2OULA

The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
publication title The structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of an inhibitor family.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 74
structure length 241
sequence length 241
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2oulA00
2DC9A 4MSXA 4Q8HA 4QRXA 1VSNA 4FK5A 2FQ9A 1QDQA 1NB3A 3P5XA 4G54A 4XR7A 1PPNA 3BPMA 1AU0A 1CS8A 3BC3A 3AI8A 2NQAA 4YYSA 2PADA 2OP3A 3KX1A 3KFQA 2E02A 2Y6EA 1MIRA 1CVZA 3HD3A 4YVAA 1DEUA 2E01A 1PPPA 4HWYA 1NLJA 2C0YA 2XU3A 4YYWA 2PREA 2YJBA 2B1MA 1SNKA 2FYEA 3IEJA 5EGWA 1EF7A 1EWOA 2GHUA 2DZZA 1PXVA 1PBHA 1MHWA 1ATKA 5A24A 3TNXA 3PW3A 4KLBA 1AU4A 3V6EA 2R9FA 1F2BA 3RVXA 3K8UA 2R6NA 1YK8A 2FT2A 1U5IA 4WA6A 1QMYA 2HH5A 1VJVA 2B1NA 2ATOA 1XKGA 2R9CA 3LFYA 3N3GA 3QSDA 3NHEA 1NL6A 3OF9A 4N79A 4CDDB 2CIOA 2IPPB 2P0RA 1TU6A 1STFE 2HHNA 4OEMA 3IUTA 3O1GA 1TL9A 1POPA 2R9MA 1BY8A 3WXGA 4ZUXU 2FRQA 4PADA 3K24A 3H8CA 1GECE 1THEA 3H6SA 1CQDA 1ITOA 3QJ3A 1M6DA 3D6SA 2H7JA 3WXEA 1K3BB 1BGOA 6PADA 4W5BA 1BQIA 4Q8GA 3IOQA 1EWPA 2PBHA 3BPFA 7PCKA 2FRAA 5F02A 3OISA 1KXRA 2GFOA 4BS5A 2HXZA 3HWNA 1PPDA 5CHVA 2F1GA 1NPZA 3I06A 3BCNA 1GMYA 2Y5BA 3RVWA 4N8WA 5K16A 3IMAA 4CZWA 4DMXA 2G8EA 2G6DA 2E00A 4AXMA 4X6HA 1KHQA 2AVWA 3HHIA 4P6GA 1ICFA 2DC7A 1BP4A 4MZSA 1NB5A 2DJGB 3QT4A 1AECA 1YK7A 3DF0A 2P7UA 1ZIVA 3WXFA 1A6RA 2ACTA 1PADA 2OULA 2JQFR 2R9OA 3OF8A 1KFXL 3ZUAA 4X6IA 2FO5A 4K7CA 1O0EA 8PCHA 4YYQA 2AYNA 4YV8A 2XU4A 1NQCA 4QRVA 1AIMA 4W5CA 3CBKA 3KWZA 3F5VA 1F29A 1U9WA 5J94A 2BDLA 4BQVA 4FJCA 1AYVA 4OELA 4I04A 4MZOA 2R9NA 5CVOB 4BPVA 1MDWA 2E03A 3H7DA 1PE6A 3B79A 5CVMA 3PNRA 4YYUA 2DCDA 2YJ2A 3V6CA 1F2CA 1AYUA 3MORA 2DC6A 1MS6A 3I3TA 1CPJA 4QBBA 1GLOA 2DCCA 3CH2X 1PPOA 2DCAA 1U9VA 5CHTA 3K9MA 3H8BA 3MHHA 2CB5A 1YT7A 1KFUL 2AUXA 2YJCA 4DMYA 1DF0A 1YVBA 4BSQA 2NQDB 4N4ZA 3USVA 1TLOA 1AYWA 2YJ9A 1EWLA 3OVZA 1MEGA 3CH3X 5CVNB 3P5VA 1CSBB 3KWBX 3U8EA 2XU5A 2HD5A 2P86A 3E1ZB 9PAPA 4QRGA 4PP2E 2AYOA 2AS8A 2DC8A 1QOLA 3MTNA 2BDZA 2IBIA 4FIPA 3PBHA 3H89A 3BWKA 4W4UA 1PIPA 3N3KA 1ME4A 4RY2A 2VHSA 1S4VA 3P5UA 2O6XA 1IWDA 1CB5A 2G8JA 2VHFA 2F7DA 1JQPA 1F2AA 3BOWA 2AUZA 1CTEA 4YYRA 4AXLA 1Y4HA 2DCBA 2NQIA 1MEMA 4PP1A 1X9YA 1ME3A 2PNSA 1QXPA 3KW9A 3P5WA 3S3RA 2DJFB 1Y08A 4I05A 4CDCB 3CBJA 5JA7A 3S3QA 1SP4B 4I07A 1HUCB 1U9XA 5JH3A 1Q6KA 1U9QX 4YYVA 3PDFA 1CV8A 2JQGR 1YALA 2AU1A 4BS6A 4CDFB 1KHPA 1PCIA 3MHSA 3N4CA 2ARYA 4CDEB 1EWMA 2FTDA 3OVXA 3M99A 2DZYA 3IHPA 2YJ8A 1ZCMA 3GCBA 3IV2A 5EF4A 4X6JA 1GCBA 3KKUA 5PADA 3KSEA 3RVVA 1CJLA 3LXSA 4P6EA 1AU2A 2FUDA 2AIMA 4XUIA 2WBFX 3F75A 1AU3A 3HHAA 3C9EA 1FH0A 2NQGA 4PI3A 2G7YA 4QH6A 5FPWA 2OZ2A 3ERVA 3O0UA 2XU1A
chains in the Genus database with same CATH superfamily
2DC9A 5JZEA 4MSXA 4Q8HA 4QRXA 1VSNA 4FK5A 3MJ5A 2FQ9A 3IFUA 4BOPA 1QDQA 1NB3A 3P5XA 4G54A 4XR7A 1PPNA 3BPMA 1AU0A 1CS8A 3BC3A 5EZQA 3AI8A 2NQAA 4YYSA 2PADA 2OP3A 3KX1A 3KFQA 2E02A 2Y6EA 1MIRA 1CVZA 3HD3A 4YVAA 3C0RA 4A5UA 1DEUA 4XZXA 2E01A 1PPPA 4HWYA 4WURA 1NLJA 4BOZA 2C0YA 2XU3A 4GUAA 4YYWA 2DOSA 2PREA 3B21A 2YJBA 2B1MA 1SNKA 2BU3A 2FYEA 3IEJA 5EGWA 1EF7A 1EWOA 2GHUA 2DZZA 1PXVA 1PBHA 1MHWA 1ATKA 5A24A 3TNXA 3PW3A 4HXDB 4KLBA 1AU4A 3V6EA 2R9FA 1F2BA 3PSEA 3RVXA 3K8UA 3MTVA 2R6NA 1YK8A 2FT2A 1U5IA 4WA6A 1QMYA 2HH5A 1VJVA 2B1NA 3PHXA 2ATOA 3BY4A 1XKGA 2R9CA 3LFYA 3N3GA 3QSDA 3NHEA 1NL6A 3OF9A 4D8EA 4N79A 4CDDB 2CIOA 2IPPB 4RNAA 2P0RA 3PT2A 1TU6A 5E6JA 1STFE 2HHNA 4OEMA 3IUTA 3O1GA 1TL9A 1POPA 2R9MA 1BY8A 3WXGA 4ZUXU 2FRQA 4PADA 3K24A 3H8CA 1GECE 1THEA 3H6SA 1CQDA 1ITOA 2HWKA 3QJ3A 1M6DA 3D6SA 2H7JA 3TMPA 3WXEA 1K3BB 1BGOA 6PADA 4W5BA 1BQIA 2JRIA 4Q8GA 3IOQA 1EWPA 2PBHA 3BPFA 7PCKA 2FE8A 3PHUA 2FRAA 5F02A 3OISA 1KXRA 4BOQA 2GFOA 4BS5A 2HXZA 3MP2A 3HWNA 1PPDA 4OVZB 5CHVA 2F1GA 1NPZA 3I06A 3BCNA 1GMYA 2BTWB 2Y5BA 3RVWA 4N8WA 5K16A 3IMAA 4CZWA 2UZJA 4DMXA 4BOSA 3TRKA 2G8EA 2G6DA 2E00A 4AXMA 4X6HA 3PRMA 1KHQA 2AVWA 3HHIA 4P6GA 1ICFA 2DC7A 3ZNHA 1PVJA 1BP4A 4MZSA 1NB5A 2DJGB 3QT4A 1AECA 1YK7A 3DF0A 2P7UA 1ZIVA 3WXFA 4D8IA 1A6RA 2ACTA 1PADA 3OQCA 2OULA 2JQFR 2R9OA 3BBAA 3OF8A 1KFXL 3ZUAA 4X6IA 2FO5A 4K7CA 1O0EA 8PCHA 4YYQA 2AYNA 4BOUA 4YV8A 2XU4A 1NQCA 4QRVA 1AIMA 4W5CA 3CBKA 3KWZA 3F5VA 1F29A 1U9WA 5J94A 2BDLA 4BQVA 4FJCA 1AYVA 4OELA 4I04A 4MZOA 2R9NA 5CVOB 4BPVA 3E9SA 1MDWA 2E03A 3H7DA 1PE6A 3B79A 5CVMA 3PNRA 4YYUA 4P16A 2DCDA 2YJ2A 3V6CA 1F2CA 3RNVA 1AYUA 3MORA 2DC6A 4MI7A 1MS6A 2Z84A 3I3TA 1CPJA 2J7QA 4QBBA 1GLOA 2DCCA 3CH2X 1PPOA 4OW0A 2DCAA 1U9VA 4IUMA 5CHTA 3K9MA 3H8BA 3MHHA 2CB5A 1YT7A 1KFUL 2AUXA 2YJCA 4DMYA 1DF0A 1YVBA 4BSQA 2NQDB 4N4ZA 5EZSA 3USVA 1TLOA 1AYWA 2YJ9A 1EWLA 4D8BA 3OVZA 3W30A 4M0WA 4PT5A 1MEGA 3CH3X 5CVNB 3P5VA 1CSBB 3KWBX 3U8EA 2XU5A 3O65A 2HD5A 2P86A 3E1ZB 9PAPA 4QRGA 4PP2E 2AYOA 2AS8A 2DC8A 4REZA 1QOLA 3MTNA 2BDZA 2IBIA 4RKXA 4FIPA 3PBHA 3H89A 3BWKA 4W4UA 1PIPA 3N3KA 2JTCA 1ME4A 4RY2A 2VHSA 1S4VA 3P5UA 2O6XA 1IWDA 1CB5A 5KO3A 2G8JA 2VHFA 2F7DA 1JQPA 1F2AA 3BOWA 2AUZA 1CTEA 4YYRA 4AXLA 1Y4HA 2DCBA 2NQIA 4ZTBA 1MEMA 4PP1A 1X9YA 1ME3A 3BB7A 2PNSA 1QXPA 3KW9A 3P5WA 4R3DA 3S3RA 2DJFB 1Y08A 4OVZA 4I05A 4CDCB 3CBJA 5JA7A 3S3QA 1UKFA 1SP4B 2BTWA 4I07A 1HUCB 1U9XA 4RF0A 5JH3A 1Q6KA 1U9QX 4YYVA 3PDFA 1CV8A 2JQGR 1YALA 2AU1A 4BS6A 1YZBA 4CDFB 1KHPA 1PCIA 3PRPA 3MHSA 4MM3B 3N4CA 2ARYA 4CDEB 1EWMA 2FTDA 3OVXA 3M99A 2DZYA 3IHPA 2YJ8A 1ZCMA 3GCBA 3IV2A 5EF4A 4X6JA 1GCBA 3KKUA 5PADA 3KSEA 3RVVA 1CJLA 3LXSA 3W31A 4P6EA 1DKIA 1AU2A 2FUDA 2AIMA 4XUIA 2WBFX 3F75A 1AU3A 2J7QC 3HHAA 3C9EA 1FH0A 4IP3A 2NQGA 3PHWA 2G7YA 4PI3A 4QH6A 5FPWA 2OZ2A 2AGAA 3ERVA 4RF1A 3O0UA 2XU1A
chains in the Genus database with same CATH topology
2DC9A 4MSXA 4Q8HA 4QRXA 1VSNA 4FK5A 2FQ9A 1QDQA 1NB3A 3P5XA 4G54A 4XR7A 1PPNA 3BPMA 1AU0A 1CS8A 3BC3A 3AI8A 2NQAA 4YYSA 2PADA 2OP3A 3KX1A 3KFQA 2E02A 2Y6EA 1MIRA 1CVZA 3HD3A 4YVAA 1DEUA 2E01A 1PPPA 4HWYA 1NLJA 2C0YA 4NV8A 2XU3A 4YYWA 2PREA 2YJBA 2B1MA 1SNKA 2FYEA 3IEJA 5EGWA 1EF7A 1EWOA 2GHUA 2DZZA 1PXVA 1PBHA 1MHWA 1ATKA 5A24A 3TNXA 3PW3A 4KLBA 1AU4A 3V6EA 2R9FA 1F2BA 3RVXA 3K8UA 2R6NA 1YK8A 2FT2A 1U5IA 4WA6A 1QMYA 2HH5A 1VJVA 2B1NA 2ATOA 1XKGA 2R9CA 3LFYA 3N3GA 3QSDA 3NHEA 1NL6A 3OF9A 4N79A 4CDDB 2CIOA 2IPPB 2P0RA 1TU6A 1STFE 2HHNA 4OEMA 3IUTA 3O1GA 1TL9A 1POPA 2R9MA 1BY8A 3WXGA 4ZUXU 2FRQA 4PADA 3K24A 3H8CA 1GECE 1THEA 3H6SA 1CQDA 1ITOA 3QJ3A 1M6DA 3D6SA 2H7JA 3WXEA 1K3BB 1BGOA 6PADA 4W5BA 1BQIA 4Q8GA 3IOQA 1EWPA 2PBHA 3BPFA 7PCKA 2VFCA 2FRAA 5F02A 3OISA 1KXRA 2GFOA 4BS5A 2HXZA 3HWNA 1PPDA 5CHVA 2F1GA 1NPZA 3I06A 3BCNA 1GMYA 2Y5BA 3RVWA 4N8WA 4C5PA 5K16A 3IMAA 4CZWA 4B55A 4DMXA 3LTWA 2G8EA 2G6DA 2E00A 4AXMA 4X6HA 1KHQA 2AVWA 3HHIA 4P6GA 1ICFA 2DC7A 1BP4A 4MZSA 1NB5A 2DJGB 3QT4A 1AECA 1YK7A 3DF0A 2P7UA 1ZIVA 3WXFA 1A6RA 2ACTA 1PADA 2OULA 2JQFR 2R9OA 3OF8A 1KFXL 3ZUAA 4X6IA 2VFBA 2FO5A 4K7CA 1O0EA 8PCHA 4YYQA 1W4TA 2AYNA 2BSZA 4YV8A 2XU4A 1NQCA 4QRVA 1AIMA 4W5CA 3CBKA 3KWZA 3F5VA 1F29A 1U9WA 5J94A 2BDLA 4BQVA 4FJCA 1AYVA 4OELA 4I04A 4MZOA 2R9NA 5CVOB 4BPVA 1MDWA 2E03A 3H7DA 1PE6A 3B79A 5CVMA 3PNRA 4YYUA 1GX3A 2DCDA 2YJ2A 3V6CA 1F2CA 1AYUA 3MORA 2DC6A 1MS6A 3I3TA 1CPJA 4QBBA 1GLOA 2DCCA 3CH2X 1PPOA 2DCAA 1U9VA 5CHTA 3K9MA 3H8BA 3MHHA 2CB5A 1E2TA 1YT7A 1KFUL 2AUXA 2YJCA 4DMYA 1DF0A 1YVBA 4BSQA 2NQDB 4N4ZA 3USVA 1TLOA 1AYWA 2YJ9A 1EWLA 3OVZA 1MEGA 4NV7A 3CH3X 5CVNB 3P5VA 1CSBB 3KWBX 3U8EA 2XU5A 2HD5A 2P86A 3E1ZB 9PAPA 4QRGA 4PP2E 2AYOA 2AS8A 2DC8A 1QOLA 3MTNA 2BDZA 2IBIA 4FIPA 3PBHA 3H89A 3BWKA 4W4UA 1PIPA 3N3KA 1ME4A 4RY2A 2VHSA 1S4VA 3P5UA 2O6XA 1IWDA 1CB5A 2G8JA 2VHFA 2F7DA 1JQPA 1F2AA 3BOWA 2AUZA 1CTEA 4YYRA 4AXLA 1Y4HA 2DCBA 2NQIA 1MEMA 4PP1A 1X9YA 1ME3A 2PNSA 1QXPA 3KW9A 3P5WA 3D9WA 3S3RA 2DJFB 1Y08A 1W5RA 4I05A 4CDCB 3CBJA 5JA7A 3S3QA 1SP4B 4I07A 1HUCB 1U9XA 5JH3A 1Q6KA 1U9QX 4YYVA 3PDFA 1CV8A 2JQGR 1YALA 2AU1A 4BS6A 4CDFB 1KHPA 1PCIA 4BGFA 3MHSA 1W6FA 3N4CA 2ARYA 4CDEB 1EWMA 2FTDA 3OVXA 3M99A 2DZYA 3IHPA 4GUZA 2YJ8A 1ZCMA 3GCBA 3IV2A 5EF4A 4X6JA 1GCBA 3KKUA 5PADA 3KSEA 3RVVA 1CJLA 3LXSA 4P6EA 1AU2A 2FUDA 2AIMA 4XUIA 2WBFX 3F75A 1AU3A 3HHAA 3C9EA 1FH0A 2NQGA 4PI3A 2G7YA 4QH6A 5FPWA 2OZ2A 3ERVA 3O0UA 2XU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC9 A;  4MSX A;  4Q8H A;  4QRX A;  1VSN A;  4FK5 A;  2FQ9 A;  1QDQ A;  1NB3 A;  3P5X A;  4G54 A;  4XR7 A;  1PPN A;  3BPM A;  1AU0 A;  1CS8 A;  3BC3 A;  3AI8 A;  2NQA A;  4YYS A;  2PAD A;  2OP3 A;  3KX1 A;  3KFQ A;  2E02 A;  2Y6E A;  1MIR A;  1CVZ A;  3HD3 A;  4YVA A;  1DEU A;  2E01 A;  1PPP A;  4HWY A;  1NLJ A;  2C0Y A;  2XU3 A;  4YYW A;  2PRE A;  2YJB A;  2B1M A;  1SNK A;  2FYE A;  3IEJ A;  5EGW A;  1EF7 A;  1EWO A;  2GHU A;  2DZZ A;  1PXV A;  1PBH A;  1MHW A;  1ATK A;  5A24 A;  3TNX A;  3PW3 A;  4KLB A;  1AU4 A;  3V6E A;  2R9F A;  1F2B A;  3RVX A;  3K8U A;  2R6N A;  1YK8 A;  2FT2 A;  1U5I A;  4WA6 A;  1QMY A;  2HH5 A;  1VJV A;  2B1N A;  2ATO A;  1XKG A;  2R9C A;  3LFY A;  3N3G A;  3QSD A;  3NHE A;  1NL6 A;  3OF9 A;  4N79 A;  4CDD B;  2CIO A;  2IPP B;  2P0R A;  1TU6 A;  1STF E;  2HHN A;  4OEM A;  3IUT A;  3O1G A;  1TL9 A;  1POP A;  2R9M A;  1BY8 A;  3WXG A;  4ZUX U;  2FRQ A;  4PAD A;  3K24 A;  3H8C A;  1GEC E;  1THE A;  3H6S A;  1CQD A;  1ITO A;  3QJ3 A;  1M6D A;  3D6S A;  2H7J A;  3WXE A;  1K3B B;  1BGO A;  6PAD A;  4W5B A;  1BQI A;  4Q8G A;  3IOQ A;  1EWP A;  2PBH A;  3BPF A;  7PCK A;  2FRA A;  5F02 A;  3OIS A;  1KXR A;  2GFO A;  4BS5 A;  2HXZ A;  3HWN A;  1PPD A;  5CHV A;  2F1G A;  1NPZ A;  3I06 A;  3BCN A;  1GMY A;  2Y5B A;  3RVW A;  4N8W A;  5K16 A;  3IMA A;  4CZW A;  4DMX A;  2G8E A;  2G6D A;  2E00 A;  4AXM A;  4X6H A;  1KHQ A;  2AVW A;  3HHI A;  4P6G A;  1ICF A;  2DC7 A;  1BP4 A;  4MZS A;  1NB5 A;  2DJG B;  3QT4 A;  1AEC A;  1YK7 A;  3DF0 A;  2P7U A;  1ZIV A;  3WXF A;  1A6R A;  2ACT A;  1PAD A;  2OUL A;  2JQF R;  2R9O A;  3OF8 A;  1KFX L;  3ZUA A;  4X6I A;  2FO5 A;  4K7C A;  1O0E A;  8PCH A;  4YYQ A;  2AYN A;  4YV8 A;  2XU4 A;  1NQC A;  4QRV A;  1AIM A;  4W5C A;  3CBK A;  3KWZ A;  3F5V A;  1F29 A;  1U9W A;  5J94 A;  2BDL A;  4BQV A;  4FJC A;  1AYV A;  4OEL A;  4I04 A;  4MZO A;  2R9N A;  5CVO B;  4BPV A;  1MDW A;  2E03 A;  3H7D A;  1PE6 A;  3B79 A;  5CVM A;  3PNR A;  4YYU A;  2DCD A;  2YJ2 A;  3V6C A;  1F2C A;  1AYU A;  3MOR A;  2DC6 A;  1MS6 A;  3I3T A;  1CPJ A;  4QBB A;  1GLO A;  2DCC A;  3CH2 X;  1PPO A;  2DCA A;  1U9V A;  5CHT A;  3K9M A;  3H8B A;  3MHH A;  2CB5 A;  1YT7 A;  1KFU L;  2AUX A;  2YJC A;  4DMY A;  1DF0 A;  1YVB A;  4BSQ A;  2NQD B;  4N4Z A;  3USV A;  1TLO A;  1AYW A;  2YJ9 A;  1EWL A;  3OVZ A;  1MEG A;  3CH3 X;  5CVN B;  3P5V A;  1CSB B;  3KWB X;  3U8E A;  2XU5 A;  2HD5 A;  2P86 A;  3E1Z B;  9PAP A;  4QRG A;  4PP2 E;  2AYO A;  2AS8 A;  2DC8 A;  1QOL A;  3MTN A;  2BDZ A;  2IBI A;  4FIP A;  3PBH A;  3H89 A;  3BWK A;  4W4U A;  1PIP A;  3N3K A;  1ME4 A;  4RY2 A;  2VHS A;  1S4V A;  3P5U A;  2O6X A;  1IWD A;  1CB5 A;  2G8J A;  2VHF A;  2F7D A;  1JQP A;  1F2A A;  3BOW A;  2AUZ A;  1CTE A;  4YYR A;  4AXL A;  1Y4H A;  2DCB A;  2NQI A;  1MEM A;  4PP1 A;  1X9Y A;  1ME3 A;  2PNS A;  1QXP A;  3KW9 A;  3P5W A;  3S3R A;  2DJF B;  1Y08 A;  4I05 A;  4CDC B;  3CBJ A;  5JA7 A;  3S3Q A;  1SP4 B;  4I07 A;  1HUC B;  1U9X A;  5JH3 A;  1Q6K A;  1U9Q X;  4YYV A;  3PDF A;  1CV8 A;  2JQG R;  1YAL A;  2AU1 A;  4BS6 A;  4CDF B;  1KHP A;  1PCI A;  3MHS A;  3N4C A;  2ARY A;  4CDE B;  1EWM A;  2FTD A;  3OVX A;  3M99 A;  2DZY A;  3IHP A;  2YJ8 A;  1ZCM A;  3GCB A;  3IV2 A;  5EF4 A;  4X6J A;  1GCB A;  3KKU A;  5PAD A;  3KSE A;  3RVV A;  1CJL A;  3LXS A;  4P6E A;  1AU2 A;  2FUD A;  2AIM A;  4XUI A;  2WBF X;  3F75 A;  1AU3 A;  3HHA A;  3C9E A;  1FH0 A;  2NQG A;  4PI3 A;  2G7Y A;  4QH6 A;  5FPW A;  2OZ2 A;  3ERV A;  3O0U A;  2XU1 A; 
#chains in the Genus database with same CATH topology
 2DC9 A;  5JZE A;  4MSX A;  4Q8H A;  4QRX A;  1VSN A;  4FK5 A;  3MJ5 A;  2FQ9 A;  3IFU A;  4BOP A;  1QDQ A;  1NB3 A;  3P5X A;  4G54 A;  4XR7 A;  1PPN A;  3BPM A;  1AU0 A;  1CS8 A;  3BC3 A;  5EZQ A;  3AI8 A;  2NQA A;  4YYS A;  2PAD A;  2OP3 A;  3KX1 A;  3KFQ A;  2E02 A;  2Y6E A;  1MIR A;  1CVZ A;  3HD3 A;  4YVA A;  3C0R A;  4A5U A;  1DEU A;  4XZX A;  2E01 A;  1PPP A;  4HWY A;  4WUR A;  1NLJ A;  4BOZ A;  2C0Y A;  2XU3 A;  4GUA A;  4YYW A;  2DOS A;  2PRE A;  3B21 A;  2YJB A;  2B1M A;  1SNK A;  2BU3 A;  2FYE A;  3IEJ A;  5EGW A;  1EF7 A;  1EWO A;  2GHU A;  2DZZ A;  1PXV A;  1PBH A;  1MHW A;  1ATK A;  5A24 A;  3TNX A;  3PW3 A;  4HXD B;  4KLB A;  1AU4 A;  3V6E A;  2R9F A;  1F2B A;  3PSE A;  3RVX A;  3K8U A;  3MTV A;  2R6N A;  1YK8 A;  2FT2 A;  1U5I A;  4WA6 A;  1QMY A;  2HH5 A;  1VJV A;  2B1N A;  3PHX A;  2ATO A;  3BY4 A;  1XKG A;  2R9C A;  3LFY A;  3N3G A;  3QSD A;  3NHE A;  1NL6 A;  3OF9 A;  4D8E A;  4N79 A;  4CDD B;  2CIO A;  2IPP B;  4RNA A;  2P0R A;  3PT2 A;  1TU6 A;  5E6J A;  1STF E;  2HHN A;  4OEM A;  3IUT A;  3O1G A;  1TL9 A;  1POP A;  2R9M A;  1BY8 A;  3WXG A;  4ZUX U;  2FRQ A;  4PAD A;  3K24 A;  3H8C A;  1GEC E;  1THE A;  3H6S A;  1CQD A;  1ITO A;  2HWK A;  3QJ3 A;  1M6D A;  3D6S A;  2H7J A;  3TMP A;  3WXE A;  1K3B B;  1BGO A;  6PAD A;  4W5B A;  1BQI A;  2JRI A;  4Q8G A;  3IOQ A;  1EWP A;  2PBH A;  3BPF A;  7PCK A;  2FE8 A;  3PHU A;  2FRA A;  5F02 A;  3OIS A;  1KXR A;  4BOQ A;  2GFO A;  4BS5 A;  2HXZ A;  3MP2 A;  3HWN A;  1PPD A;  4OVZ B;  5CHV A;  2F1G A;  1NPZ A;  3I06 A;  3BCN A;  1GMY A;  2BTW B;  2Y5B A;  3RVW A;  4N8W A;  5K16 A;  3IMA A;  4CZW A;  2UZJ A;  4DMX A;  4BOS A;  3TRK A;  2G8E A;  2G6D A;  2E00 A;  4AXM A;  4X6H A;  3PRM A;  1KHQ A;  2AVW A;  3HHI A;  4P6G A;  1ICF A;  2DC7 A;  3ZNH A;  1PVJ A;  1BP4 A;  4MZS A;  1NB5 A;  2DJG B;  3QT4 A;  1AEC A;  1YK7 A;  3DF0 A;  2P7U A;  1ZIV A;  3WXF A;  4D8I A;  1A6R A;  2ACT A;  1PAD A;  3OQC A;  2OUL A;  2JQF R;  2R9O A;  3BBA A;  3OF8 A;  1KFX L;  3ZUA A;  4X6I A;  2FO5 A;  4K7C A;  1O0E A;  8PCH A;  4YYQ A;  2AYN A;  4BOU A;  4YV8 A;  2XU4 A;  1NQC A;  4QRV A;  1AIM A;  4W5C A;  3CBK A;  3KWZ A;  3F5V A;  1F29 A;  1U9W A;  5J94 A;  2BDL A;  4BQV A;  4FJC A;  1AYV A;  4OEL A;  4I04 A;  4MZO A;  2R9N A;  5CVO B;  4BPV A;  3E9S A;  1MDW A;  2E03 A;  3H7D A;  1PE6 A;  3B79 A;  5CVM A;  3PNR A;  4YYU A;  4P16 A;  2DCD A;  2YJ2 A;  3V6C A;  1F2C A;  3RNV A;  1AYU A;  3MOR A;  2DC6 A;  4MI7 A;  1MS6 A;  2Z84 A;  3I3T A;  1CPJ A;  2J7Q A;  4QBB A;  1GLO A;  2DCC A;  3CH2 X;  1PPO A;  4OW0 A;  2DCA A;  1U9V A;  4IUM A;  5CHT A;  3K9M A;  3H8B A;  3MHH A;  2CB5 A;  1YT7 A;  1KFU L;  2AUX A;  2YJC A;  4DMY A;  1DF0 A;  1YVB A;  4BSQ A;  2NQD B;  4N4Z A;  5EZS A;  3USV A;  1TLO A;  1AYW A;  2YJ9 A;  1EWL A;  4D8B A;  3OVZ A;  3W30 A;  4M0W A;  4PT5 A;  1MEG A;  3CH3 X;  5CVN B;  3P5V A;  1CSB B;  3KWB X;  3U8E A;  2XU5 A;  3O65 A;  2HD5 A;  2P86 A;  3E1Z B;  9PAP A;  4QRG A;  4PP2 E;  2AYO A;  2AS8 A;  2DC8 A;  4REZ A;  1QOL A;  3MTN A;  2BDZ A;  2IBI A;  4RKX A;  4FIP A;  3PBH A;  3H89 A;  3BWK A;  4W4U A;  1PIP A;  3N3K A;  2JTC A;  1ME4 A;  4RY2 A;  2VHS A;  1S4V A;  3P5U A;  2O6X A;  1IWD A;  1CB5 A;  5KO3 A;  2G8J A;  2VHF A;  2F7D A;  1JQP A;  1F2A A;  3BOW A;  2AUZ A;  1CTE A;  4YYR A;  4AXL A;  1Y4H A;  2DCB A;  2NQI A;  4ZTB A;  1MEM A;  4PP1 A;  1X9Y A;  1ME3 A;  3BB7 A;  2PNS A;  1QXP A;  3KW9 A;  3P5W A;  4R3D A;  3S3R A;  2DJF B;  1Y08 A;  4OVZ A;  4I05 A;  4CDC B;  3CBJ A;  5JA7 A;  3S3Q A;  1UKF A;  1SP4 B;  2BTW A;  4I07 A;  1HUC B;  1U9X A;  4RF0 A;  5JH3 A;  1Q6K A;  1U9Q X;  4YYV A;  3PDF A;  1CV8 A;  2JQG R;  1YAL A;  2AU1 A;  4BS6 A;  1YZB A;  4CDF B;  1KHP A;  1PCI A;  3PRP A;  3MHS A;  4MM3 B;  3N4C A;  2ARY A;  4CDE B;  1EWM A;  2FTD A;  3OVX A;  3M99 A;  2DZY A;  3IHP A;  2YJ8 A;  1ZCM A;  3GCB A;  3IV2 A;  5EF4 A;  4X6J A;  1GCB A;  3KKU A;  5PAD A;  3KSE A;  3RVV A;  1CJL A;  3LXS A;  3W31 A;  4P6E A;  1DKI A;  1AU2 A;  2FUD A;  2AIM A;  4XUI A;  2WBF X;  3F75 A;  1AU3 A;  2J7Q C;  3HHA A;  3C9E A;  1FH0 A;  4IP3 A;  2NQG A;  3PHW A;  2G7Y A;  4PI3 A;  4QH6 A;  5FPW A;  2OZ2 A;  2AGA A;  3ERV A;  4RF1 A;  3O0U A;  2XU1 A; 
#chains in the Genus database with same CATH homology
 2DC9 A;  4MSX A;  4Q8H A;  4QRX A;  1VSN A;  4FK5 A;  2FQ9 A;  1QDQ A;  1NB3 A;  3P5X A;  4G54 A;  4XR7 A;  1PPN A;  3BPM A;  1AU0 A;  1CS8 A;  3BC3 A;  3AI8 A;  2NQA A;  4YYS A;  2PAD A;  2OP3 A;  3KX1 A;  3KFQ A;  2E02 A;  2Y6E A;  1MIR A;  1CVZ A;  3HD3 A;  4YVA A;  1DEU A;  2E01 A;  1PPP A;  4HWY A;  1NLJ A;  2C0Y A;  4NV8 A;  2XU3 A;  4YYW A;  2PRE A;  2YJB A;  2B1M A;  1SNK A;  2FYE A;  3IEJ A;  5EGW A;  1EF7 A;  1EWO A;  2GHU A;  2DZZ A;  1PXV A;  1PBH A;  1MHW A;  1ATK A;  5A24 A;  3TNX A;  3PW3 A;  4KLB A;  1AU4 A;  3V6E A;  2R9F A;  1F2B A;  3RVX A;  3K8U A;  2R6N A;  1YK8 A;  2FT2 A;  1U5I A;  4WA6 A;  1QMY A;  2HH5 A;  1VJV A;  2B1N A;  2ATO A;  1XKG A;  2R9C A;  3LFY A;  3N3G A;  3QSD A;  3NHE A;  1NL6 A;  3OF9 A;  4N79 A;  4CDD B;  2CIO A;  2IPP B;  2P0R A;  1TU6 A;  1STF E;  2HHN A;  4OEM A;  3IUT A;  3O1G A;  1TL9 A;  1POP A;  2R9M A;  1BY8 A;  3WXG A;  4ZUX U;  2FRQ A;  4PAD A;  3K24 A;  3H8C A;  1GEC E;  1THE A;  3H6S A;  1CQD A;  1ITO A;  3QJ3 A;  1M6D A;  3D6S A;  2H7J A;  3WXE A;  1K3B B;  1BGO A;  6PAD A;  4W5B A;  1BQI A;  4Q8G A;  3IOQ A;  1EWP A;  2PBH A;  3BPF A;  7PCK A;  2VFC A;  2FRA A;  5F02 A;  3OIS A;  1KXR A;  2GFO A;  4BS5 A;  2HXZ A;  3HWN A;  1PPD A;  5CHV A;  2F1G A;  1NPZ A;  3I06 A;  3BCN A;  1GMY A;  2Y5B A;  3RVW A;  4N8W A;  4C5P A;  5K16 A;  3IMA A;  4CZW A;  4B55 A;  4DMX A;  3LTW A;  2G8E A;  2G6D A;  2E00 A;  4AXM A;  4X6H A;  1KHQ A;  2AVW A;  3HHI A;  4P6G A;  1ICF A;  2DC7 A;  1BP4 A;  4MZS A;  1NB5 A;  2DJG B;  3QT4 A;  1AEC A;  1YK7 A;  3DF0 A;  2P7U A;  1ZIV A;  3WXF A;  1A6R A;  2ACT A;  1PAD A;  2OUL A;  2JQF R;  2R9O A;  3OF8 A;  1KFX L;  3ZUA A;  4X6I A;  2VFB A;  2FO5 A;  4K7C A;  1O0E A;  8PCH A;  4YYQ A;  1W4T A;  2AYN A;  2BSZ A;  4YV8 A;  2XU4 A;  1NQC A;  4QRV A;  1AIM A;  4W5C A;  3CBK A;  3KWZ A;  3F5V A;  1F29 A;  1U9W A;  5J94 A;  2BDL A;  4BQV A;  4FJC A;  1AYV A;  4OEL A;  4I04 A;  4MZO A;  2R9N A;  5CVO B;  4BPV A;  1MDW A;  2E03 A;  3H7D A;  1PE6 A;  3B79 A;  5CVM A;  3PNR A;  4YYU A;  1GX3 A;  2DCD A;  2YJ2 A;  3V6C A;  1F2C A;  1AYU A;  3MOR A;  2DC6 A;  1MS6 A;  3I3T A;  1CPJ A;  4QBB A;  1GLO A;  2DCC A;  3CH2 X;  1PPO A;  2DCA A;  1U9V A;  5CHT A;  3K9M A;  3H8B A;  3MHH A;  2CB5 A;  1E2T A;  1YT7 A;  1KFU L;  2AUX A;  2YJC A;  4DMY A;  1DF0 A;  1YVB A;  4BSQ A;  2NQD B;  4N4Z A;  3USV A;  1TLO A;  1AYW A;  2YJ9 A;  1EWL A;  3OVZ A;  1MEG A;  4NV7 A;  3CH3 X;  5CVN B;  3P5V A;  1CSB B;  3KWB X;  3U8E A;  2XU5 A;  2HD5 A;  2P86 A;  3E1Z B;  9PAP A;  4QRG A;  4PP2 E;  2AYO A;  2AS8 A;  2DC8 A;  1QOL A;  3MTN A;  2BDZ A;  2IBI A;  4FIP A;  3PBH A;  3H89 A;  3BWK A;  4W4U A;  1PIP A;  3N3K A;  1ME4 A;  4RY2 A;  2VHS A;  1S4V A;  3P5U A;  2O6X A;  1IWD A;  1CB5 A;  2G8J A;  2VHF A;  2F7D A;  1JQP A;  1F2A A;  3BOW A;  2AUZ A;  1CTE A;  4YYR A;  4AXL A;  1Y4H A;  2DCB A;  2NQI A;  1MEM A;  4PP1 A;  1X9Y A;  1ME3 A;  2PNS A;  1QXP A;  3KW9 A;  3P5W A;  3D9W A;  3S3R A;  2DJF B;  1Y08 A;  1W5R A;  4I05 A;  4CDC B;  3CBJ A;  5JA7 A;  3S3Q A;  1SP4 B;  4I07 A;  1HUC B;  1U9X A;  5JH3 A;  1Q6K A;  1U9Q X;  4YYV A;  3PDF A;  1CV8 A;  2JQG R;  1YAL A;  2AU1 A;  4BS6 A;  4CDF B;  1KHP A;  1PCI A;  4BGF A;  3MHS A;  1W6F A;  3N4C A;  2ARY A;  4CDE B;  1EWM A;  2FTD A;  3OVX A;  3M99 A;  2DZY A;  3IHP A;  4GUZ A;  2YJ8 A;  1ZCM A;  3GCB A;  3IV2 A;  5EF4 A;  4X6J A;  1GCB A;  3KKU A;  5PAD A;  3KSE A;  3RVV A;  1CJL A;  3LXS A;  4P6E A;  1AU2 A;  2FUD A;  2AIM A;  4XUI A;  2WBF X;  3F75 A;  1AU3 A;  3HHA A;  3C9E A;  1FH0 A;  2NQG A;  4PI3 A;  2G7Y A;  4QH6 A;  5FPW A;  2OZ2 A;  3ERV A;  3O0U A;  2XU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...