1Y08A

Structure of the streptococcal endopeptidase ides, a novel cysteine proteinase with strict specificity for igg
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
291
structure length
286
Chain Sequence
TSVWTKGVTPPANFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLSGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINFNGEQMFDVKEAIDTKNHQLDSKLFEYFKEKAFPYLKHLGVFPDHVIDMFINGYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SPy0861
publication title Structure of the streptococcal endopeptidase IdeS, a cysteine proteinase with strict specificity for IgG
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 81
structure length 286
sequence length 291
ec nomenclature
pdb deposition date 2004-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1y08A01
1KHQA 1KXRA 1CSBB 1U5IA 2R9OA 3H6SA 2AVWA 1PPDA 5EGWA 1KHPA 2C0YA 1EWMA 4QRVA 3C9EA 4I05A 2B1MA 1NLJA 1DF0A 2R9CA 4Q8HA 3MHSA 2Y6EA 3O1GA 4DMXA 3B79A 2AS8A 3U8EA 2XU5A 4QBBA 3RVVA 2VHFA 4YVAA 4HWYA 1K3BB 2ATOA 2FQ9A 1Y08A 4MZSA 4PI3A 3CH2X 3BOWA 4X6JA 3NHEA 3K24A 2OP3A 2DC8A 3BWKA 9PAPA 5FPWA 3I3TA 2P86A 1QOLA 3KKUA 1NB5A 1XKGA 2DC6A 1EWLA 1CJLA 1TU6A 2JQGR 2XU3A 2BDZA 2R9MA 4BS5A 4BS6A 2DCDA 3QSDA 3P5XA 1M6DA 2HH5A 4FIPA 1NB3A 1HUCB 4YV8A 4MSXA 4CDDB 4X6IA 4W4UA 2PREA 4CDFB 1MS6A 3MTNA 3H7DA 3PBHA 1BY8A 1KFXL 2G8JA 1GCBA 2E02A 1CB5A 3KX1A 5CVOB 4YYRA 2O6XA 4CZWA 2JQFR 3K8UA 1PIPA 2E03A 1PBHA 4BQVA 4OELA 4QH6A 2AYOA 2NQGA 2YJ8A 1GLOA 1F29A 3O0UA 2PBHA 3OISA 3QT4A 3KFQA 3E1ZB 5CVNB 4ZUXU 3P5VA 1ME4A 5K16A 2YJ9A 1EF7A 1F2CA 3RVXA 3HD3A 3WXEA 4KLBA 2DJFB 1CPJA 4PADA 3OVXA 4CDEB 3D6SA 1YVBA 1MHWA 2G8EA 2HHNA 4AXLA 4I04A 3LXSA 5J94A 1NQCA 1CV8A 1PE6A 3ERVA 2CIOA 5JA7A 1AU2A 1GMYA 3IUTA 1AECA 1CQDA 3GCBA 1ZIVA 1VJVA 1MEMA 2G7YA 5CHTA 1F2AA 3P5WA 3IOQA 1AU3A 1PADA 2R6NA 1CS8A 1THEA 4BPVA 2VHSA 2PADA 3P5UA 4CDCB 2NQDB 3KW9A 2HXZA 5F02A 3LFYA 2FT2A 4G54A 1YT7A 2GFOA 2FO5A 3QJ3A 2OULA 3PW3A 1TL9A 2DCAA 2FRQA 3BCNA 1QXPA 2F1GA 4YYSA 1YK8A 2ARYA 1U9WA 2DJGB 1PPNA 4Q8GA 2AUXA 4I07A 4FK5A 3OVZA 2XU1A 4QRGA 1PCIA 1DEUA 2AIMA 1QDQA 1TLOA 4PP2E 2FUDA 1CTEA 2AUZA 2DCCA 1A6RA 1KFUL 1YALA 3CBKA 2R9NA 3H89A 2E01A 3KWBX 3S3RA 6PADA 2GHUA 3PNRA 3KWZA 3CH3X 3ZUAA 2G6DA 2ACTA 1EWPA 3F5VA 1PPOA 3WXGA 4XUIA 2CB5A 3N3KA 1IWDA 2IPPB 3OF8A 4OEMA 3HHIA 2HD5A 2NQAA 2Y5BA 3OF9A 3IV2A 1GECE 3IHPA 3N3GA 4P6EA 1O0EA 2YJCA 1U9QX 3S3QA 2P0RA 4DMYA 4W5BA 3DF0A 2PNSA 1BP4A 2E00A 3BC3A 1ICFA 3HHAA 1AU4A 4W5CA 4PP1A 4YYWA 5JH3A 1ATKA 3BPMA 1NPZA 8PCHA 1AU0A 2OZ2A 1NL6A 4YYVA 3H8CA 1PPPA 2P7UA 4MZOA 1SNKA 2R9FA 1Q6KA 4FJCA 1AIMA 3K9MA 1AYUA 4QRXA 4YYUA 2AU1A 4WA6A 3MORA 2WBFX 2YJ2A 3M99A 2DCBA 3F75A 3TNXA 1MIRA 3MHHA 1U9XA 5CVMA 2FRAA 1CVZA 4X6HA 5CHVA 2H7JA 2B1NA 4P6GA 1STFE 2NQIA 5A24A 1YK7A 4N79A 3H8BA 1F2BA 1POPA 2DZYA 1PXVA 2FYEA 3V6CA 3IEJA 2F7DA 3AI8A 3BPFA 1FH0A 1ITOA 2BDLA 4N4ZA 2FTDA 1Y4HA 2XU4A 2DZZA 1EWOA 1X9YA 2IBIA 1MDWA 3N4CA 1BQIA 3IMAA 4YYQA 3HWNA 1SP4B 4K7CA 2DC9A 1AYVA 4RY2A 4N8WA 4XR7A 3RVWA 1BGOA 2DC7A 3I06A 1AYWA 5EF4A 3PDFA 1JQPA 1ZCMA 1VSNA 3USVA 4AXMA 4BSQA 2YJBA 1QMYA 7PCKA 3CBJA 2AYNA 3KSEA 5PADA 1MEGA 1ME3A 3WXFA 1U9VA 3V6EA 1S4VA
chains in the Genus database with same CATH superfamily
1KHQA 1KXRA 1CSBB 1U5IA 2R9OA 3H6SA 2AVWA 1PPDA 4WURA 5EGWA 1KHPA 2C0YA 1EWMA 2JRIA 3C9EA 4QRVA 3E9SA 4I05A 2B1MA 1NLJA 1DF0A 2R9CA 4Q8HA 3MHSA 2Y6EA 3O1GA 4RNAA 4DMXA 4BOZA 3B79A 2AS8A 3U8EA 2XU5A 4QBBA 3RVVA 2VHFA 4YVAA 4HWYA 1K3BB 2ATOA 2FQ9A 1Y08A 4MZSA 4PI3A 3CH2X 3BOWA 4X6JA 3NHEA 3K24A 2OP3A 2DC8A 3BWKA 9PAPA 5E6JA 4RF1A 5FPWA 3I3TA 2P86A 1QOLA 3KKUA 1NB5A 1XKGA 4IP3A 2DC6A 1EWLA 3MJ5A 3ZNHA 1CJLA 1TU6A 2JQGR 2XU3A 2BDZA 2R9MA 4BS5A 4BS6A 2DCDA 3BY4A 5EZQA 5KO3A 3QSDA 3P5XA 1M6DA 2HH5A 4FIPA 1NB3A 1HUCB 4YV8A 4MSXA 4CDDB 4X6IA 4W4UA 3PT2A 2PREA 4CDFB 1MS6A 3MTNA 3H7DA 3PBHA 2BU3A 1BY8A 1KFXL 2G8JA 1GCBA 2E02A 1CB5A 3KX1A 5CVOB 4YYRA 2O6XA 4RKXA 4CZWA 2JQFR 3K8UA 2Z84A 1PIPA 2E03A 2JTCA 1PBHA 4BQVA 3PHXA 4OELA 3PHUA 4QH6A 2AYOA 2NQGA 2YJ8A 1GLOA 1F29A 3O0UA 2PBHA 2HWKA 3OISA 3QT4A 3KFQA 3E1ZB 4MI7A 5CVNB 4ZUXU 3P5VA 3W31A 1ME4A 5K16A 2YJ9A 1EF7A 1F2CA 3RVXA 3MP2A 3HD3A 4HXDB 3WXEA 4KLBA 2DJFB 1CPJA 4PADA 3OVXA 4CDEB 3D6SA 1YVBA 1MHWA 2G8EA 2HHNA 4BOQA 1YZBA 4AXLA 4I04A 1UKFA 3LXSA 2UZJA 3C0RA 4GUAA 5J94A 1NQCA 1CV8A 1DKIA 1PE6A 3ERVA 4OVZA 2CIOA 5JA7A 1AU2A 5JZEA 1GMYA 3IUTA 1AECA 1CQDA 3GCBA 2FE8A 1ZIVA 1VJVA 1MEMA 2G7YA 5CHTA 1F2AA 3P5WA 3IOQA 1AU3A 1PADA 2R6NA 1CS8A 1THEA 4BPVA 2VHSA 2PADA 3P5UA 4CDCB 2NQDB 3KW9A 2HXZA 5F02A 2DOSA 3LFYA 2BTWA 2FT2A 4G54A 1YT7A 2GFOA 2FO5A 3QJ3A 3W30A 2OULA 3PW3A 1TL9A 2DCAA 2FRQA 3BCNA 1QXPA 2F1GA 4YYSA 1YK8A 2ARYA 1U9WA 4REZA 2DJGB 1PPNA 4Q8GA 2AUXA 4I07A 4FK5A 3OVZA 2XU1A 4QRGA 4A5UA 1PCIA 1DEUA 2AIMA 1QDQA 1TLOA 4PP2E 4D8BA 4OVZB 2FUDA 1CTEA 2AUZA 2DCCA 1A6RA 1KFUL 1YALA 3CBKA 2R9NA 3H89A 2E01A 3KWBX 3S3RA 6PADA 2GHUA 3PNRA 3KWZA 3TRKA 3CH3X 3ZUAA 2AGAA 2G6DA 2ACTA 1EWPA 1PVJA 3F5VA 1PPOA 3WXGA 3PHWA 4XUIA 2CB5A 2J7QA 3N3KA 1IWDA 2IPPB 2BTWB 3OF8A 4OEMA 3HHIA 2HD5A 2NQAA 2Y5BA 3OF9A 3IV2A 2J7QC 1GECE 3IHPA 3PRMA 3N3GA 4OW0A 4P6EA 1O0EA 2YJCA 1U9QX 3S3QA 2P0RA 4DMYA 4PT5A 4W5BA 3DF0A 2PNSA 1BP4A 2E00A 3BC3A 3OQCA 1ICFA 3HHAA 1AU4A 4W5CA 4PP1A 3RNVA 4YYWA 5JH3A 1ATKA 3BPMA 1NPZA 8PCHA 1AU0A 2OZ2A 3MTVA 1NL6A 4YYVA 3H8CA 1PPPA 3TMPA 2P7UA 4RF0A 4MZOA 1SNKA 2R9FA 4IUMA 4XZXA 1Q6KA 4FJCA 1AIMA 3K9MA 1AYUA 4QRXA 4YYUA 2AU1A 4WA6A 3MORA 2WBFX 4BOPA 2YJ2A 3M99A 2DCBA 3F75A 3TNXA 3IFUA 1MIRA 3MHHA 1U9XA 5CVMA 2FRAA 1CVZA 4X6HA 5CHVA 2H7JA 2B1NA 4P6GA 1STFE 2NQIA 5A24A 4BOUA 1YK7A 4N79A 3H8BA 1F2BA 1POPA 2DZYA 1PXVA 2FYEA 3BB7A 3V6CA 3IEJA 4D8IA 3BBAA 2F7DA 3AI8A 4ZTBA 3BPFA 1FH0A 1ITOA 2BDLA 4N4ZA 4P16A 2FTDA 1Y4HA 2XU4A 3B21A 2DZZA 3PSEA 1EWOA 1X9YA 2IBIA 1MDWA 3N4CA 1BQIA 3IMAA 4YYQA 3HWNA 4D8EA 1SP4B 4K7CA 2DC9A 1AYVA 4RY2A 4N8WA 4R3DA 4MM3B 4XR7A 4M0WA 3RVWA 1BGOA 2DC7A 3I06A 1AYWA 5EF4A 3PDFA 1JQPA 1ZCMA 1VSNA 3O65A 3USVA 4AXMA 4BSQA 2YJBA 1QMYA 7PCKA 3CBJA 2AYNA 3KSEA 5PADA 3PRPA 5EZSA 1MEGA 1ME3A 3WXFA 1U9VA 4BOSA 3V6EA 1S4VA
chains in the Genus database with same CATH topology
1KHQA 1KXRA 1CSBB 1U5IA 2R9OA 3H6SA 1E2TA 2AVWA 1PPDA 5EGWA 1KHPA 2C0YA 1EWMA 4QRVA 3C9EA 4I05A 2B1MA 1NLJA 1DF0A 2R9CA 4Q8HA 3MHSA 2Y6EA 3O1GA 4DMXA 3B79A 2AS8A 3U8EA 2XU5A 4QBBA 3RVVA 2VHFA 4YVAA 4HWYA 1K3BB 2ATOA 2FQ9A 1Y08A 4MZSA 4PI3A 3CH2X 3BOWA 4X6JA 3NHEA 3K24A 2OP3A 2DC8A 3BWKA 9PAPA 5FPWA 3I3TA 2P86A 1QOLA 3KKUA 1NB5A 1XKGA 2DC6A 1EWLA 1CJLA 1TU6A 2JQGR 2XU3A 2BDZA 2R9MA 4BS5A 4BS6A 2DCDA 3QSDA 2VFBA 3P5XA 1M6DA 2HH5A 4FIPA 1NB3A 1HUCB 4YV8A 4MSXA 4CDDB 4X6IA 4W4UA 2PREA 4CDFB 1MS6A 3MTNA 3H7DA 3PBHA 1BY8A 1KFXL 2G8JA 1GCBA 2E02A 1CB5A 3KX1A 5CVOB 4YYRA 2O6XA 1GX3A 4CZWA 2JQFR 3K8UA 1PIPA 2E03A 1PBHA 4BQVA 4OELA 4QH6A 2AYOA 2NQGA 2YJ8A 1GLOA 1F29A 3O0UA 2PBHA 3OISA 3QT4A 4B55A 3D9WA 3KFQA 3E1ZB 5CVNB 4ZUXU 3P5VA 1ME4A 5K16A 2YJ9A 1EF7A 1F2CA 3RVXA 3HD3A 3WXEA 4KLBA 2DJFB 1CPJA 4PADA 3OVXA 4CDEB 3D6SA 1YVBA 1MHWA 2G8EA 2HHNA 4AXLA 4I04A 3LXSA 5J94A 1NQCA 1CV8A 1PE6A 3ERVA 2CIOA 5JA7A 1AU2A 1GMYA 3IUTA 1AECA 1CQDA 3GCBA 1ZIVA 1VJVA 1MEMA 2G7YA 5CHTA 1F2AA 3P5WA 3IOQA 1AU3A 1PADA 2R6NA 1CS8A 1THEA 4BPVA 2VHSA 2PADA 3P5UA 4CDCB 4GUZA 2NQDB 3KW9A 2HXZA 5F02A 3LFYA 2FT2A 4G54A 1YT7A 2GFOA 2FO5A 3QJ3A 4BGFA 2OULA 3PW3A 1TL9A 4NV8A 2DCAA 2FRQA 3BCNA 1QXPA 2F1GA 4YYSA 1YK8A 2ARYA 1U9WA 2DJGB 1PPNA 4Q8GA 2AUXA 4I07A 4FK5A 3OVZA 2XU1A 4QRGA 1PCIA 1DEUA 2AIMA 1QDQA 1TLOA 4PP2E 2FUDA 1CTEA 2AUZA 1W6FA 2DCCA 1A6RA 1KFUL 1YALA 3CBKA 2R9NA 3H89A 2E01A 3KWBX 3S3RA 6PADA 2GHUA 3PNRA 3KWZA 3CH3X 3ZUAA 2G6DA 2ACTA 1EWPA 3F5VA 1PPOA 3WXGA 4XUIA 2CB5A 3N3KA 1IWDA 2IPPB 3OF8A 4OEMA 2VFCA 3HHIA 2HD5A 2NQAA 2Y5BA 3OF9A 3IV2A 1GECE 3IHPA 3N3GA 4P6EA 1O0EA 2YJCA 1U9QX 3S3QA 2P0RA 4DMYA 4W5BA 3DF0A 2PNSA 1BP4A 2E00A 3BC3A 1ICFA 3HHAA 1AU4A 4W5CA 4PP1A 4YYWA 5JH3A 1ATKA 3BPMA 4C5PA 1NPZA 8PCHA 1AU0A 2OZ2A 1W5RA 1NL6A 4YYVA 3H8CA 1PPPA 2P7UA 2BSZA 4MZOA 1SNKA 2R9FA 1Q6KA 4FJCA 1AIMA 3K9MA 1AYUA 4QRXA 4YYUA 2AU1A 4WA6A 3MORA 2WBFX 2YJ2A 3M99A 2DCBA 1W4TA 3F75A 3TNXA 1MIRA 3LTWA 3MHHA 1U9XA 5CVMA 2FRAA 1CVZA 4X6HA 5CHVA 2H7JA 2B1NA 4P6GA 1STFE 2NQIA 5A24A 1YK7A 4N79A 3H8BA 1F2BA 1POPA 2DZYA 1PXVA 2FYEA 3V6CA 3IEJA 2F7DA 3AI8A 3BPFA 1FH0A 1ITOA 2BDLA 4N4ZA 2FTDA 1Y4HA 2XU4A 4NV7A 2DZZA 1EWOA 1X9YA 2IBIA 1MDWA 3N4CA 1BQIA 3IMAA 4YYQA 3HWNA 1SP4B 4K7CA 2DC9A 1AYVA 4RY2A 4N8WA 4XR7A 3RVWA 1BGOA 2DC7A 3I06A 1AYWA 5EF4A 3PDFA 1JQPA 1ZCMA 1VSNA 3USVA 4AXMA 4BSQA 2YJBA 1QMYA 7PCKA 3CBJA 2AYNA 3KSEA 5PADA 1MEGA 1ME3A 3WXFA 1U9VA 3V6EA 1S4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHQ A;  1KXR A;  1CSB B;  1U5I A;  2R9O A;  3H6S A;  2AVW A;  1PPD A;  5EGW A;  1KHP A;  2C0Y A;  1EWM A;  4QRV A;  3C9E A;  4I05 A;  2B1M A;  1NLJ A;  1DF0 A;  2R9C A;  4Q8H A;  3MHS A;  2Y6E A;  3O1G A;  4DMX A;  3B79 A;  2AS8 A;  3U8E A;  2XU5 A;  4QBB A;  3RVV A;  2VHF A;  4YVA A;  4HWY A;  1K3B B;  2ATO A;  2FQ9 A;  1Y08 A;  4MZS A;  4PI3 A;  3CH2 X;  3BOW A;  4X6J A;  3NHE A;  3K24 A;  2OP3 A;  2DC8 A;  3BWK A;  9PAP A;  5FPW A;  3I3T A;  2P86 A;  1QOL A;  3KKU A;  1NB5 A;  1XKG A;  2DC6 A;  1EWL A;  1CJL A;  1TU6 A;  2JQG R;  2XU3 A;  2BDZ A;  2R9M A;  4BS5 A;  4BS6 A;  2DCD A;  3QSD A;  3P5X A;  1M6D A;  2HH5 A;  4FIP A;  1NB3 A;  1HUC B;  4YV8 A;  4MSX A;  4CDD B;  4X6I A;  4W4U A;  2PRE A;  4CDF B;  1MS6 A;  3MTN A;  3H7D A;  3PBH A;  1BY8 A;  1KFX L;  2G8J A;  1GCB A;  2E02 A;  1CB5 A;  3KX1 A;  5CVO B;  4YYR A;  2O6X A;  4CZW A;  2JQF R;  3K8U A;  1PIP A;  2E03 A;  1PBH A;  4BQV A;  4OEL A;  4QH6 A;  2AYO A;  2NQG A;  2YJ8 A;  1GLO A;  1F29 A;  3O0U A;  2PBH A;  3OIS A;  3QT4 A;  3KFQ A;  3E1Z B;  5CVN B;  4ZUX U;  3P5V A;  1ME4 A;  5K16 A;  2YJ9 A;  1EF7 A;  1F2C A;  3RVX A;  3HD3 A;  3WXE A;  4KLB A;  2DJF B;  1CPJ A;  4PAD A;  3OVX A;  4CDE B;  3D6S A;  1YVB A;  1MHW A;  2G8E A;  2HHN A;  4AXL A;  4I04 A;  3LXS A;  5J94 A;  1NQC A;  1CV8 A;  1PE6 A;  3ERV A;  2CIO A;  5JA7 A;  1AU2 A;  1GMY A;  3IUT A;  1AEC A;  1CQD A;  3GCB A;  1ZIV A;  1VJV A;  1MEM A;  2G7Y A;  5CHT A;  1F2A A;  3P5W A;  3IOQ A;  1AU3 A;  1PAD A;  2R6N A;  1CS8 A;  1THE A;  4BPV A;  2VHS A;  2PAD A;  3P5U A;  4CDC B;  2NQD B;  3KW9 A;  2HXZ A;  5F02 A;  3LFY A;  2FT2 A;  4G54 A;  1YT7 A;  2GFO A;  2FO5 A;  3QJ3 A;  2OUL A;  3PW3 A;  1TL9 A;  2DCA A;  2FRQ A;  3BCN A;  1QXP A;  2F1G A;  4YYS A;  1YK8 A;  2ARY A;  1U9W A;  2DJG B;  1PPN A;  4Q8G A;  2AUX A;  4I07 A;  4FK5 A;  3OVZ A;  2XU1 A;  4QRG A;  1PCI A;  1DEU A;  2AIM A;  1QDQ A;  1TLO A;  4PP2 E;  2FUD A;  1CTE A;  2AUZ A;  2DCC A;  1A6R A;  1KFU L;  1YAL A;  3CBK A;  2R9N A;  3H89 A;  2E01 A;  3KWB X;  3S3R A;  6PAD A;  2GHU A;  3PNR A;  3KWZ A;  3CH3 X;  3ZUA A;  2G6D A;  2ACT A;  1EWP A;  3F5V A;  1PPO A;  3WXG A;  4XUI A;  2CB5 A;  3N3K A;  1IWD A;  2IPP B;  3OF8 A;  4OEM A;  3HHI A;  2HD5 A;  2NQA A;  2Y5B A;  3OF9 A;  3IV2 A;  1GEC E;  3IHP A;  3N3G A;  4P6E A;  1O0E A;  2YJC A;  1U9Q X;  3S3Q A;  2P0R A;  4DMY A;  4W5B A;  3DF0 A;  2PNS A;  1BP4 A;  2E00 A;  3BC3 A;  1ICF A;  3HHA A;  1AU4 A;  4W5C A;  4PP1 A;  4YYW A;  5JH3 A;  1ATK A;  3BPM A;  1NPZ A;  8PCH A;  1AU0 A;  2OZ2 A;  1NL6 A;  4YYV A;  3H8C A;  1PPP A;  2P7U A;  4MZO A;  1SNK A;  2R9F A;  1Q6K A;  4FJC A;  1AIM A;  3K9M A;  1AYU A;  4QRX A;  4YYU A;  2AU1 A;  4WA6 A;  3MOR A;  2WBF X;  2YJ2 A;  3M99 A;  2DCB A;  3F75 A;  3TNX A;  1MIR A;  3MHH A;  1U9X A;  5CVM A;  2FRA A;  1CVZ A;  4X6H A;  5CHV A;  2H7J A;  2B1N A;  4P6G A;  1STF E;  2NQI A;  5A24 A;  1YK7 A;  4N79 A;  3H8B A;  1F2B A;  1POP A;  2DZY A;  1PXV A;  2FYE A;  3V6C A;  3IEJ A;  2F7D A;  3AI8 A;  3BPF A;  1FH0 A;  1ITO A;  2BDL A;  4N4Z A;  2FTD A;  1Y4H A;  2XU4 A;  2DZZ A;  1EWO A;  1X9Y A;  2IBI A;  1MDW A;  3N4C A;  1BQI A;  3IMA A;  4YYQ A;  3HWN A;  1SP4 B;  4K7C A;  2DC9 A;  1AYV A;  4RY2 A;  4N8W A;  4XR7 A;  3RVW A;  1BGO A;  2DC7 A;  3I06 A;  1AYW A;  5EF4 A;  3PDF A;  1JQP A;  1ZCM A;  1VSN A;  3USV A;  4AXM A;  4BSQ A;  2YJB A;  1QMY A;  7PCK A;  3CBJ A;  2AYN A;  3KSE A;  5PAD A;  1MEG A;  1ME3 A;  3WXF A;  1U9V A;  3V6E A;  1S4V A; 
#chains in the Genus database with same CATH topology
 1KHQ A;  1KXR A;  1CSB B;  1U5I A;  2R9O A;  3H6S A;  2AVW A;  1PPD A;  4WUR A;  5EGW A;  1KHP A;  2C0Y A;  1EWM A;  2JRI A;  3C9E A;  4QRV A;  3E9S A;  4I05 A;  2B1M A;  1NLJ A;  1DF0 A;  2R9C A;  4Q8H A;  3MHS A;  2Y6E A;  3O1G A;  4RNA A;  4DMX A;  4BOZ A;  3B79 A;  2AS8 A;  3U8E A;  2XU5 A;  4QBB A;  3RVV A;  2VHF A;  4YVA A;  4HWY A;  1K3B B;  2ATO A;  2FQ9 A;  1Y08 A;  4MZS A;  4PI3 A;  3CH2 X;  3BOW A;  4X6J A;  3NHE A;  3K24 A;  2OP3 A;  2DC8 A;  3BWK A;  9PAP A;  5E6J A;  4RF1 A;  5FPW A;  3I3T A;  2P86 A;  1QOL A;  3KKU A;  1NB5 A;  1XKG A;  4IP3 A;  2DC6 A;  1EWL A;  3MJ5 A;  3ZNH A;  1CJL A;  1TU6 A;  2JQG R;  2XU3 A;  2BDZ A;  2R9M A;  4BS5 A;  4BS6 A;  2DCD A;  3BY4 A;  5EZQ A;  5KO3 A;  3QSD A;  3P5X A;  1M6D A;  2HH5 A;  4FIP A;  1NB3 A;  1HUC B;  4YV8 A;  4MSX A;  4CDD B;  4X6I A;  4W4U A;  3PT2 A;  2PRE A;  4CDF B;  1MS6 A;  3MTN A;  3H7D A;  3PBH A;  2BU3 A;  1BY8 A;  1KFX L;  2G8J A;  1GCB A;  2E02 A;  1CB5 A;  3KX1 A;  5CVO B;  4YYR A;  2O6X A;  4RKX A;  4CZW A;  2JQF R;  3K8U A;  2Z84 A;  1PIP A;  2E03 A;  2JTC A;  1PBH A;  4BQV A;  3PHX A;  4OEL A;  3PHU A;  4QH6 A;  2AYO A;  2NQG A;  2YJ8 A;  1GLO A;  1F29 A;  3O0U A;  2PBH A;  2HWK A;  3OIS A;  3QT4 A;  3KFQ A;  3E1Z B;  4MI7 A;  5CVN B;  4ZUX U;  3P5V A;  3W31 A;  1ME4 A;  5K16 A;  2YJ9 A;  1EF7 A;  1F2C A;  3RVX A;  3MP2 A;  3HD3 A;  4HXD B;  3WXE A;  4KLB A;  2DJF B;  1CPJ A;  4PAD A;  3OVX A;  4CDE B;  3D6S A;  1YVB A;  1MHW A;  2G8E A;  2HHN A;  4BOQ A;  1YZB A;  4AXL A;  4I04 A;  1UKF A;  3LXS A;  2UZJ A;  3C0R A;  4GUA A;  5J94 A;  1NQC A;  1CV8 A;  1DKI A;  1PE6 A;  3ERV A;  4OVZ A;  2CIO A;  5JA7 A;  1AU2 A;  5JZE A;  1GMY A;  3IUT A;  1AEC A;  1CQD A;  3GCB A;  2FE8 A;  1ZIV A;  1VJV A;  1MEM A;  2G7Y A;  5CHT A;  1F2A A;  3P5W A;  3IOQ A;  1AU3 A;  1PAD A;  2R6N A;  1CS8 A;  1THE A;  4BPV A;  2VHS A;  2PAD A;  3P5U A;  4CDC B;  2NQD B;  3KW9 A;  2HXZ A;  5F02 A;  2DOS A;  3LFY A;  2BTW A;  2FT2 A;  4G54 A;  1YT7 A;  2GFO A;  2FO5 A;  3QJ3 A;  3W30 A;  2OUL A;  3PW3 A;  1TL9 A;  2DCA A;  2FRQ A;  3BCN A;  1QXP A;  2F1G A;  4YYS A;  1YK8 A;  2ARY A;  1U9W A;  4REZ A;  2DJG B;  1PPN A;  4Q8G A;  2AUX A;  4I07 A;  4FK5 A;  3OVZ A;  2XU1 A;  4QRG A;  4A5U A;  1PCI A;  1DEU A;  2AIM A;  1QDQ A;  1TLO A;  4PP2 E;  4D8B A;  4OVZ B;  2FUD A;  1CTE A;  2AUZ A;  2DCC A;  1A6R A;  1KFU L;  1YAL A;  3CBK A;  2R9N A;  3H89 A;  2E01 A;  3KWB X;  3S3R A;  6PAD A;  2GHU A;  3PNR A;  3KWZ A;  3TRK A;  3CH3 X;  3ZUA A;  2AGA A;  2G6D A;  2ACT A;  1EWP A;  1PVJ A;  3F5V A;  1PPO A;  3WXG A;  3PHW A;  4XUI A;  2CB5 A;  2J7Q A;  3N3K A;  1IWD A;  2IPP B;  2BTW B;  3OF8 A;  4OEM A;  3HHI A;  2HD5 A;  2NQA A;  2Y5B A;  3OF9 A;  3IV2 A;  2J7Q C;  1GEC E;  3IHP A;  3PRM A;  3N3G A;  4OW0 A;  4P6E A;  1O0E A;  2YJC A;  1U9Q X;  3S3Q A;  2P0R A;  4DMY A;  4PT5 A;  4W5B A;  3DF0 A;  2PNS A;  1BP4 A;  2E00 A;  3BC3 A;  3OQC A;  1ICF A;  3HHA A;  1AU4 A;  4W5C A;  4PP1 A;  3RNV A;  4YYW A;  5JH3 A;  1ATK A;  3BPM A;  1NPZ A;  8PCH A;  1AU0 A;  2OZ2 A;  3MTV A;  1NL6 A;  4YYV A;  3H8C A;  1PPP A;  3TMP A;  2P7U A;  4RF0 A;  4MZO A;  1SNK A;  2R9F A;  4IUM A;  4XZX A;  1Q6K A;  4FJC A;  1AIM A;  3K9M A;  1AYU A;  4QRX A;  4YYU A;  2AU1 A;  4WA6 A;  3MOR A;  2WBF X;  4BOP A;  2YJ2 A;  3M99 A;  2DCB A;  3F75 A;  3TNX A;  3IFU A;  1MIR A;  3MHH A;  1U9X A;  5CVM A;  2FRA A;  1CVZ A;  4X6H A;  5CHV A;  2H7J A;  2B1N A;  4P6G A;  1STF E;  2NQI A;  5A24 A;  4BOU A;  1YK7 A;  4N79 A;  3H8B A;  1F2B A;  1POP A;  2DZY A;  1PXV A;  2FYE A;  3BB7 A;  3V6C A;  3IEJ A;  4D8I A;  3BBA A;  2F7D A;  3AI8 A;  4ZTB A;  3BPF A;  1FH0 A;  1ITO A;  2BDL A;  4N4Z A;  4P16 A;  2FTD A;  1Y4H A;  2XU4 A;  3B21 A;  2DZZ A;  3PSE A;  1EWO A;  1X9Y A;  2IBI A;  1MDW A;  3N4C A;  1BQI A;  3IMA A;  4YYQ A;  3HWN A;  4D8E A;  1SP4 B;  4K7C A;  2DC9 A;  1AYV A;  4RY2 A;  4N8W A;  4R3D A;  4MM3 B;  4XR7 A;  4M0W A;  3RVW A;  1BGO A;  2DC7 A;  3I06 A;  1AYW A;  5EF4 A;  3PDF A;  1JQP A;  1ZCM A;  1VSN A;  3O65 A;  3USV A;  4AXM A;  4BSQ A;  2YJB A;  1QMY A;  7PCK A;  3CBJ A;  2AYN A;  3KSE A;  5PAD A;  3PRP A;  5EZS A;  1MEG A;  1ME3 A;  3WXF A;  1U9V A;  4BOS A;  3V6E A;  1S4V A; 
#chains in the Genus database with same CATH homology
 1KHQ A;  1KXR A;  1CSB B;  1U5I A;  2R9O A;  3H6S A;  1E2T A;  2AVW A;  1PPD A;  5EGW A;  1KHP A;  2C0Y A;  1EWM A;  4QRV A;  3C9E A;  4I05 A;  2B1M A;  1NLJ A;  1DF0 A;  2R9C A;  4Q8H A;  3MHS A;  2Y6E A;  3O1G A;  4DMX A;  3B79 A;  2AS8 A;  3U8E A;  2XU5 A;  4QBB A;  3RVV A;  2VHF A;  4YVA A;  4HWY A;  1K3B B;  2ATO A;  2FQ9 A;  1Y08 A;  4MZS A;  4PI3 A;  3CH2 X;  3BOW A;  4X6J A;  3NHE A;  3K24 A;  2OP3 A;  2DC8 A;  3BWK A;  9PAP A;  5FPW A;  3I3T A;  2P86 A;  1QOL A;  3KKU A;  1NB5 A;  1XKG A;  2DC6 A;  1EWL A;  1CJL A;  1TU6 A;  2JQG R;  2XU3 A;  2BDZ A;  2R9M A;  4BS5 A;  4BS6 A;  2DCD A;  3QSD A;  2VFB A;  3P5X A;  1M6D A;  2HH5 A;  4FIP A;  1NB3 A;  1HUC B;  4YV8 A;  4MSX A;  4CDD B;  4X6I A;  4W4U A;  2PRE A;  4CDF B;  1MS6 A;  3MTN A;  3H7D A;  3PBH A;  1BY8 A;  1KFX L;  2G8J A;  1GCB A;  2E02 A;  1CB5 A;  3KX1 A;  5CVO B;  4YYR A;  2O6X A;  1GX3 A;  4CZW A;  2JQF R;  3K8U A;  1PIP A;  2E03 A;  1PBH A;  4BQV A;  4OEL A;  4QH6 A;  2AYO A;  2NQG A;  2YJ8 A;  1GLO A;  1F29 A;  3O0U A;  2PBH A;  3OIS A;  3QT4 A;  4B55 A;  3D9W A;  3KFQ A;  3E1Z B;  5CVN B;  4ZUX U;  3P5V A;  1ME4 A;  5K16 A;  2YJ9 A;  1EF7 A;  1F2C A;  3RVX A;  3HD3 A;  3WXE A;  4KLB A;  2DJF B;  1CPJ A;  4PAD A;  3OVX A;  4CDE B;  3D6S A;  1YVB A;  1MHW A;  2G8E A;  2HHN A;  4AXL A;  4I04 A;  3LXS A;  5J94 A;  1NQC A;  1CV8 A;  1PE6 A;  3ERV A;  2CIO A;  5JA7 A;  1AU2 A;  1GMY A;  3IUT A;  1AEC A;  1CQD A;  3GCB A;  1ZIV A;  1VJV A;  1MEM A;  2G7Y A;  5CHT A;  1F2A A;  3P5W A;  3IOQ A;  1AU3 A;  1PAD A;  2R6N A;  1CS8 A;  1THE A;  4BPV A;  2VHS A;  2PAD A;  3P5U A;  4CDC B;  4GUZ A;  2NQD B;  3KW9 A;  2HXZ A;  5F02 A;  3LFY A;  2FT2 A;  4G54 A;  1YT7 A;  2GFO A;  2FO5 A;  3QJ3 A;  4BGF A;  2OUL A;  3PW3 A;  1TL9 A;  4NV8 A;  2DCA A;  2FRQ A;  3BCN A;  1QXP A;  2F1G A;  4YYS A;  1YK8 A;  2ARY A;  1U9W A;  2DJG B;  1PPN A;  4Q8G A;  2AUX A;  4I07 A;  4FK5 A;  3OVZ A;  2XU1 A;  4QRG A;  1PCI A;  1DEU A;  2AIM A;  1QDQ A;  1TLO A;  4PP2 E;  2FUD A;  1CTE A;  2AUZ A;  1W6F A;  2DCC A;  1A6R A;  1KFU L;  1YAL A;  3CBK A;  2R9N A;  3H89 A;  2E01 A;  3KWB X;  3S3R A;  6PAD A;  2GHU A;  3PNR A;  3KWZ A;  3CH3 X;  3ZUA A;  2G6D A;  2ACT A;  1EWP A;  3F5V A;  1PPO A;  3WXG A;  4XUI A;  2CB5 A;  3N3K A;  1IWD A;  2IPP B;  3OF8 A;  4OEM A;  2VFC A;  3HHI A;  2HD5 A;  2NQA A;  2Y5B A;  3OF9 A;  3IV2 A;  1GEC E;  3IHP A;  3N3G A;  4P6E A;  1O0E A;  2YJC A;  1U9Q X;  3S3Q A;  2P0R A;  4DMY A;  4W5B A;  3DF0 A;  2PNS A;  1BP4 A;  2E00 A;  3BC3 A;  1ICF A;  3HHA A;  1AU4 A;  4W5C A;  4PP1 A;  4YYW A;  5JH3 A;  1ATK A;  3BPM A;  4C5P A;  1NPZ A;  8PCH A;  1AU0 A;  2OZ2 A;  1W5R A;  1NL6 A;  4YYV A;  3H8C A;  1PPP A;  2P7U A;  2BSZ A;  4MZO A;  1SNK A;  2R9F A;  1Q6K A;  4FJC A;  1AIM A;  3K9M A;  1AYU A;  4QRX A;  4YYU A;  2AU1 A;  4WA6 A;  3MOR A;  2WBF X;  2YJ2 A;  3M99 A;  2DCB A;  1W4T A;  3F75 A;  3TNX A;  1MIR A;  3LTW A;  3MHH A;  1U9X A;  5CVM A;  2FRA A;  1CVZ A;  4X6H A;  5CHV A;  2H7J A;  2B1N A;  4P6G A;  1STF E;  2NQI A;  5A24 A;  1YK7 A;  4N79 A;  3H8B A;  1F2B A;  1POP A;  2DZY A;  1PXV A;  2FYE A;  3V6C A;  3IEJ A;  2F7D A;  3AI8 A;  3BPF A;  1FH0 A;  1ITO A;  2BDL A;  4N4Z A;  2FTD A;  1Y4H A;  2XU4 A;  4NV7 A;  2DZZ A;  1EWO A;  1X9Y A;  2IBI A;  1MDW A;  3N4C A;  1BQI A;  3IMA A;  4YYQ A;  3HWN A;  1SP4 B;  4K7C A;  2DC9 A;  1AYV A;  4RY2 A;  4N8W A;  4XR7 A;  3RVW A;  1BGO A;  2DC7 A;  3I06 A;  1AYW A;  5EF4 A;  3PDF A;  1JQP A;  1ZCM A;  1VSN A;  3USV A;  4AXM A;  4BSQ A;  2YJB A;  1QMY A;  7PCK A;  3CBJ A;  2AYN A;  3KSE A;  5PAD A;  1MEG A;  1ME3 A;  3WXF A;  1U9V A;  3V6E A;  1S4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...