3O0UA

Cathepsin k covalently bound to a cyano-pyrimidine inhibitor with improved selectivity over herg
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3o0uA00
1GECE 2XU5A 1BGOA 5EGWA 3KKUA 1AU0A 3BPFA 4P6GA 4BS5A 2FQ9A 4PI3A 3C9EA 1PIPA 2R9FA 3BC3A 3N3KA 2DC9A 2ARYA 3KX1A 4FK5A 4Q8HA 2G7YA 2HH5A 1YK8A 8PCHA 3BWKA 1EF7A 2OZ2A 2P0RA 2DZZA 2AS8A 4YYWA 2R9MA 1YALA 6PADA 1U9VA 1CTEA 5EF4A 2BDLA 2G8JA 9PAPA 4MSXA 2DJGB 2AVWA 1PCIA 4I04A 2DCAA 4YYVA 4YYUA 3KFQA 1PPPA 1U9XA 5F02A 3P5XA 2GFOA 3O1GA 4N79A 1QDQA 1AECA 4DMXA 5J94A 2NQAA 1AYVA 1ME3A 3IOQA 1NLJA 2FRQA 1X9YA 2E03A 3V6CA 4YYQA 3HHAA 4QRGA 3MHHA 2HHNA 3GCBA 3OISA 4K7CA 2AYNA 2PBHA 2B1MA 2OP3A 2Y6EA 2DCCA 1KFXL 4X6JA 3WXGA 2YJ9A 2YJBA 3WXFA 4N4ZA 3WXEA 1ZCMA 3QJ3A 4BS6A 5CVMA 1U9WA 1JQPA 3OF8A 4MZSA 3TNXA 2CIOA 4WA6A 5CVNB 4P6EA 3E1ZB 3PDFA 1IWDA 4CDEB 1XKGA 3P5WA 1PPDA 1QXPA 1KHQA 4QH6A 2E02A 1F29A 2HXZA 3HWNA 1NB3A 2FO5A 3RVXA 4PADA 4XUIA 3K9MA 3CBKA 3AI8A 3N3GA 1CSBB 2FYEA 3MORA 5JH3A 2DC8A 2P7UA 3K8UA 1CB5A 1THEA 3PW3A 1ATKA 4G54A 1MDWA 1K3BB 2FUDA 2BDZA 1GMYA 5CHVA 3IV2A 1U9QX 3CH3X 2VHFA 4QRXA 1YT7A 4XR7A 1AU4A 3OF9A 2AUXA 4BQVA 3IEJA 2DJFB 5CHTA 1KFUL 1PPNA 4W5BA 5PADA 2DC6A 3S3RA 1S4VA 1QMYA 2R9CA 1Y08A 2G6DA 1GCBA 4I07A 4FIPA 1M6DA 3LXSA 2DC7A 1Q6KA 3KSEA 4YYSA 7PCKA 4CDCB 2O6XA 3IMAA 3F5VA 2DCDA 3D6SA 5K16A 1U5IA 1MIRA 2CB5A 2ACTA 2FRAA 1AU2A 2E01A 1AIMA 1DF0A 1SP4B 2R9OA 3HHIA 2XU1A 2YJ8A 1ICFA 1GLOA 3PNRA 1TL9A 3KW9A 2PADA 4AXMA 1NB5A 1F2BA 3NHEA 2YJ2A 4W5CA 4ZUXU 1EWMA 2R9NA 2ATOA 1EWOA 4FJCA 2AYOA 1CS8A 2R6NA 1POPA 1MEGA 4QBBA 1AU3A 2DCBA 1VSNA 3H7DA 3F75A 2XU3A 1TU6A 3I06A 1MEMA 2IBIA 2NQGA 1F2CA 1ME4A 3KWBX 2FT2A 3OVXA 2VHSA 2H7JA 2FTDA 1PADA 1AYUA 1CV8A 3USVA 3K24A 2AU1A 4HWYA 2G8EA 3B79A 3U8EA 2C0YA 3ZUAA 3MTNA 2P86A 2OULA 4PP2E 4N8WA 2B1NA 4PP1A 1TLOA 2F7DA 2XU4A 1PXVA 1NPZA 3DF0A 3H8CA 3P5VA 2Y5BA 1KXRA 1BY8A 1CJLA 1MS6A 3H8BA 3QT4A 3RVVA 3O0UA 1F2AA 1NL6A 4CDDB 3LFYA 2E00A 1ZIVA 5CVOB 2NQDB 3IUTA 3M99A 3H89A 3BCNA 2AIMA 4W4UA 1ITOA 2IPPB 4QRVA 4I05A 1A6RA 4CZWA 3CH2X 3H6SA 2NQIA 4DMYA 1AYWA 1DEUA 4OELA 1Y4HA 1EWLA 3S3QA 3QSDA 1O0EA 3BOWA 4KLBA 3MHSA 4YVAA 2F1GA 1VJVA 1EWPA 5JA7A 5A24A 3V6EA 4OEMA 2JQFR 2PNSA 1CPJA 1QOLA 3CBJA 1YVBA 1NQCA 1MHWA 1PPOA 3RVWA 3P5UA 1STFE 4YYRA 2YJCA 1CVZA 3I3TA 1PBHA 1KHPA 4AXLA 3IHPA 1YK7A 3OVZA 5FPWA 3BPMA 4X6IA 2GHUA 1BP4A 2PREA 4CDFB 1CQDA 3ERVA 4RY2A 4BSQA 1PE6A 4Q8GA 1HUCB 3N4CA 1SNKA 1FH0A 4X6HA 2DZYA 2WBFX 3KWZA 4YV8A 2JQGR 2HD5A 2AUZA 1BQIA 3HD3A 4BPVA 3PBHA 4MZOA
chains in the Genus database with same CATH superfamily
1GECE 2XU5A 1BGOA 5EGWA 3KKUA 1AU0A 3BPFA 4P6GA 4BS5A 2FQ9A 4PI3A 4HXDB 3C9EA 1PIPA 2R9FA 3BC3A 3N3KA 2DC9A 2ARYA 3KX1A 4FK5A 4Q8HA 2G7YA 2HH5A 1YK8A 8PCHA 3BWKA 1EF7A 2OZ2A 3PRMA 2HWKA 2JTCA 3PT2A 2P0RA 3C0RA 2DZZA 2AS8A 4YYWA 2R9MA 1YALA 6PADA 1U9VA 1CTEA 5EF4A 2BDLA 2G8JA 9PAPA 4MSXA 2DJGB 2AVWA 4BOSA 1PCIA 4MM3B 4I04A 2DCAA 4YYVA 4YYUA 2AGAA 3KFQA 1PPPA 1U9XA 5F02A 3P5XA 2GFOA 3O1GA 4N79A 1QDQA 1AECA 4DMXA 5J94A 2NQAA 1AYVA 1ME3A 3IOQA 1NLJA 2FRQA 1X9YA 2BU3A 2E03A 3V6CA 4YYQA 3HHAA 3O65A 4QRGA 3MHHA 2HHNA 3GCBA 3E9SA 3OISA 2UZJA 4K7CA 4D8IA 2AYNA 2PBHA 2B1MA 2OP3A 2Y6EA 2DCCA 1KFXL 4X6JA 3WXGA 2YJ9A 2YJBA 3WXFA 4N4ZA 4BOQA 3WXEA 1ZCMA 3QJ3A 4BS6A 5CVMA 1U9WA 1JQPA 3OF8A 4MZSA 3TNXA 1PVJA 2CIOA 2J7QA 4WA6A 5CVNB 4P6EA 3E1ZB 3BY4A 3PDFA 1IWDA 4CDEB 1XKGA 3P5WA 1PPDA 1QXPA 1KHQA 4QH6A 2E02A 1F29A 2HXZA 3HWNA 3TRKA 1NB3A 4RKXA 2Z84A 2FO5A 3RVXA 4PADA 4XUIA 3K9MA 3CBKA 3AI8A 3MJ5A 3N3GA 1CSBB 2FYEA 3MORA 5JH3A 2DC8A 2P7UA 3K8UA 4R3DA 1CB5A 4XZXA 1THEA 2BTWA 5JZEA 4D8BA 5KO3A 3PW3A 3IFUA 5EZQA 1ATKA 4G54A 1MDWA 1K3BB 2FUDA 2BDZA 1GMYA 5CHVA 4D8EA 3IV2A 1U9QX 3CH3X 4BOZA 2VHFA 4QRXA 1YT7A 4XR7A 1AU4A 3OF9A 2AUXA 4BQVA 3IEJA 4RNAA 2DJFB 5CHTA 1KFUL 1PPNA 4W5BA 5PADA 2DC6A 3S3RA 1S4VA 1QMYA 2R9CA 3PHWA 1Y08A 3BBAA 2G6DA 1GCBA 4I07A 4FIPA 1M6DA 3LXSA 4A5UA 2DC7A 1Q6KA 3KSEA 4ZTBA 4YYSA 7PCKA 4CDCB 2O6XA 3IMAA 3F5VA 2DCDA 3D6SA 4RF1A 5K16A 1U5IA 1MIRA 2CB5A 2ACTA 2FRAA 4MI7A 1AU2A 2E01A 1AIMA 1DF0A 1SP4B 2R9OA 3HHIA 2XU1A 2YJ8A 1ICFA 1GLOA 3PNRA 1TL9A 3KW9A 2PADA 4AXMA 1UKFA 1NB5A 1DKIA 4OVZB 1F2BA 3NHEA 2YJ2A 4W5CA 4ZUXU 1EWMA 2R9NA 2ATOA 1EWOA 4FJCA 2AYOA 1CS8A 2R6NA 1POPA 1MEGA 4QBBA 1AU3A 2DCBA 3MTVA 3MP2A 1VSNA 3H7DA 3F75A 3PRPA 2XU3A 1TU6A 3I06A 3PHUA 1MEMA 2IBIA 2NQGA 1F2CA 1ME4A 1YZBA 3KWBX 2FT2A 3OVXA 2VHSA 2H7JA 2FTDA 1PADA 1AYUA 1CV8A 3USVA 3K24A 2AU1A 4HWYA 2G8EA 3B79A 4WURA 3TMPA 3U8EA 2C0YA 3ZUAA 4RF0A 3MTNA 2P86A 2OULA 4PP2E 2JRIA 3BB7A 2B1NA 4N8WA 4PP1A 1TLOA 2BTWB 2F7DA 4IUMA 3PSEA 2XU4A 1PXVA 1NPZA 3DF0A 3H8CA 3P5VA 2Y5BA 1KXRA 1BY8A 1CJLA 1MS6A 3H8BA 3QT4A 3RVVA 3W30A 3B21A 4IP3A 3O0UA 1F2AA 1NL6A 4CDDB 3LFYA 2E00A 1ZIVA 2DOSA 5CVOB 2NQDB 3IUTA 3M99A 3H89A 3BCNA 2AIMA 4W4UA 1ITOA 2IPPB 4QRVA 4I05A 1A6RA 4CZWA 3CH2X 3H6SA 2NQIA 3OQCA 1AYWA 1DEUA 3ZNHA 4OELA 4DMYA 1Y4HA 1EWLA 4BOUA 3S3QA 3QSDA 1O0EA 3BOWA 4KLBA 3MHSA 4YVAA 2F1GA 1VJVA 1EWPA 5JA7A 5A24A 3V6EA 4OEMA 2JQFR 2PNSA 2J7QC 4OW0A 1CPJA 1QOLA 3CBJA 5E6JA 1YVBA 1NQCA 1MHWA 1PPOA 3W31A 3RVWA 3P5UA 1STFE 4YYRA 3PHXA 2YJCA 4GUAA 4PT5A 4P16A 1CVZA 3I3TA 4M0WA 1PBHA 1KHPA 4AXLA 4REZA 3IHPA 1YK7A 3OVZA 5FPWA 3BPMA 4OVZA 4X6IA 2GHUA 1BP4A 2PREA 4CDFB 2FE8A 1CQDA 3ERVA 4RY2A 4BSQA 1PE6A 4Q8GA 4BOPA 1HUCB 3N4CA 1SNKA 1FH0A 4X6HA 2DZYA 2WBFX 3RNVA 3KWZA 4YV8A 2JQGR 2HD5A 2AUZA 1BQIA 3HD3A 4BPVA 3PBHA 5EZSA 4MZOA
chains in the Genus database with same CATH topology
1GECE 2XU5A 1BGOA 5EGWA 3KKUA 1AU0A 3BPFA 4P6GA 4BS5A 2FQ9A 4PI3A 3C9EA 1PIPA 2VFBA 2R9FA 3BC3A 3N3KA 2DC9A 2ARYA 3KX1A 4FK5A 4Q8HA 2G7YA 2HH5A 1YK8A 8PCHA 3BWKA 1EF7A 2OZ2A 2P0RA 2DZZA 2AS8A 4YYWA 2R9MA 1YALA 6PADA 1U9VA 1W4TA 1CTEA 5EF4A 2BDLA 2G8JA 9PAPA 4MSXA 2DJGB 2AVWA 1PCIA 4I04A 2DCAA 4YYVA 4YYUA 3KFQA 3D9WA 1PPPA 1U9XA 5F02A 3P5XA 2GFOA 3O1GA 4N79A 1QDQA 1AECA 4DMXA 5J94A 2NQAA 1AYVA 1ME3A 3IOQA 1NLJA 2FRQA 1X9YA 2E03A 3V6CA 4YYQA 3HHAA 4QRGA 3MHHA 2HHNA 3GCBA 3OISA 4K7CA 2AYNA 2PBHA 2B1MA 2OP3A 2Y6EA 2DCCA 1KFXL 4X6JA 3WXGA 2YJ9A 2YJBA 3WXFA 4N4ZA 3WXEA 1ZCMA 3QJ3A 4BS6A 5CVMA 1U9WA 1JQPA 3OF8A 4MZSA 3TNXA 2CIOA 4WA6A 5CVNB 4P6EA 1W5RA 3E1ZB 3PDFA 1IWDA 4CDEB 4B55A 1XKGA 3P5WA 1PPDA 1QXPA 1KHQA 4QH6A 2E02A 1F29A 2HXZA 3HWNA 1NB3A 2FO5A 3RVXA 4PADA 4XUIA 3K9MA 3CBKA 3AI8A 3N3GA 1CSBB 2FYEA 3MORA 5JH3A 2DC8A 2P7UA 3K8UA 1CB5A 1THEA 3PW3A 1ATKA 4G54A 1MDWA 1K3BB 2FUDA 2BDZA 1GMYA 5CHVA 3IV2A 1U9QX 3CH3X 2VHFA 4QRXA 1YT7A 4XR7A 1AU4A 3OF9A 2AUXA 4BQVA 3IEJA 2DJFB 5CHTA 1KFUL 1PPNA 4W5BA 5PADA 2DC6A 3S3RA 1S4VA 1QMYA 2R9CA 1Y08A 2G6DA 1GCBA 4I07A 4FIPA 1M6DA 3LXSA 2DC7A 3LTWA 1Q6KA 3KSEA 4YYSA 7PCKA 4CDCB 2O6XA 3IMAA 3F5VA 2DCDA 3D6SA 5K16A 1U5IA 1MIRA 2CB5A 2ACTA 2FRAA 1AU2A 2E01A 1AIMA 1DF0A 1SP4B 2R9OA 3HHIA 2XU1A 2YJ8A 1ICFA 1GLOA 2BSZA 3PNRA 1TL9A 3KW9A 2PADA 4AXMA 1NB5A 1F2BA 3NHEA 2YJ2A 4W5CA 4ZUXU 1EWMA 2R9NA 2ATOA 1EWOA 4FJCA 2AYOA 1CS8A 2R6NA 1POPA 1MEGA 4QBBA 1AU3A 2DCBA 1VSNA 3H7DA 3F75A 2XU3A 1TU6A 3I06A 1MEMA 2IBIA 2NQGA 1F2CA 1ME4A 3KWBX 2FT2A 3OVXA 1E2TA 2VHSA 2H7JA 2FTDA 1PADA 1AYUA 1CV8A 3USVA 3K24A 2AU1A 4HWYA 2G8EA 3B79A 3U8EA 2C0YA 3ZUAA 3MTNA 2P86A 2OULA 4PP2E 4N8WA 2B1NA 4PP1A 1TLOA 2F7DA 2XU4A 1PXVA 1NPZA 3DF0A 3H8CA 3P5VA 1W6FA 2Y5BA 1KXRA 1BY8A 1CJLA 1MS6A 3H8BA 3QT4A 3RVVA 3O0UA 1F2AA 1NL6A 4CDDB 3LFYA 2VFCA 2E00A 1ZIVA 5CVOB 2NQDB 3IUTA 3M99A 3H89A 3BCNA 2AIMA 4W4UA 1ITOA 4GUZA 2IPPB 4QRVA 4I05A 1A6RA 4CZWA 3CH2X 3H6SA 2NQIA 4DMYA 1AYWA 1DEUA 4OELA 1Y4HA 4C5PA 1EWLA 3S3QA 3QSDA 1O0EA 3BOWA 4KLBA 3MHSA 4YVAA 2F1GA 1VJVA 1EWPA 5JA7A 5A24A 3V6EA 4OEMA 2JQFR 2PNSA 1CPJA 4NV8A 1QOLA 3CBJA 1YVBA 1NQCA 1MHWA 1PPOA 3RVWA 3P5UA 1STFE 4YYRA 2YJCA 1CVZA 3I3TA 1PBHA 1KHPA 4AXLA 3IHPA 1YK7A 3OVZA 5FPWA 3BPMA 4X6IA 2GHUA 1BP4A 2PREA 4CDFB 1CQDA 3ERVA 4RY2A 4BSQA 1PE6A 4NV7A 4Q8GA 1HUCB 3N4CA 1SNKA 4BGFA 1FH0A 4X6HA 2DZYA 2WBFX 3KWZA 4YV8A 2JQGR 2HD5A 2AUZA 1BQIA 3HD3A 4BPVA 3PBHA 4MZOA 1GX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GEC E;  2XU5 A;  1BGO A;  5EGW A;  3KKU A;  1AU0 A;  3BPF A;  4P6G A;  4BS5 A;  2FQ9 A;  4PI3 A;  3C9E A;  1PIP A;  2R9F A;  3BC3 A;  3N3K A;  2DC9 A;  2ARY A;  3KX1 A;  4FK5 A;  4Q8H A;  2G7Y A;  2HH5 A;  1YK8 A;  8PCH A;  3BWK A;  1EF7 A;  2OZ2 A;  2P0R A;  2DZZ A;  2AS8 A;  4YYW A;  2R9M A;  1YAL A;  6PAD A;  1U9V A;  1CTE A;  5EF4 A;  2BDL A;  2G8J A;  9PAP A;  4MSX A;  2DJG B;  2AVW A;  1PCI A;  4I04 A;  2DCA A;  4YYV A;  4YYU A;  3KFQ A;  1PPP A;  1U9X A;  5F02 A;  3P5X A;  2GFO A;  3O1G A;  4N79 A;  1QDQ A;  1AEC A;  4DMX A;  5J94 A;  2NQA A;  1AYV A;  1ME3 A;  3IOQ A;  1NLJ A;  2FRQ A;  1X9Y A;  2E03 A;  3V6C A;  4YYQ A;  3HHA A;  4QRG A;  3MHH A;  2HHN A;  3GCB A;  3OIS A;  4K7C A;  2AYN A;  2PBH A;  2B1M A;  2OP3 A;  2Y6E A;  2DCC A;  1KFX L;  4X6J A;  3WXG A;  2YJ9 A;  2YJB A;  3WXF A;  4N4Z A;  3WXE A;  1ZCM A;  3QJ3 A;  4BS6 A;  5CVM A;  1U9W A;  1JQP A;  3OF8 A;  4MZS A;  3TNX A;  2CIO A;  4WA6 A;  5CVN B;  4P6E A;  3E1Z B;  3PDF A;  1IWD A;  4CDE B;  1XKG A;  3P5W A;  1PPD A;  1QXP A;  1KHQ A;  4QH6 A;  2E02 A;  1F29 A;  2HXZ A;  3HWN A;  1NB3 A;  2FO5 A;  3RVX A;  4PAD A;  4XUI A;  3K9M A;  3CBK A;  3AI8 A;  3N3G A;  1CSB B;  2FYE A;  3MOR A;  5JH3 A;  2DC8 A;  2P7U A;  3K8U A;  1CB5 A;  1THE A;  3PW3 A;  1ATK A;  4G54 A;  1MDW A;  1K3B B;  2FUD A;  2BDZ A;  1GMY A;  5CHV A;  3IV2 A;  1U9Q X;  3CH3 X;  2VHF A;  4QRX A;  1YT7 A;  4XR7 A;  1AU4 A;  3OF9 A;  2AUX A;  4BQV A;  3IEJ A;  2DJF B;  5CHT A;  1KFU L;  1PPN A;  4W5B A;  5PAD A;  2DC6 A;  3S3R A;  1S4V A;  1QMY A;  2R9C A;  1Y08 A;  2G6D A;  1GCB A;  4I07 A;  4FIP A;  1M6D A;  3LXS A;  2DC7 A;  1Q6K A;  3KSE A;  4YYS A;  7PCK A;  4CDC B;  2O6X A;  3IMA A;  3F5V A;  2DCD A;  3D6S A;  5K16 A;  1U5I A;  1MIR A;  2CB5 A;  2ACT A;  2FRA A;  1AU2 A;  2E01 A;  1AIM A;  1DF0 A;  1SP4 B;  2R9O A;  3HHI A;  2XU1 A;  2YJ8 A;  1ICF A;  1GLO A;  3PNR A;  1TL9 A;  3KW9 A;  2PAD A;  4AXM A;  1NB5 A;  1F2B A;  3NHE A;  2YJ2 A;  4W5C A;  4ZUX U;  1EWM A;  2R9N A;  2ATO A;  1EWO A;  4FJC A;  2AYO A;  1CS8 A;  2R6N A;  1POP A;  1MEG A;  4QBB A;  1AU3 A;  2DCB A;  1VSN A;  3H7D A;  3F75 A;  2XU3 A;  1TU6 A;  3I06 A;  1MEM A;  2IBI A;  2NQG A;  1F2C A;  1ME4 A;  3KWB X;  2FT2 A;  3OVX A;  2VHS A;  2H7J A;  2FTD A;  1PAD A;  1AYU A;  1CV8 A;  3USV A;  3K24 A;  2AU1 A;  4HWY A;  2G8E A;  3B79 A;  3U8E A;  2C0Y A;  3ZUA A;  3MTN A;  2P86 A;  2OUL A;  4PP2 E;  4N8W A;  2B1N A;  4PP1 A;  1TLO A;  2F7D A;  2XU4 A;  1PXV A;  1NPZ A;  3DF0 A;  3H8C A;  3P5V A;  2Y5B A;  1KXR A;  1BY8 A;  1CJL A;  1MS6 A;  3H8B A;  3QT4 A;  3RVV A;  3O0U A;  1F2A A;  1NL6 A;  4CDD B;  3LFY A;  2E00 A;  1ZIV A;  5CVO B;  2NQD B;  3IUT A;  3M99 A;  3H89 A;  3BCN A;  2AIM A;  4W4U A;  1ITO A;  2IPP B;  4QRV A;  4I05 A;  1A6R A;  4CZW A;  3CH2 X;  3H6S A;  2NQI A;  4DMY A;  1AYW A;  1DEU A;  4OEL A;  1Y4H A;  1EWL A;  3S3Q A;  3QSD A;  1O0E A;  3BOW A;  4KLB A;  3MHS A;  4YVA A;  2F1G A;  1VJV A;  1EWP A;  5JA7 A;  5A24 A;  3V6E A;  4OEM A;  2JQF R;  2PNS A;  1CPJ A;  1QOL A;  3CBJ A;  1YVB A;  1NQC A;  1MHW A;  1PPO A;  3RVW A;  3P5U A;  1STF E;  4YYR A;  2YJC A;  1CVZ A;  3I3T A;  1PBH A;  1KHP A;  4AXL A;  3IHP A;  1YK7 A;  3OVZ A;  5FPW A;  3BPM A;  4X6I A;  2GHU A;  1BP4 A;  2PRE A;  4CDF B;  1CQD A;  3ERV A;  4RY2 A;  4BSQ A;  1PE6 A;  4Q8G A;  1HUC B;  3N4C A;  1SNK A;  1FH0 A;  4X6H A;  2DZY A;  2WBF X;  3KWZ A;  4YV8 A;  2JQG R;  2HD5 A;  2AUZ A;  1BQI A;  3HD3 A;  4BPV A;  3PBH A;  4MZO A; 
#chains in the Genus database with same CATH topology
 1GEC E;  2XU5 A;  1BGO A;  5EGW A;  3KKU A;  1AU0 A;  3BPF A;  4P6G A;  4BS5 A;  2FQ9 A;  4PI3 A;  4HXD B;  3C9E A;  1PIP A;  2R9F A;  3BC3 A;  3N3K A;  2DC9 A;  2ARY A;  3KX1 A;  4FK5 A;  4Q8H A;  2G7Y A;  2HH5 A;  1YK8 A;  8PCH A;  3BWK A;  1EF7 A;  2OZ2 A;  3PRM A;  2HWK A;  2JTC A;  3PT2 A;  2P0R A;  3C0R A;  2DZZ A;  2AS8 A;  4YYW A;  2R9M A;  1YAL A;  6PAD A;  1U9V A;  1CTE A;  5EF4 A;  2BDL A;  2G8J A;  9PAP A;  4MSX A;  2DJG B;  2AVW A;  4BOS A;  1PCI A;  4MM3 B;  4I04 A;  2DCA A;  4YYV A;  4YYU A;  2AGA A;  3KFQ A;  1PPP A;  1U9X A;  5F02 A;  3P5X A;  2GFO A;  3O1G A;  4N79 A;  1QDQ A;  1AEC A;  4DMX A;  5J94 A;  2NQA A;  1AYV A;  1ME3 A;  3IOQ A;  1NLJ A;  2FRQ A;  1X9Y A;  2BU3 A;  2E03 A;  3V6C A;  4YYQ A;  3HHA A;  3O65 A;  4QRG A;  3MHH A;  2HHN A;  3GCB A;  3E9S A;  3OIS A;  2UZJ A;  4K7C A;  4D8I A;  2AYN A;  2PBH A;  2B1M A;  2OP3 A;  2Y6E A;  2DCC A;  1KFX L;  4X6J A;  3WXG A;  2YJ9 A;  2YJB A;  3WXF A;  4N4Z A;  4BOQ A;  3WXE A;  1ZCM A;  3QJ3 A;  4BS6 A;  5CVM A;  1U9W A;  1JQP A;  3OF8 A;  4MZS A;  3TNX A;  1PVJ A;  2CIO A;  2J7Q A;  4WA6 A;  5CVN B;  4P6E A;  3E1Z B;  3BY4 A;  3PDF A;  1IWD A;  4CDE B;  1XKG A;  3P5W A;  1PPD A;  1QXP A;  1KHQ A;  4QH6 A;  2E02 A;  1F29 A;  2HXZ A;  3HWN A;  3TRK A;  1NB3 A;  4RKX A;  2Z84 A;  2FO5 A;  3RVX A;  4PAD A;  4XUI A;  3K9M A;  3CBK A;  3AI8 A;  3MJ5 A;  3N3G A;  1CSB B;  2FYE A;  3MOR A;  5JH3 A;  2DC8 A;  2P7U A;  3K8U A;  4R3D A;  1CB5 A;  4XZX A;  1THE A;  2BTW A;  5JZE A;  4D8B A;  5KO3 A;  3PW3 A;  3IFU A;  5EZQ A;  1ATK A;  4G54 A;  1MDW A;  1K3B B;  2FUD A;  2BDZ A;  1GMY A;  5CHV A;  4D8E A;  3IV2 A;  1U9Q X;  3CH3 X;  4BOZ A;  2VHF A;  4QRX A;  1YT7 A;  4XR7 A;  1AU4 A;  3OF9 A;  2AUX A;  4BQV A;  3IEJ A;  4RNA A;  2DJF B;  5CHT A;  1KFU L;  1PPN A;  4W5B A;  5PAD A;  2DC6 A;  3S3R A;  1S4V A;  1QMY A;  2R9C A;  3PHW A;  1Y08 A;  3BBA A;  2G6D A;  1GCB A;  4I07 A;  4FIP A;  1M6D A;  3LXS A;  4A5U A;  2DC7 A;  1Q6K A;  3KSE A;  4ZTB A;  4YYS A;  7PCK A;  4CDC B;  2O6X A;  3IMA A;  3F5V A;  2DCD A;  3D6S A;  4RF1 A;  5K16 A;  1U5I A;  1MIR A;  2CB5 A;  2ACT A;  2FRA A;  4MI7 A;  1AU2 A;  2E01 A;  1AIM A;  1DF0 A;  1SP4 B;  2R9O A;  3HHI A;  2XU1 A;  2YJ8 A;  1ICF A;  1GLO A;  3PNR A;  1TL9 A;  3KW9 A;  2PAD A;  4AXM A;  1UKF A;  1NB5 A;  1DKI A;  4OVZ B;  1F2B A;  3NHE A;  2YJ2 A;  4W5C A;  4ZUX U;  1EWM A;  2R9N A;  2ATO A;  1EWO A;  4FJC A;  2AYO A;  1CS8 A;  2R6N A;  1POP A;  1MEG A;  4QBB A;  1AU3 A;  2DCB A;  3MTV A;  3MP2 A;  1VSN A;  3H7D A;  3F75 A;  3PRP A;  2XU3 A;  1TU6 A;  3I06 A;  3PHU A;  1MEM A;  2IBI A;  2NQG A;  1F2C A;  1ME4 A;  1YZB A;  3KWB X;  2FT2 A;  3OVX A;  2VHS A;  2H7J A;  2FTD A;  1PAD A;  1AYU A;  1CV8 A;  3USV A;  3K24 A;  2AU1 A;  4HWY A;  2G8E A;  3B79 A;  4WUR A;  3TMP A;  3U8E A;  2C0Y A;  3ZUA A;  4RF0 A;  3MTN A;  2P86 A;  2OUL A;  4PP2 E;  2JRI A;  3BB7 A;  2B1N A;  4N8W A;  4PP1 A;  1TLO A;  2BTW B;  2F7D A;  4IUM A;  3PSE A;  2XU4 A;  1PXV A;  1NPZ A;  3DF0 A;  3H8C A;  3P5V A;  2Y5B A;  1KXR A;  1BY8 A;  1CJL A;  1MS6 A;  3H8B A;  3QT4 A;  3RVV A;  3W30 A;  3B21 A;  4IP3 A;  3O0U A;  1F2A A;  1NL6 A;  4CDD B;  3LFY A;  2E00 A;  1ZIV A;  2DOS A;  5CVO B;  2NQD B;  3IUT A;  3M99 A;  3H89 A;  3BCN A;  2AIM A;  4W4U A;  1ITO A;  2IPP B;  4QRV A;  4I05 A;  1A6R A;  4CZW A;  3CH2 X;  3H6S A;  2NQI A;  3OQC A;  1AYW A;  1DEU A;  3ZNH A;  4OEL A;  4DMY A;  1Y4H A;  1EWL A;  4BOU A;  3S3Q A;  3QSD A;  1O0E A;  3BOW A;  4KLB A;  3MHS A;  4YVA A;  2F1G A;  1VJV A;  1EWP A;  5JA7 A;  5A24 A;  3V6E A;  4OEM A;  2JQF R;  2PNS A;  2J7Q C;  4OW0 A;  1CPJ A;  1QOL A;  3CBJ A;  5E6J A;  1YVB A;  1NQC A;  1MHW A;  1PPO A;  3W31 A;  3RVW A;  3P5U A;  1STF E;  4YYR A;  3PHX A;  2YJC A;  4GUA A;  4PT5 A;  4P16 A;  1CVZ A;  3I3T A;  4M0W A;  1PBH A;  1KHP A;  4AXL A;  4REZ A;  3IHP A;  1YK7 A;  3OVZ A;  5FPW A;  3BPM A;  4OVZ A;  4X6I A;  2GHU A;  1BP4 A;  2PRE A;  4CDF B;  2FE8 A;  1CQD A;  3ERV A;  4RY2 A;  4BSQ A;  1PE6 A;  4Q8G A;  4BOP A;  1HUC B;  3N4C A;  1SNK A;  1FH0 A;  4X6H A;  2DZY A;  2WBF X;  3RNV A;  3KWZ A;  4YV8 A;  2JQG R;  2HD5 A;  2AUZ A;  1BQI A;  3HD3 A;  4BPV A;  3PBH A;  5EZS A;  4MZO A; 
#chains in the Genus database with same CATH homology
 1GEC E;  2XU5 A;  1BGO A;  5EGW A;  3KKU A;  1AU0 A;  3BPF A;  4P6G A;  4BS5 A;  2FQ9 A;  4PI3 A;  3C9E A;  1PIP A;  2VFB A;  2R9F A;  3BC3 A;  3N3K A;  2DC9 A;  2ARY A;  3KX1 A;  4FK5 A;  4Q8H A;  2G7Y A;  2HH5 A;  1YK8 A;  8PCH A;  3BWK A;  1EF7 A;  2OZ2 A;  2P0R A;  2DZZ A;  2AS8 A;  4YYW A;  2R9M A;  1YAL A;  6PAD A;  1U9V A;  1W4T A;  1CTE A;  5EF4 A;  2BDL A;  2G8J A;  9PAP A;  4MSX A;  2DJG B;  2AVW A;  1PCI A;  4I04 A;  2DCA A;  4YYV A;  4YYU A;  3KFQ A;  3D9W A;  1PPP A;  1U9X A;  5F02 A;  3P5X A;  2GFO A;  3O1G A;  4N79 A;  1QDQ A;  1AEC A;  4DMX A;  5J94 A;  2NQA A;  1AYV A;  1ME3 A;  3IOQ A;  1NLJ A;  2FRQ A;  1X9Y A;  2E03 A;  3V6C A;  4YYQ A;  3HHA A;  4QRG A;  3MHH A;  2HHN A;  3GCB A;  3OIS A;  4K7C A;  2AYN A;  2PBH A;  2B1M A;  2OP3 A;  2Y6E A;  2DCC A;  1KFX L;  4X6J A;  3WXG A;  2YJ9 A;  2YJB A;  3WXF A;  4N4Z A;  3WXE A;  1ZCM A;  3QJ3 A;  4BS6 A;  5CVM A;  1U9W A;  1JQP A;  3OF8 A;  4MZS A;  3TNX A;  2CIO A;  4WA6 A;  5CVN B;  4P6E A;  1W5R A;  3E1Z B;  3PDF A;  1IWD A;  4CDE B;  4B55 A;  1XKG A;  3P5W A;  1PPD A;  1QXP A;  1KHQ A;  4QH6 A;  2E02 A;  1F29 A;  2HXZ A;  3HWN A;  1NB3 A;  2FO5 A;  3RVX A;  4PAD A;  4XUI A;  3K9M A;  3CBK A;  3AI8 A;  3N3G A;  1CSB B;  2FYE A;  3MOR A;  5JH3 A;  2DC8 A;  2P7U A;  3K8U A;  1CB5 A;  1THE A;  3PW3 A;  1ATK A;  4G54 A;  1MDW A;  1K3B B;  2FUD A;  2BDZ A;  1GMY A;  5CHV A;  3IV2 A;  1U9Q X;  3CH3 X;  2VHF A;  4QRX A;  1YT7 A;  4XR7 A;  1AU4 A;  3OF9 A;  2AUX A;  4BQV A;  3IEJ A;  2DJF B;  5CHT A;  1KFU L;  1PPN A;  4W5B A;  5PAD A;  2DC6 A;  3S3R A;  1S4V A;  1QMY A;  2R9C A;  1Y08 A;  2G6D A;  1GCB A;  4I07 A;  4FIP A;  1M6D A;  3LXS A;  2DC7 A;  3LTW A;  1Q6K A;  3KSE A;  4YYS A;  7PCK A;  4CDC B;  2O6X A;  3IMA A;  3F5V A;  2DCD A;  3D6S A;  5K16 A;  1U5I A;  1MIR A;  2CB5 A;  2ACT A;  2FRA A;  1AU2 A;  2E01 A;  1AIM A;  1DF0 A;  1SP4 B;  2R9O A;  3HHI A;  2XU1 A;  2YJ8 A;  1ICF A;  1GLO A;  2BSZ A;  3PNR A;  1TL9 A;  3KW9 A;  2PAD A;  4AXM A;  1NB5 A;  1F2B A;  3NHE A;  2YJ2 A;  4W5C A;  4ZUX U;  1EWM A;  2R9N A;  2ATO A;  1EWO A;  4FJC A;  2AYO A;  1CS8 A;  2R6N A;  1POP A;  1MEG A;  4QBB A;  1AU3 A;  2DCB A;  1VSN A;  3H7D A;  3F75 A;  2XU3 A;  1TU6 A;  3I06 A;  1MEM A;  2IBI A;  2NQG A;  1F2C A;  1ME4 A;  3KWB X;  2FT2 A;  3OVX A;  1E2T A;  2VHS A;  2H7J A;  2FTD A;  1PAD A;  1AYU A;  1CV8 A;  3USV A;  3K24 A;  2AU1 A;  4HWY A;  2G8E A;  3B79 A;  3U8E A;  2C0Y A;  3ZUA A;  3MTN A;  2P86 A;  2OUL A;  4PP2 E;  4N8W A;  2B1N A;  4PP1 A;  1TLO A;  2F7D A;  2XU4 A;  1PXV A;  1NPZ A;  3DF0 A;  3H8C A;  3P5V A;  1W6F A;  2Y5B A;  1KXR A;  1BY8 A;  1CJL A;  1MS6 A;  3H8B A;  3QT4 A;  3RVV A;  3O0U A;  1F2A A;  1NL6 A;  4CDD B;  3LFY A;  2VFC A;  2E00 A;  1ZIV A;  5CVO B;  2NQD B;  3IUT A;  3M99 A;  3H89 A;  3BCN A;  2AIM A;  4W4U A;  1ITO A;  4GUZ A;  2IPP B;  4QRV A;  4I05 A;  1A6R A;  4CZW A;  3CH2 X;  3H6S A;  2NQI A;  4DMY A;  1AYW A;  1DEU A;  4OEL A;  1Y4H A;  4C5P A;  1EWL A;  3S3Q A;  3QSD A;  1O0E A;  3BOW A;  4KLB A;  3MHS A;  4YVA A;  2F1G A;  1VJV A;  1EWP A;  5JA7 A;  5A24 A;  3V6E A;  4OEM A;  2JQF R;  2PNS A;  1CPJ A;  4NV8 A;  1QOL A;  3CBJ A;  1YVB A;  1NQC A;  1MHW A;  1PPO A;  3RVW A;  3P5U A;  1STF E;  4YYR A;  2YJC A;  1CVZ A;  3I3T A;  1PBH A;  1KHP A;  4AXL A;  3IHP A;  1YK7 A;  3OVZ A;  5FPW A;  3BPM A;  4X6I A;  2GHU A;  1BP4 A;  2PRE A;  4CDF B;  1CQD A;  3ERV A;  4RY2 A;  4BSQ A;  1PE6 A;  4NV7 A;  4Q8G A;  1HUC B;  3N4C A;  1SNK A;  4BGF A;  1FH0 A;  4X6H A;  2DZY A;  2WBF X;  3KWZ A;  4YV8 A;  2JQG R;  2HD5 A;  2AUZ A;  1BQI A;  3HD3 A;  4BPV A;  3PBH A;  4MZO A;  1GX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...