3W30 A;  3OVX A;  1O0E A;  1PCI A;  3K9M A;  4X6J A;  1UKF A;  5PAD A;  3I06 A;  3P5W A;  3KFQ A;  4P6E A;  2XU1 A;  2DC6 A;  4CZW A;  4N4Z A;  1EWL A;  3QJ3 A;  1MS6 A;  4QRX A;  1ICF A;  2JQF R;  5CVO B;  3OVZ A;  3BB7 A;  3K8U A;  3MJ5 A;  4BS6 A;  2BDL A;  4YYQ A;  3DF0 A;  3IFU A;  2AU1 A;  4YYW A;  3ERV A;  2R9M A;  3KWZ A;  4YVA A;  5J94 A;  1CB5 A;  1ZIV A;  3LXS A;  5EGW A;  3BBA A;  3D6S A;  3OF8 A;  2DCB A;  2NQD B;  5CHV A;  1DEU A;  4RF1 A;  5JH3 A;  4WA6 A;  4PT5 A;  1K3B B;  1KHP A;  1MEG A;  1MHW A;  1TL9 A;  4PI3 A;  3H89 A;  1NPZ A;  3C9E A;  3RVV A;  1PPO A;  1VJV A;  3N3K A;  4BQV A;  2NQG A;  2AUX A;  4HWY A;  4I04 A;  1SNK A;  1DF0 A;  4BOS A;  2VHF A;  3BPF A;  3W31 A;  2PAD A;  2C0Y A;  3O65 A;  3E9S A;  3P5X A;  2Z84 A;  5CVM A;  5F02 A;  3O1G A;  2Y5B A;  2DCA A;  4OEM A;  4RY2 A;  2R6N A;  1AEC A;  4CDD B;  1AU3 A;  2XU5 A;  4AXL A;  4DMY A;  3PHW A;  4Q8H A;  4REZ A;  4I05 A;  3IV2 A;  3GCB A;  2VHS A;  4YYU A;  2PBH A;  2B1N A;  1CS8 A;  4X6I A;  3I3T A;  4BS5 A;  4OVZ A;  5JA7 A;  4OW0 A;  2FUD A;  7PCK A;  4ZUX U;  1YK8 A;  1ATK A;  1MEM A;  1AU0 A;  5A24 A;  2G8E A;  1MIR A;  2JTC A;  1F29 A;  1TU6 A;  2HH5 A;  1DKI A;  4XR7 A;  2FE8 A;  4CDC B;  2P7U A;  4M0W A;  1AIM A;  4HXD B;  1YAL A;  3B21 A;  3KSE A;  3OF9 A;  5EF4 A;  1THE A;  5EZS A;  3N4C A;  3H8C A;  4QH6 A;  2DC7 A;  4RF0 A;  5JZE A;  2CB5 A;  2BTW A;  3U8E A;  1F2C A;  4KLB A;  4CDE B;  2P86 A;  5CVN B;  1NQC A;  3MOR A;  2NQA A;  3KWB X;  1HUC B;  2E02 A;  1KFU L;  2Y6E A;  3PSE A;  3PRM A;  1A6R A;  1NB5 A;  3HHA A;  3ZNH A;  2HD5 A;  1PPD A;  2R9C A;  2FO5 A;  3AI8 A;  1AU4 A;  2J7Q C;  2DCC A;  2PNS A;  1QOL A;  3TRK A;  3QSD A;  2DZY A;  3LFY A;  4BOU A;  4N79 A;  4OVZ B;  3TNX A;  1PIP A;  3V6E A;  1EWO A;  2YJ2 A;  1BGO A;  2AIM A;  4OEL A;  2JRI A;  2DOS A;  3O0U A;  3H7D A;  1VSN A;  4QBB A;  4PAD A;  3PHX A;  1GCB A;  1PPN A;  4MSX A;  3CBK A;  1EF7 A;  3BOW A;  4FIP A;  3M99 A;  2G8J A;  4QRG A;  4D8I A;  1ME4 A;  2R9N A;  1KXR A;  1U9W A;  2YJ9 A;  3OIS A;  2DCD A;  4G54 A;  5E6J A;  3RNV A;  3WXF A;  1Y08 A;  1QDQ A;  3CH2 X;  2BTW B;  1Y4H A;  2E01 A;  2WBF X;  3BCN A;  4ZTB A;  1BQI A;  2IPP B;  1AYU A;  2YJB A;  2GFO A;  3OQC A;  3MHS A;  3CH3 X;  4RNA A;  2ATO A;  3QT4 A;  1CJL A;  4GUA A;  2AUZ A;  2R9O A;  3F5V A;  1YK7 A;  3HHI A;  2FTD A;  2PRE A;  4XZX A;  4K7C A;  1YVB A;  1PPP A;  1F2A A;  3RVX A;  1JQP A;  2BDZ A;  2HHN A;  2XU3 A;  1TLO A;  2DJF B;  2E00 A;  4D8B A;  1NB3 A;  4RKX A;  1ITO A;  3USV A;  1ZCM A;  2G6D A;  1CTE A;  2YJ8 A;  4AXM A;  2AGA A;  8PCH A;  3K24 A;  4P6G A;  3B79 A;  3V6C A;  1CQD A;  4PP1 A;  4I07 A;  2B1M A;  4MZO A;  3P5U A;  4CDF B;  4BSQ A;  2NQI A;  2R9F A;  4PP2 E;  2DC9 A;  1AYV A;  4X6H A;  1KFX L;  1ME3 A;  2FRA A;  3ZUA A;  2OP3 A;  5KO3 A;  4WUR A;  2OUL A;  3S3R A;  4IUM A;  3HWN A;  3PNR A;  1BP4 A;  2ACT A;  3PHU A;  2P0R A;  1M6D A;  1X9Y A;  4FJC A;  2HWK A;  2AS8 A;  1YT7 A;  6PAD A;  4BOZ A;  1POP A;  3BC3 A;  3BWK A;  2AYN A;  1KHQ A;  3C0R A;  3H8B A;  4D8E A;  3NHE A;  2HXZ A;  1PE6 A;  1AU2 A;  1PXV A;  5K16 A;  1CSB B;  2ARY A;  3MTV A;  2G7Y A;  2GHU A;  3IUT A;  4IP3 A;  1AYW A;  1U9X A;  2FQ9 A;  3MP2 A;  5FPW A;  2DZZ A;  4DMX A;  4Q8G A;  3PT2 A;  2YJC A;  3WXE A;  1GMY A;  2E03 A;  2FYE A;  1MDW A;  4YYS A;  4A5U A;  1BY8 A;  4W5C A;  3H6S A;  3PDF A;  3E1Z B;  4P16 A;  1GEC E;  3IMA A;  1NL6 A;  3P5V A;  4W5B A;  5CHT A;  3KX1 A;  2DC8 A;  3PW3 A;  9PAP A;  3IHP A;  4QRV A;  1CPJ A;  1CVZ A;  3F75 A;  3BPM A;  3TMP A;  3RVW A;  1GLO A;  4R3D A;  2O6X A;  1SP4 B;  1CV8 A;  2AVW A;  2H7J A;  1F2B A;  1FH0 A;  4FK5 A;  4N8W A;  4BPV A;  3N3G A;  3PBH A;  2BU3 A;  2F7D A;  2OZ2 A;  2CIO A;  3MTN A;  2IBI A;  4BOQ A;  5EZQ A;  4MM3 B;  2AYO A;  1U9V A;  4XUI A;  1Q6K A;  1EWP A;  3HD3 A;  2F1G A;  1QXP A;  3WXG A;  2DJG B;  1PVJ A;  4BOP A;  3KW9 A;  4MI7 A;  2JQG R;  2UZJ A;  2XU4 A;  1XKG A;  1STF E;  1IWD A;  3BY4 A;  2J7Q A;  3MHH A;  4W4U A;  1YZB A;  2FT2 A;  1QMY A;  1S4V A;  3S3Q A;  4YYV A;  2FRQ A;  4YV8 A;  1U9Q X;  1PAD A;  4MZS A;  1NLJ A;  3IOQ A;  1EWM A;  3PRP A;  1U5I A; 
#chains in the Genus database with same CATH homology
 1PBH A;  3CBJ A;  4YYR A;  1GX3 A;  3KKU A;  3IEJ A;  4B55 A;  3OVX A;  1O0E A;  1PCI A;  3K9M A;  4X6J A;  4NV8 A;  5PAD A;  3I06 A;  3P5W A;  3KFQ A;  4P6E A;  2XU1 A;  2DC6 A;  4CZW A;  4N4Z A;  1EWL A;  3QJ3 A;  1MS6 A;  4QRX A;  1ICF A;  2JQF R;  5CVO B;  3OVZ A;  3K8U A;  4BS6 A;  2BDL A;  4YYQ A;  3DF0 A;  2AU1 A;  4YYW A;  3ERV A;  2R9M A;  1W6F A;  3KWZ A;  4YVA A;  5J94 A;  1CB5 A;  1ZIV A;  3LXS A;  5EGW A;  3D6S A;  3OF8 A;  2DCB A;  2NQD B;  5CHV A;  1DEU A;  5JH3 A;  4WA6 A;  1W4T A;  1K3B B;  1KHP A;  1MEG A;  1MHW A;  1TL9 A;  4PI3 A;  3H89 A;  1NPZ A;  3C9E A;  3RVV A;  1PPO A;  1VJV A;  3N3K A;  4BQV A;  2NQG A;  2AUX A;  4HWY A;  4I04 A;  1SNK A;  1DF0 A;  2VHF A;  3BPF A;  2PAD A;  2C0Y A;  1W5R A;  3P5X A;  5CVM A;  1E2T A;  5F02 A;  3O1G A;  2Y5B A;  2DCA A;  4OEM A;  4RY2 A;  2R6N A;  1AEC A;  4CDD B;  4BGF A;  1AU3 A;  2VFC A;  2XU5 A;  4AXL A;  4DMY A;  4Q8H A;  4I05 A;  3IV2 A;  3GCB A;  2VHS A;  4YYU A;  2VFB A;  2PBH A;  2B1N A;  1CS8 A;  4C5P A;  4X6I A;  3I3T A;  4BS5 A;  5JA7 A;  2FUD A;  7PCK A;  4ZUX U;  1YK8 A;  1ATK A;  1MEM A;  1AU0 A;  5A24 A;  2G8E A;  1MIR A;  1F29 A;  1TU6 A;  2HH5 A;  4XR7 A;  4CDC B;  2P7U A;  2BSZ A;  1AIM A;  1YAL A;  3KSE A;  3OF9 A;  5EF4 A;  1THE A;  3N4C A;  3H8C A;  4QH6 A;  2DC7 A;  2CB5 A;  3U8E A;  1F2C A;  4KLB A;  4CDE B;  2P86 A;  5CVN B;  1NQC A;  3MOR A;  2NQA A;  3KWB X;  1HUC B;  2E02 A;  1KFU L;  2Y6E A;  1NB5 A;  1A6R A;  3HHA A;  2HD5 A;  1PPD A;  2R9C A;  2FO5 A;  3AI8 A;  1AU4 A;  3D9W A;  2DCC A;  2PNS A;  1QOL A;  3QSD A;  2DZY A;  3LFY A;  4N79 A;  3TNX A;  1PIP A;  3V6E A;  1EWO A;  2YJ2 A;  1BGO A;  2AIM A;  4OEL A;  3O0U A;  3H7D A;  1VSN A;  4QBB A;  4PAD A;  1GCB A;  1PPN A;  4MSX A;  3CBK A;  1EF7 A;  3BOW A;  4FIP A;  3M99 A;  2G8J A;  4QRG A;  1ME4 A;  2R9N A;  1KXR A;  1U9W A;  2YJ9 A;  3OIS A;  2DCD A;  4G54 A;  3WXF A;  1Y08 A;  1QDQ A;  3CH2 X;  2E01 A;  1Y4H A;  2WBF X;  3BCN A;  1BQI A;  2IPP B;  1AYU A;  2YJB A;  2GFO A;  3MHS A;  3CH3 X;  2ATO A;  3QT4 A;  1CJL A;  2AUZ A;  2R9O A;  3F5V A;  1YK7 A;  3HHI A;  2FTD A;  2PRE A;  4K7C A;  1YVB A;  1PPP A;  1F2A A;  3RVX A;  1JQP A;  2BDZ A;  2HHN A;  2XU3 A;  1TLO A;  2DJF B;  2E00 A;  1NB3 A;  1ITO A;  3USV A;  1ZCM A;  2G6D A;  1CTE A;  2YJ8 A;  4AXM A;  8PCH A;  3K24 A;  4P6G A;  3B79 A;  3V6C A;  1CQD A;  4PP1 A;  4I07 A;  2B1M A;  4MZO A;  3P5U A;  4CDF B;  4BSQ A;  2NQI A;  2R9F A;  4PP2 E;  2DC9 A;  1AYV A;  4X6H A;  1KFX L;  1ME3 A;  2FRA A;  3ZUA A;  2OP3 A;  2OUL A;  3S3R A;  3HWN A;  3PNR A;  1BP4 A;  2ACT A;  2P0R A;  1M6D A;  1X9Y A;  4FJC A;  2AS8 A;  1YT7 A;  6PAD A;  1POP A;  3BC3 A;  3BWK A;  2AYN A;  1KHQ A;  3H8B A;  3NHE A;  2HXZ A;  1PE6 A;  4GUZ A;  1AU2 A;  1PXV A;  5K16 A;  1CSB B;  2ARY A;  2G7Y A;  2GHU A;  3IUT A;  1AYW A;  1U9X A;  2FQ9 A;  5FPW A;  2DZZ A;  4DMX A;  4Q8G A;  2YJC A;  3WXE A;  1GMY A;  2E03 A;  2FYE A;  1MDW A;  4YYS A;  1BY8 A;  4W5C A;  3H6S A;  3PDF A;  3E1Z B;  1GEC E;  3IMA A;  1NL6 A;  3P5V A;  4W5B A;  5CHT A;  3KX1 A;  2DC8 A;  3PW3 A;  9PAP A;  3IHP A;  4QRV A;  1CPJ A;  1CVZ A;  3F75 A;  3BPM A;  3RVW A;  1GLO A;  2O6X A;  1SP4 B;  1CV8 A;  2AVW A;  2H7J A;  1F2B A;  1FH0 A;  4FK5 A;  4N8W A;  4BPV A;  3N3G A;  3PBH A;  2F7D A;  2OZ2 A;  2CIO A;  3MTN A;  2IBI A;  2AYO A;  1U9V A;  4XUI A;  1Q6K A;  1EWP A;  3HD3 A;  2F1G A;  1QXP A;  3WXG A;  2DJG B;  3KW9 A;  2JQG R;  2XU4 A;  1XKG A;  1STF E;  1IWD A;  3MHH A;  4W4U A;  2FT2 A;  1QMY A;  1S4V A;  3LTW A;  3S3Q A;  4YYV A;  2FRQ A;  4YV8 A;  4NV7 A;  1U9Q X;  1PAD A;  4MZS A;  1NLJ A;  3IOQ A;  1EWM A;  1U5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...