1Y08A

Structure of the streptococcal endopeptidase ides, a novel cysteine proteinase with strict specificity for igg
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
291
structure length
286
Chain Sequence
TSVWTKGVTPPANFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLSGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINFNGEQMFDVKEAIDTKNHQLDSKLFEYFKEKAFPYLKHLGVFPDHVIDMFINGYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords hypothetical protein SPy0861
publication title Structure of the streptococcal endopeptidase IdeS, a cysteine proteinase with strict specificity for IgG
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 81
structure length 286
sequence length 291
ec nomenclature
pdb deposition date 2004-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1y08A01
1NB5A 3H8BA 4P6GA 4N79A 1QDQA 4HWYA 3HWNA 2VHFA 1MDWA 4PADA 1KFXL 2G8EA 1ITOA 1PE6A 1CTEA 1BY8A 4AXMA 1QMYA 3NHEA 3BC3A 2E00A 3WXEA 2AVWA 4DMXA 3WXGA 1Q6KA 1QOLA 3PDFA 1CQDA 1VJVA 2XU4A 2AS8A 1ICFA 3HD3A 2YJBA 1HUCB 2R6NA 1STFE 1TL9A 3H7DA 4FK5A 5EGWA 2F7DA 2C0YA 1PPOA 2P0RA 4CDCB 2B1MA 3KFQA 3USVA 4YYQA 2DC8A 4I07A 4PI3A 2VHSA 2DJGB 1GMYA 3CBKA 2GFOA 1A6RA 1MEGA 2XU5A 2DZYA 3QSDA 4X6JA 4X6IA 1AU0A 3N3GA 2FRAA 1POPA 3K24A 3KX1A 1GECE 3KKUA 1MIRA 3F75A 1CB5A 1TU6A 2R9FA 3OF9A 1YK8A 4YV8A 3BPMA 3RVVA 1CJLA 3P5VA 1NLJA 1PPNA 5J94A 2E01A 1ZIVA 1KHQA 1AU3A 3IMAA 3KWBX 2FTDA 2NQAA 3GCBA 3V6CA 1U9XA 2DCBA 1AYVA 1CVZA 1KFUL 4Q8GA 2DJFB 4PP1A 1K3BB 1CSBB 1F2CA 4CZWA 2FQ9A 4W4UA 1AU4A 1PPPA 4MZOA 4P6EA 2G6DA 2HD5A 2O6XA 4XR7A 1NQCA 2ARYA 2FYEA 4QRXA 4QRGA 5CHVA 4CDFB 2Y5BA 1F29A 1KHPA 2AU1A 3IHPA 1PBHA 3H89A 3OISA 2P86A 4WA6A 2DCAA 3B79A 1Y08A 3IOQA 4MSXA 1EWLA 1U9VA 2IPPB 5F02A 4BPVA 3OF8A 1FH0A 4OEMA 1EWPA 2NQDB 1PADA 4KLBA 3N4CA 5CVMA 1ZCMA 8PCHA 2E03A 1PXVA 3QJ3A 4N8WA 2XU1A 1F2AA 1YK7A 2H7JA 7PCKA 2AUZA 3V6EA 3P5WA 3MHHA 2CB5A 3MORA 3OVZA 4YYSA 3AI8A 1EWOA 4FIPA 3RVXA 2YJCA 2BDZA 2OULA 2JQGR 3IV2A 3QT4A 4I05A 4CDEB 2DCDA 4DMYA 6PADA 1GLOA 3O1GA 2PBHA 1YT7A 1QXPA 1CS8A 1X9YA 2OZ2A 2AUXA 2G7YA 2P7UA 4BS5A 2OP3A 2GHUA 2HH5A 3PBHA 3HHIA 2Y6EA 1NB3A 1KXRA 1XKGA 2BDLA 1NPZA 3PW3A 3ERVA 3ZUAA 2JQFR 3KW9A 5JA7A 3WXFA 1AYUA 3S3RA 2FUDA 1MS6A 4QRVA 3K8UA 1EF7A 3BCNA 1BQIA 4YYRA 3TNXA 1PCIA 1EWMA 3HHAA 1BGOA 2YJ8A 5FPWA 4YYWA 1M6DA 4N4ZA 5K16A 3RVWA 1ME4A 2IBIA 1JQPA 2YJ2A 3F5VA 5A24A 2F1GA 3K9MA 3DF0A 4W5BA 1SNKA 2WBFX 2FRQA 3BOWA 1CPJA 1PPDA 3KSEA 3E1ZB 1MHWA 3IEJA 1O0EA 2CIOA 3I06A 2E02A 2DC7A 5CHTA 1ATKA 3U8EA 2FO5A 2HHNA 4XUIA 4BSQA 4W5CA 2B1NA 2PADA 2DC6A 4RY2A 4QBBA 2DCCA 2NQIA 4YYUA 4BS6A 3LXSA 1BP4A 3H6SA 1MEMA 4YVAA 3PNRA 2AYOA 2R9NA 3I3TA 4G54A 3OVXA 2DC9A 5EF4A 3P5UA 4PP2E 9PAPA 5PADA 4X6HA 3MTNA 4BQVA 4CDDB 2R9MA 4K7CA 2AYNA 5JH3A 1AU2A 4I04A 1THEA 4AXLA 3IUTA 4MZSA 2PNSA 1IWDA 1U5IA 2YJ9A 1F2BA 2AIMA 1YVBA 1U9QX 1Y4HA 2ATOA 1AECA 3C9EA 3MHSA 1AIMA 2ACTA 3CH2X 4ZUXU 1PIPA 3BWKA 1VSNA 2PREA 2DZZA 4Q8HA 1ME3A 4YYVA 4FJCA 2HXZA 1DF0A 4OELA 3KWZA 1NL6A 3BPFA 2G8JA 2R9OA 5CVNB 2R9CA 3CH3X 3N3KA 1SP4B 3O0UA 1AYWA 3H8CA 1GCBA 3LFYA 3D6SA 4QH6A 1U9WA 1YALA 2XU3A 3P5XA 1S4VA 1TLOA 3CBJA 1DEUA 2FT2A 2NQGA 3S3QA 5CVOB 3M99A 1CV8A
chains in the Genus database with same CATH superfamily
3TRKA 4OW0A 1NB5A 3H8BA 4P6GA 3O65A 4BOUA 4N79A 1QDQA 4HWYA 3HWNA 2VHFA 1MDWA 4PADA 1KFXL 2G8EA 5EZQA 1ITOA 1PE6A 1CTEA 1BY8A 4AXMA 1QMYA 4BOZA 3NHEA 3BC3A 2E00A 3WXEA 2AVWA 4DMXA 3WXGA 1Q6KA 1QOLA 3PDFA 3BY4A 1CQDA 1VJVA 2XU4A 2AS8A 1ICFA 3HD3A 2YJBA 1HUCB 2UZJA 2R6NA 1STFE 1TL9A 3H7DA 4FK5A 5EGWA 4OVZA 2F7DA 4XZXA 2C0YA 1PPOA 2P0RA 4CDCB 2B1MA 3KFQA 3USVA 4YYQA 2DC8A 4I07A 4PI3A 2VHSA 2DJGB 3OQCA 1GMYA 3CBKA 2GFOA 1A6RA 1MEGA 2XU5A 2DZYA 1UKFA 3QSDA 4X6JA 4X6IA 1AU0A 3N3GA 2HWKA 2FRAA 1POPA 3K24A 3KX1A 1GECE 3KKUA 1MIRA 3F75A 1CB5A 1TU6A 2R9FA 3OF9A 1YK8A 3RNVA 4YV8A 3BPMA 3RVVA 4D8IA 1CJLA 3P5VA 1NLJA 1PPNA 3PHUA 2J7QA 5J94A 2E01A 1ZIVA 1KHQA 1AU3A 2BTWA 3IMAA 2JTCA 3KWBX 2FTDA 2NQAA 3GCBA 3V6CA 1U9XA 5JZEA 2DCBA 1AYVA 1CVZA 1KFUL 4Q8GA 2DJFB 4BOSA 4PP1A 5E6JA 1K3BB 1CSBB 1F2CA 4CZWA 2FQ9A 4W4UA 4D8EA 1AU4A 1PPPA 4MZOA 4P6EA 2G6DA 2HD5A 2O6XA 4GUAA 4XR7A 1NQCA 2ARYA 2FYEA 4OVZB 4QRXA 4QRGA 5CHVA 4CDFB 2Y5BA 1F29A 1KHPA 1YZBA 2AU1A 3IHPA 1PBHA 3H89A 3OISA 2P86A 3MJ5A 2DCAA 4WA6A 3B79A 1Y08A 3IOQA 4MSXA 1EWLA 2Z84A 3E9SA 1U9VA 3BB7A 2IPPB 5F02A 4BPVA 3OF8A 1FH0A 4OEMA 4BOPA 1EWPA 2NQDB 1PADA 4KLBA 3N4CA 5CVMA 1ZCMA 8PCHA 2E03A 1PXVA 3QJ3A 4N8WA 2XU1A 1F2AA 3C0RA 1YK7A 2H7JA 7PCKA 2AUZA 3V6EA 3P5WA 2BTWB 3MHHA 2CB5A 3MORA 3PRMA 4RKXA 3OVZA 4YYSA 3W30A 3AI8A 1EWOA 4FIPA 3RVXA 2YJCA 2BDZA 2OULA 4REZA 2JQGR 3IV2A 3QT4A 4I05A 4CDEB 2DCDA 4DMYA 6PADA 1GLOA 3O1GA 2PBHA 1YT7A 1QXPA 2J7QC 1CS8A 1X9YA 2OZ2A 2AUXA 2G7YA 2P7UA 4BS5A 3PT2A 2OP3A 2GHUA 2HH5A 4IUMA 3PBHA 4RNAA 3HHIA 2Y6EA 1NB3A 3BBAA 1KXRA 1XKGA 2BDLA 1NPZA 3PW3A 3ERVA 3ZUAA 4MI7A 2JRIA 2JQFR 3KW9A 5JA7A 3WXFA 1AYUA 3S3RA 2FUDA 3PHXA 1MS6A 4QRVA 3K8UA 1EF7A 3BCNA 1BQIA 2DOSA 4YYRA 3TNXA 1PCIA 1EWMA 3HHAA 1BGOA 2YJ8A 5FPWA 4YYWA 1M6DA 4N4ZA 5KO3A 5K16A 3RVWA 1ME4A 2IBIA 1JQPA 2YJ2A 3F5VA 5A24A 2F1GA 3K9MA 3DF0A 4IP3A 4W5BA 3TMPA 3W31A 1SNKA 2WBFX 2FRQA 3BOWA 3MP2A 1CPJA 1PPDA 3KSEA 3E1ZB 1MHWA 3IEJA 1O0EA 2CIOA 3I06A 3B21A 2E02A 2DC7A 3PRPA 5CHTA 4RF1A 1ATKA 3U8EA 2FO5A 2HHNA 3IFUA 4XUIA 4BSQA 4W5CA 2B1NA 2PADA 2DC6A 4RY2A 3MTVA 4QBBA 2DCCA 2BU3A 2NQIA 4YYUA 4BS6A 3LXSA 1BP4A 3H6SA 1MEMA 4YVAA 3PNRA 2AYOA 2R9NA 3I3TA 4G54A 4BOQA 3OVXA 2DC9A 4MM3B 5EF4A 3P5UA 4PP2E 9PAPA 5PADA 4X6HA 3MTNA 4P16A 4BQVA 4CDDB 4A5UA 2R9MA 4K7CA 4HXDB 2AYNA 5JH3A 1AU2A 4I04A 5EZSA 4ZTBA 1THEA 4AXLA 3IUTA 4MZSA 3ZNHA 2PNSA 1IWDA 1U5IA 2YJ9A 3PHWA 1F2BA 2AIMA 1YVBA 3PSEA 1U9QX 4D8BA 1Y4HA 2ATOA 1AECA 3C9EA 3MHSA 1DKIA 1AIMA 2ACTA 3CH2X 4ZUXU 1PIPA 3BWKA 1VSNA 2PREA 2DZZA 4Q8HA 1ME3A 4YYVA 4FJCA 2HXZA 1PVJA 2FE8A 1DF0A 4OELA 3KWZA 4RF0A 1NL6A 3BPFA 2AGAA 2G8JA 2R9OA 5CVNB 2R9CA 4M0WA 3CH3X 3N3KA 1SP4B 4R3DA 3O0UA 1AYWA 3H8CA 1GCBA 3LFYA 3D6SA 4QH6A 1U9WA 1YALA 2XU3A 3P5XA 1S4VA 1TLOA 4WURA 3CBJA 4PT5A 1DEUA 2FT2A 2NQGA 3S3QA 5CVOB 3M99A 1CV8A
chains in the Genus database with same CATH topology
1NB5A 3H8BA 4P6GA 4N79A 1QDQA 4HWYA 3HWNA 2VHFA 1MDWA 4PADA 1KFXL 2G8EA 1ITOA 1PE6A 3D9WA 1CTEA 2VFCA 1BY8A 4AXMA 1QMYA 3NHEA 3BC3A 2E00A 3WXEA 2AVWA 4DMXA 3WXGA 1Q6KA 1QOLA 3PDFA 1CQDA 1VJVA 2XU4A 2AS8A 1ICFA 3HD3A 2YJBA 1HUCB 3LTWA 2R6NA 1STFE 1TL9A 3H7DA 4FK5A 5EGWA 2F7DA 2C0YA 1PPOA 2P0RA 4CDCB 2B1MA 3KFQA 3USVA 4YYQA 2DC8A 4I07A 4PI3A 2VHSA 2DJGB 1GMYA 3CBKA 2GFOA 1A6RA 1MEGA 2XU5A 2DZYA 3QSDA 4X6JA 4X6IA 1AU0A 3N3GA 2FRAA 1POPA 3K24A 3KX1A 1GX3A 1GECE 3KKUA 2BSZA 1MIRA 3F75A 4C5PA 1CB5A 1TU6A 2R9FA 3OF9A 1YK8A 4YV8A 3BPMA 3RVVA 1CJLA 3P5VA 1NLJA 1PPNA 5J94A 2E01A 1ZIVA 1KHQA 1AU3A 1W6FA 3IMAA 3KWBX 2FTDA 2NQAA 3GCBA 3V6CA 1U9XA 2DCBA 1AYVA 1CVZA 1KFUL 4Q8GA 2DJFB 4PP1A 1K3BB 1CSBB 1F2CA 4CZWA 2FQ9A 4W4UA 1AU4A 1PPPA 4MZOA 4P6EA 2G6DA 2HD5A 2O6XA 4XR7A 1W5RA 1NQCA 2ARYA 2FYEA 4QRXA 4QRGA 5CHVA 4CDFB 2Y5BA 1F29A 1KHPA 2AU1A 3IHPA 1PBHA 3H89A 3OISA 2P86A 4NV7A 4WA6A 2DCAA 3B79A 1Y08A 3IOQA 4MSXA 1EWLA 1U9VA 2IPPB 5F02A 4BPVA 3OF8A 1FH0A 4OEMA 1EWPA 2NQDB 1PADA 4KLBA 3N4CA 5CVMA 1ZCMA 8PCHA 2E03A 1PXVA 3QJ3A 4N8WA 2XU1A 1F2AA 1YK7A 2H7JA 7PCKA 2AUZA 3V6EA 3P5WA 3MHHA 2CB5A 3MORA 3OVZA 4YYSA 3AI8A 1EWOA 4FIPA 3RVXA 2YJCA 2BDZA 2OULA 2JQGR 3IV2A 3QT4A 4I05A 4CDEB 2DCDA 4DMYA 6PADA 1GLOA 3O1GA 2PBHA 1YT7A 1QXPA 1CS8A 1X9YA 2OZ2A 2AUXA 2G7YA 2P7UA 4BS5A 2OP3A 2GHUA 2HH5A 3PBHA 3HHIA 2Y6EA 1NB3A 1KXRA 1XKGA 2BDLA 1NPZA 3PW3A 3ERVA 3ZUAA 2JQFR 3KW9A 5JA7A 3WXFA 1AYUA 3S3RA 2FUDA 1MS6A 4QRVA 3K8UA 1EF7A 3BCNA 1BQIA 4YYRA 3TNXA 1PCIA 1EWMA 3HHAA 1BGOA 2YJ8A 5FPWA 4YYWA 1M6DA 4N4ZA 5K16A 3RVWA 1W4TA 1ME4A 2IBIA 1JQPA 2YJ2A 3F5VA 5A24A 2F1GA 3K9MA 3DF0A 4W5BA 1SNKA 2WBFX 2FRQA 3BOWA 1CPJA 1PPDA 3KSEA 3E1ZB 1MHWA 3IEJA 1O0EA 2CIOA 3I06A 2E02A 2DC7A 5CHTA 1ATKA 3U8EA 2FO5A 2HHNA 4XUIA 4BSQA 4W5CA 2B1NA 2PADA 2DC6A 4RY2A 4QBBA 2DCCA 2NQIA 4YYUA 4BS6A 3LXSA 1BP4A 3H6SA 1MEMA 4YVAA 3PNRA 2AYOA 2R9NA 3I3TA 4G54A 3OVXA 2DC9A 5EF4A 3P5UA 4PP2E 9PAPA 5PADA 4X6HA 3MTNA 4BQVA 4CDDB 2R9MA 4K7CA 2AYNA 5JH3A 1AU2A 4I04A 1THEA 4AXLA 3IUTA 4MZSA 4NV8A 2PNSA 1IWDA 1U5IA 2YJ9A 1F2BA 2AIMA 1YVBA 1E2TA 2VFBA 1U9QX 4B55A 1Y4HA 2ATOA 1AECA 3C9EA 3MHSA 1AIMA 2ACTA 3CH2X 4ZUXU 1PIPA 3BWKA 1VSNA 2PREA 2DZZA 4BGFA 4Q8HA 1ME3A 4YYVA 4FJCA 2HXZA 1DF0A 4OELA 3KWZA 1NL6A 3BPFA 2G8JA 2R9OA 5CVNB 2R9CA 4GUZA 3CH3X 3N3KA 1SP4B 3O0UA 1AYWA 3H8CA 1GCBA 3LFYA 3D6SA 4QH6A 1U9WA 1YALA 2XU3A 3P5XA 1S4VA 1TLOA 3CBJA 1DEUA 2FT2A 2NQGA 3S3QA 5CVOB 3M99A 1CV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB5 A;  3H8B A;  4P6G A;  4N79 A;  1QDQ A;  4HWY A;  3HWN A;  2VHF A;  1MDW A;  4PAD A;  1KFX L;  2G8E A;  1ITO A;  1PE6 A;  1CTE A;  1BY8 A;  4AXM A;  1QMY A;  3NHE A;  3BC3 A;  2E00 A;  3WXE A;  2AVW A;  4DMX A;  3WXG A;  1Q6K A;  1QOL A;  3PDF A;  1CQD A;  1VJV A;  2XU4 A;  2AS8 A;  1ICF A;  3HD3 A;  2YJB A;  1HUC B;  2R6N A;  1STF E;  1TL9 A;  3H7D A;  4FK5 A;  5EGW A;  2F7D A;  2C0Y A;  1PPO A;  2P0R A;  4CDC B;  2B1M A;  3KFQ A;  3USV A;  4YYQ A;  2DC8 A;  4I07 A;  4PI3 A;  2VHS A;  2DJG B;  1GMY A;  3CBK A;  2GFO A;  1A6R A;  1MEG A;  2XU5 A;  2DZY A;  3QSD A;  4X6J A;  4X6I A;  1AU0 A;  3N3G A;  2FRA A;  1POP A;  3K24 A;  3KX1 A;  1GEC E;  3KKU A;  1MIR A;  3F75 A;  1CB5 A;  1TU6 A;  2R9F A;  3OF9 A;  1YK8 A;  4YV8 A;  3BPM A;  3RVV A;  1CJL A;  3P5V A;  1NLJ A;  1PPN A;  5J94 A;  2E01 A;  1ZIV A;  1KHQ A;  1AU3 A;  3IMA A;  3KWB X;  2FTD A;  2NQA A;  3GCB A;  3V6C A;  1U9X A;  2DCB A;  1AYV A;  1CVZ A;  1KFU L;  4Q8G A;  2DJF B;  4PP1 A;  1K3B B;  1CSB B;  1F2C A;  4CZW A;  2FQ9 A;  4W4U A;  1AU4 A;  1PPP A;  4MZO A;  4P6E A;  2G6D A;  2HD5 A;  2O6X A;  4XR7 A;  1NQC A;  2ARY A;  2FYE A;  4QRX A;  4QRG A;  5CHV A;  4CDF B;  2Y5B A;  1F29 A;  1KHP A;  2AU1 A;  3IHP A;  1PBH A;  3H89 A;  3OIS A;  2P86 A;  4WA6 A;  2DCA A;  3B79 A;  1Y08 A;  3IOQ A;  4MSX A;  1EWL A;  1U9V A;  2IPP B;  5F02 A;  4BPV A;  3OF8 A;  1FH0 A;  4OEM A;  1EWP A;  2NQD B;  1PAD A;  4KLB A;  3N4C A;  5CVM A;  1ZCM A;  8PCH A;  2E03 A;  1PXV A;  3QJ3 A;  4N8W A;  2XU1 A;  1F2A A;  1YK7 A;  2H7J A;  7PCK A;  2AUZ A;  3V6E A;  3P5W A;  3MHH A;  2CB5 A;  3MOR A;  3OVZ A;  4YYS A;  3AI8 A;  1EWO A;  4FIP A;  3RVX A;  2YJC A;  2BDZ A;  2OUL A;  2JQG R;  3IV2 A;  3QT4 A;  4I05 A;  4CDE B;  2DCD A;  4DMY A;  6PAD A;  1GLO A;  3O1G A;  2PBH A;  1YT7 A;  1QXP A;  1CS8 A;  1X9Y A;  2OZ2 A;  2AUX A;  2G7Y A;  2P7U A;  4BS5 A;  2OP3 A;  2GHU A;  2HH5 A;  3PBH A;  3HHI A;  2Y6E A;  1NB3 A;  1KXR A;  1XKG A;  2BDL A;  1NPZ A;  3PW3 A;  3ERV A;  3ZUA A;  2JQF R;  3KW9 A;  5JA7 A;  3WXF A;  1AYU A;  3S3R A;  2FUD A;  1MS6 A;  4QRV A;  3K8U A;  1EF7 A;  3BCN A;  1BQI A;  4YYR A;  3TNX A;  1PCI A;  1EWM A;  3HHA A;  1BGO A;  2YJ8 A;  5FPW A;  4YYW A;  1M6D A;  4N4Z A;  5K16 A;  3RVW A;  1ME4 A;  2IBI A;  1JQP A;  2YJ2 A;  3F5V A;  5A24 A;  2F1G A;  3K9M A;  3DF0 A;  4W5B A;  1SNK A;  2WBF X;  2FRQ A;  3BOW A;  1CPJ A;  1PPD A;  3KSE A;  3E1Z B;  1MHW A;  3IEJ A;  1O0E A;  2CIO A;  3I06 A;  2E02 A;  2DC7 A;  5CHT A;  1ATK A;  3U8E A;  2FO5 A;  2HHN A;  4XUI A;  4BSQ A;  4W5C A;  2B1N A;  2PAD A;  2DC6 A;  4RY2 A;  4QBB A;  2DCC A;  2NQI A;  4YYU A;  4BS6 A;  3LXS A;  1BP4 A;  3H6S A;  1MEM A;  4YVA A;  3PNR A;  2AYO A;  2R9N A;  3I3T A;  4G54 A;  3OVX A;  2DC9 A;  5EF4 A;  3P5U A;  4PP2 E;  9PAP A;  5PAD A;  4X6H A;  3MTN A;  4BQV A;  4CDD B;  2R9M A;  4K7C A;  2AYN A;  5JH3 A;  1AU2 A;  4I04 A;  1THE A;  4AXL A;  3IUT A;  4MZS A;  2PNS A;  1IWD A;  1U5I A;  2YJ9 A;  1F2B A;  2AIM A;  1YVB A;  1U9Q X;  1Y4H A;  2ATO A;  1AEC A;  3C9E A;  3MHS A;  1AIM A;  2ACT A;  3CH2 X;  4ZUX U;  1PIP A;  3BWK A;  1VSN A;  2PRE A;  2DZZ A;  4Q8H A;  1ME3 A;  4YYV A;  4FJC A;  2HXZ A;  1DF0 A;  4OEL A;  3KWZ A;  1NL6 A;  3BPF A;  2G8J A;  2R9O A;  5CVN B;  2R9C A;  3CH3 X;  3N3K A;  1SP4 B;  3O0U A;  1AYW A;  3H8C A;  1GCB A;  3LFY A;  3D6S A;  4QH6 A;  1U9W A;  1YAL A;  2XU3 A;  3P5X A;  1S4V A;  1TLO A;  3CBJ A;  1DEU A;  2FT2 A;  2NQG A;  3S3Q A;  5CVO B;  3M99 A;  1CV8 A; 
#chains in the Genus database with same CATH topology
 3TRK A;  4OW0 A;  1NB5 A;  3H8B A;  4P6G A;  3O65 A;  4BOU A;  4N79 A;  1QDQ A;  4HWY A;  3HWN A;  2VHF A;  1MDW A;  4PAD A;  1KFX L;  2G8E A;  5EZQ A;  1ITO A;  1PE6 A;  1CTE A;  1BY8 A;  4AXM A;  1QMY A;  4BOZ A;  3NHE A;  3BC3 A;  2E00 A;  3WXE A;  2AVW A;  4DMX A;  3WXG A;  1Q6K A;  1QOL A;  3PDF A;  3BY4 A;  1CQD A;  1VJV A;  2XU4 A;  2AS8 A;  1ICF A;  3HD3 A;  2YJB A;  1HUC B;  2UZJ A;  2R6N A;  1STF E;  1TL9 A;  3H7D A;  4FK5 A;  5EGW A;  4OVZ A;  2F7D A;  4XZX A;  2C0Y A;  1PPO A;  2P0R A;  4CDC B;  2B1M A;  3KFQ A;  3USV A;  4YYQ A;  2DC8 A;  4I07 A;  4PI3 A;  2VHS A;  2DJG B;  3OQC A;  1GMY A;  3CBK A;  2GFO A;  1A6R A;  1MEG A;  2XU5 A;  2DZY A;  1UKF A;  3QSD A;  4X6J A;  4X6I A;  1AU0 A;  3N3G A;  2HWK A;  2FRA A;  1POP A;  3K24 A;  3KX1 A;  1GEC E;  3KKU A;  1MIR A;  3F75 A;  1CB5 A;  1TU6 A;  2R9F A;  3OF9 A;  1YK8 A;  3RNV A;  4YV8 A;  3BPM A;  3RVV A;  4D8I A;  1CJL A;  3P5V A;  1NLJ A;  1PPN A;  3PHU A;  2J7Q A;  5J94 A;  2E01 A;  1ZIV A;  1KHQ A;  1AU3 A;  2BTW A;  3IMA A;  2JTC A;  3KWB X;  2FTD A;  2NQA A;  3GCB A;  3V6C A;  1U9X A;  5JZE A;  2DCB A;  1AYV A;  1CVZ A;  1KFU L;  4Q8G A;  2DJF B;  4BOS A;  4PP1 A;  5E6J A;  1K3B B;  1CSB B;  1F2C A;  4CZW A;  2FQ9 A;  4W4U A;  4D8E A;  1AU4 A;  1PPP A;  4MZO A;  4P6E A;  2G6D A;  2HD5 A;  2O6X A;  4GUA A;  4XR7 A;  1NQC A;  2ARY A;  2FYE A;  4OVZ B;  4QRX A;  4QRG A;  5CHV A;  4CDF B;  2Y5B A;  1F29 A;  1KHP A;  1YZB A;  2AU1 A;  3IHP A;  1PBH A;  3H89 A;  3OIS A;  2P86 A;  3MJ5 A;  2DCA A;  4WA6 A;  3B79 A;  1Y08 A;  3IOQ A;  4MSX A;  1EWL A;  2Z84 A;  3E9S A;  1U9V A;  3BB7 A;  2IPP B;  5F02 A;  4BPV A;  3OF8 A;  1FH0 A;  4OEM A;  4BOP A;  1EWP A;  2NQD B;  1PAD A;  4KLB A;  3N4C A;  5CVM A;  1ZCM A;  8PCH A;  2E03 A;  1PXV A;  3QJ3 A;  4N8W A;  2XU1 A;  1F2A A;  3C0R A;  1YK7 A;  2H7J A;  7PCK A;  2AUZ A;  3V6E A;  3P5W A;  2BTW B;  3MHH A;  2CB5 A;  3MOR A;  3PRM A;  4RKX A;  3OVZ A;  4YYS A;  3W30 A;  3AI8 A;  1EWO A;  4FIP A;  3RVX A;  2YJC A;  2BDZ A;  2OUL A;  4REZ A;  2JQG R;  3IV2 A;  3QT4 A;  4I05 A;  4CDE B;  2DCD A;  4DMY A;  6PAD A;  1GLO A;  3O1G A;  2PBH A;  1YT7 A;  1QXP A;  2J7Q C;  1CS8 A;  1X9Y A;  2OZ2 A;  2AUX A;  2G7Y A;  2P7U A;  4BS5 A;  3PT2 A;  2OP3 A;  2GHU A;  2HH5 A;  4IUM A;  3PBH A;  4RNA A;  3HHI A;  2Y6E A;  1NB3 A;  3BBA A;  1KXR A;  1XKG A;  2BDL A;  1NPZ A;  3PW3 A;  3ERV A;  3ZUA A;  4MI7 A;  2JRI A;  2JQF R;  3KW9 A;  5JA7 A;  3WXF A;  1AYU A;  3S3R A;  2FUD A;  3PHX A;  1MS6 A;  4QRV A;  3K8U A;  1EF7 A;  3BCN A;  1BQI A;  2DOS A;  4YYR A;  3TNX A;  1PCI A;  1EWM A;  3HHA A;  1BGO A;  2YJ8 A;  5FPW A;  4YYW A;  1M6D A;  4N4Z A;  5KO3 A;  5K16 A;  3RVW A;  1ME4 A;  2IBI A;  1JQP A;  2YJ2 A;  3F5V A;  5A24 A;  2F1G A;  3K9M A;  3DF0 A;  4IP3 A;  4W5B A;  3TMP A;  3W31 A;  1SNK A;  2WBF X;  2FRQ A;  3BOW A;  3MP2 A;  1CPJ A;  1PPD A;  3KSE A;  3E1Z B;  1MHW A;  3IEJ A;  1O0E A;  2CIO A;  3I06 A;  3B21 A;  2E02 A;  2DC7 A;  3PRP A;  5CHT A;  4RF1 A;  1ATK A;  3U8E A;  2FO5 A;  2HHN A;  3IFU A;  4XUI A;  4BSQ A;  4W5C A;  2B1N A;  2PAD A;  2DC6 A;  4RY2 A;  3MTV A;  4QBB A;  2DCC A;  2BU3 A;  2NQI A;  4YYU A;  4BS6 A;  3LXS A;  1BP4 A;  3H6S A;  1MEM A;  4YVA A;  3PNR A;  2AYO A;  2R9N A;  3I3T A;  4G54 A;  4BOQ A;  3OVX A;  2DC9 A;  4MM3 B;  5EF4 A;  3P5U A;  4PP2 E;  9PAP A;  5PAD A;  4X6H A;  3MTN A;  4P16 A;  4BQV A;  4CDD B;  4A5U A;  2R9M A;  4K7C A;  4HXD B;  2AYN A;  5JH3 A;  1AU2 A;  4I04 A;  5EZS A;  4ZTB A;  1THE A;  4AXL A;  3IUT A;  4MZS A;  3ZNH A;  2PNS A;  1IWD A;  1U5I A;  2YJ9 A;  3PHW A;  1F2B A;  2AIM A;  1YVB A;  3PSE A;  1U9Q X;  4D8B A;  1Y4H A;  2ATO A;  1AEC A;  3C9E A;  3MHS A;  1DKI A;  1AIM A;  2ACT A;  3CH2 X;  4ZUX U;  1PIP A;  3BWK A;  1VSN A;  2PRE A;  2DZZ A;  4Q8H A;  1ME3 A;  4YYV A;  4FJC A;  2HXZ A;  1PVJ A;  2FE8 A;  1DF0 A;  4OEL A;  3KWZ A;  4RF0 A;  1NL6 A;  3BPF A;  2AGA A;  2G8J A;  2R9O A;  5CVN B;  2R9C A;  4M0W A;  3CH3 X;  3N3K A;  1SP4 B;  4R3D A;  3O0U A;  1AYW A;  3H8C A;  1GCB A;  3LFY A;  3D6S A;  4QH6 A;  1U9W A;  1YAL A;  2XU3 A;  3P5X A;  1S4V A;  1TLO A;  4WUR A;  3CBJ A;  4PT5 A;  1DEU A;  2FT2 A;  2NQG A;  3S3Q A;  5CVO B;  3M99 A;  1CV8 A; 
#chains in the Genus database with same CATH homology
 1NB5 A;  3H8B A;  4P6G A;  4N79 A;  1QDQ A;  4HWY A;  3HWN A;  2VHF A;  1MDW A;  4PAD A;  1KFX L;  2G8E A;  1ITO A;  1PE6 A;  3D9W A;  1CTE A;  2VFC A;  1BY8 A;  4AXM A;  1QMY A;  3NHE A;  3BC3 A;  2E00 A;  3WXE A;  2AVW A;  4DMX A;  3WXG A;  1Q6K A;  1QOL A;  3PDF A;  1CQD A;  1VJV A;  2XU4 A;  2AS8 A;  1ICF A;  3HD3 A;  2YJB A;  1HUC B;  3LTW A;  2R6N A;  1STF E;  1TL9 A;  3H7D A;  4FK5 A;  5EGW A;  2F7D A;  2C0Y A;  1PPO A;  2P0R A;  4CDC B;  2B1M A;  3KFQ A;  3USV A;  4YYQ A;  2DC8 A;  4I07 A;  4PI3 A;  2VHS A;  2DJG B;  1GMY A;  3CBK A;  2GFO A;  1A6R A;  1MEG A;  2XU5 A;  2DZY A;  3QSD A;  4X6J A;  4X6I A;  1AU0 A;  3N3G A;  2FRA A;  1POP A;  3K24 A;  3KX1 A;  1GX3 A;  1GEC E;  3KKU A;  2BSZ A;  1MIR A;  3F75 A;  4C5P A;  1CB5 A;  1TU6 A;  2R9F A;  3OF9 A;  1YK8 A;  4YV8 A;  3BPM A;  3RVV A;  1CJL A;  3P5V A;  1NLJ A;  1PPN A;  5J94 A;  2E01 A;  1ZIV A;  1KHQ A;  1AU3 A;  1W6F A;  3IMA A;  3KWB X;  2FTD A;  2NQA A;  3GCB A;  3V6C A;  1U9X A;  2DCB A;  1AYV A;  1CVZ A;  1KFU L;  4Q8G A;  2DJF B;  4PP1 A;  1K3B B;  1CSB B;  1F2C A;  4CZW A;  2FQ9 A;  4W4U A;  1AU4 A;  1PPP A;  4MZO A;  4P6E A;  2G6D A;  2HD5 A;  2O6X A;  4XR7 A;  1W5R A;  1NQC A;  2ARY A;  2FYE A;  4QRX A;  4QRG A;  5CHV A;  4CDF B;  2Y5B A;  1F29 A;  1KHP A;  2AU1 A;  3IHP A;  1PBH A;  3H89 A;  3OIS A;  2P86 A;  4NV7 A;  4WA6 A;  2DCA A;  3B79 A;  1Y08 A;  3IOQ A;  4MSX A;  1EWL A;  1U9V A;  2IPP B;  5F02 A;  4BPV A;  3OF8 A;  1FH0 A;  4OEM A;  1EWP A;  2NQD B;  1PAD A;  4KLB A;  3N4C A;  5CVM A;  1ZCM A;  8PCH A;  2E03 A;  1PXV A;  3QJ3 A;  4N8W A;  2XU1 A;  1F2A A;  1YK7 A;  2H7J A;  7PCK A;  2AUZ A;  3V6E A;  3P5W A;  3MHH A;  2CB5 A;  3MOR A;  3OVZ A;  4YYS A;  3AI8 A;  1EWO A;  4FIP A;  3RVX A;  2YJC A;  2BDZ A;  2OUL A;  2JQG R;  3IV2 A;  3QT4 A;  4I05 A;  4CDE B;  2DCD A;  4DMY A;  6PAD A;  1GLO A;  3O1G A;  2PBH A;  1YT7 A;  1QXP A;  1CS8 A;  1X9Y A;  2OZ2 A;  2AUX A;  2G7Y A;  2P7U A;  4BS5 A;  2OP3 A;  2GHU A;  2HH5 A;  3PBH A;  3HHI A;  2Y6E A;  1NB3 A;  1KXR A;  1XKG A;  2BDL A;  1NPZ A;  3PW3 A;  3ERV A;  3ZUA A;  2JQF R;  3KW9 A;  5JA7 A;  3WXF A;  1AYU A;  3S3R A;  2FUD A;  1MS6 A;  4QRV A;  3K8U A;  1EF7 A;  3BCN A;  1BQI A;  4YYR A;  3TNX A;  1PCI A;  1EWM A;  3HHA A;  1BGO A;  2YJ8 A;  5FPW A;  4YYW A;  1M6D A;  4N4Z A;  5K16 A;  3RVW A;  1W4T A;  1ME4 A;  2IBI A;  1JQP A;  2YJ2 A;  3F5V A;  5A24 A;  2F1G A;  3K9M A;  3DF0 A;  4W5B A;  1SNK A;  2WBF X;  2FRQ A;  3BOW A;  1CPJ A;  1PPD A;  3KSE A;  3E1Z B;  1MHW A;  3IEJ A;  1O0E A;  2CIO A;  3I06 A;  2E02 A;  2DC7 A;  5CHT A;  1ATK A;  3U8E A;  2FO5 A;  2HHN A;  4XUI A;  4BSQ A;  4W5C A;  2B1N A;  2PAD A;  2DC6 A;  4RY2 A;  4QBB A;  2DCC A;  2NQI A;  4YYU A;  4BS6 A;  3LXS A;  1BP4 A;  3H6S A;  1MEM A;  4YVA A;  3PNR A;  2AYO A;  2R9N A;  3I3T A;  4G54 A;  3OVX A;  2DC9 A;  5EF4 A;  3P5U A;  4PP2 E;  9PAP A;  5PAD A;  4X6H A;  3MTN A;  4BQV A;  4CDD B;  2R9M A;  4K7C A;  2AYN A;  5JH3 A;  1AU2 A;  4I04 A;  1THE A;  4AXL A;  3IUT A;  4MZS A;  4NV8 A;  2PNS A;  1IWD A;  1U5I A;  2YJ9 A;  1F2B A;  2AIM A;  1YVB A;  1E2T A;  2VFB A;  1U9Q X;  4B55 A;  1Y4H A;  2ATO A;  1AEC A;  3C9E A;  3MHS A;  1AIM A;  2ACT A;  3CH2 X;  4ZUX U;  1PIP A;  3BWK A;  1VSN A;  2PRE A;  2DZZ A;  4BGF A;  4Q8H A;  1ME3 A;  4YYV A;  4FJC A;  2HXZ A;  1DF0 A;  4OEL A;  3KWZ A;  1NL6 A;  3BPF A;  2G8J A;  2R9O A;  5CVN B;  2R9C A;  4GUZ A;  3CH3 X;  3N3K A;  1SP4 B;  3O0U A;  1AYW A;  3H8C A;  1GCB A;  3LFY A;  3D6S A;  4QH6 A;  1U9W A;  1YAL A;  2XU3 A;  3P5X A;  1S4V A;  1TLO A;  3CBJ A;  1DEU A;  2FT2 A;  2NQG A;  3S3Q A;  5CVO B;  3M99 A;  1CV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...