3O0UA

Cathepsin k covalently bound to a cyano-pyrimidine inhibitor with improved selectivity over herg
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin K
publication title Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3o0uA00
1NL6A 4YYWA 1KXRA 1EF7A 4X6JA 2R9CA 4ZUXU 2DC7A 3P5UA 4QRVA 1ZIVA 4P6GA 1EWLA 1KHQA 2ARYA 1MHWA 2NQGA 4W5CA 2DCBA 4KLBA 1CS8A 1U9WA 3DF0A 2AUXA 3AI8A 2G8JA 3N3KA 2YJ9A 1CPJA 2G7YA 1MS6A 2CB5A 4QBBA 5F02A 4AXLA 3ERVA 1K3BB 2DC8A 1QDQA 3HWNA 5J94A 4DMXA 2E01A 2YJ8A 1AIMA 2XU1A 2NQDB 1BGOA 2AYOA 2CIOA 4FK5A 3KWZA 4PADA 2OULA 5PADA 4BPVA 3GCBA 2PBHA 3IMAA 1TLOA 3F75A 3BCNA 3H6SA 2HD5A 5JH3A 5CHTA 1TU6A 2R9FA 2BDLA 3MORA 1PIPA 3OVXA 2E03A 4WA6A 4CDCB 2P86A 3PNRA 1NPZA 1X9YA 4MZOA 2HHNA 4G54A 3OF9A 4Q8HA 2DJGB 2PADA 1GCBA 4YV8A 4X6IA 1F29A 3K9MA 3KKUA 9PAPA 1TL9A 2O6XA 1AYVA 1GLOA 1QOLA 2H7JA 3PDFA 1YK7A 1DF0A 3F5VA 1EWMA 8PCHA 3NHEA 3QSDA 3ZUAA 2DZZA 1A6RA 1Q6KA 1ZCMA 1PPPA 3P5XA 3BC3A 2DC6A 5CVMA 4I07A 4BS5A 2FRQA 3K8UA 1GMYA 1NQCA 1YALA 4CDFB 2ATOA 3OISA 1AU4A 1STFE 4HWYA 5CVOB 1CJLA 3IHPA 1THEA 4K7CA 1MEMA 1YT7A 3H7DA 1MDWA 1PBHA 2YJCA 3MTNA 4FJCA 2NQIA 2AU1A 5JA7A 2FT2A 2R9OA 1JQPA 1Y4HA 3I3TA 3KSEA 1ATKA 3O1GA 2FRAA 1AYWA 3IV2A 3BPFA 1CB5A 1U5IA 5A24A 3V6EA 4PI3A 3P5VA 2BDZA 2R9MA 3CBJA 2E00A 2OP3A 1CTEA 3RVXA 1PPDA 4MZSA 3H89A 1POPA 3LXSA 1AU3A 1AYUA 3HHIA 3N3GA 3KFQA 2XU4A 4YYVA 1O0EA 3K24A 3D6SA 1SP4B 2YJ2A 1HUCB 4BSQA 3S3QA 4YYQA 2VHFA 2YJBA 2PREA 4MSXA 5K16A 3C9EA 4OEMA 4YYRA 2DCDA 3KWBX 1EWOA 4PP2E 1NLJA 1CVZA 3CH3X 4CZWA 4YVAA 2Y5BA 1S4VA 4DMYA 4XR7A 1ITOA 1YK8A 2VHSA 4XUIA 3IOQA 3TNXA 1ME4A 1PPNA 1U9VA 1QMYA 2XU3A 2DCAA 3USVA 4N8WA 1ICFA 4FIPA 1YVBA 2DC9A 4X6HA 4OELA 2B1MA 3I06A 3PW3A 4QH6A 2B1NA 4AXMA 1U9XA 4Q8GA 1AECA 1AU2A 1BQIA 2GHUA 2JQGR 3WXEA 1CSBB 2R9NA 2AYNA 3WXFA 3PBHA 1XKGA 3S3RA 2R6NA 2HH5A 2P0RA 2IBIA 5CVNB 2C0YA 2P7UA 3OF8A 1FH0A 1BY8A 4YYSA 3KX1A 1GECE 3QT4A 3O0UA 4W5BA 2Y6EA 1NB3A 2NQAA 2F1GA 1PXVA 1KFXL 3LFYA 1ME3A 3P5WA 4I05A 4N79A 2E02A 2AVWA 2WBFX 1SNKA 3U8EA 2HXZA 1AU0A 2AUZA 4CDDB 2F7DA 1PE6A 3RVVA 4P6EA 1F2CA 3OVZA 4BS6A 3BPMA 3H8CA 4N4ZA 4QRGA 2PNSA 3MHSA 1CQDA 2G6DA 5FPWA 3BOWA 5EGWA 2AS8A 2XU5A 3BWKA 3WXGA 4QRXA 5CHVA 1M6DA 1MEGA 3V6CA 7PCKA 3IUTA 3MHHA 3QJ3A 1BP4A 1U9QX 4W4UA 1CV8A 1F2BA 4YYUA 2DCCA 2JQFR 4CDEB 3B79A 6PADA 2FYEA 2FUDA 4RY2A 1DEUA 1QXPA 1VJVA 3M99A 3HHAA 3N4CA 1PCIA 4BQVA 1MIRA 3HD3A 2AIMA 2FTDA 2DZYA 2G8EA 2FQ9A 2IPPB 3IEJA 5EF4A 1VSNA 3CBKA 2GFOA 1NB5A 3KW9A 3H8BA 1F2AA 1EWPA 2FO5A 1PADA 4PP1A 3RVWA 3CH2X 2OZ2A 2ACTA 3E1ZB 4I04A 2DJFB 1PPOA 1KFUL 1KHPA 1Y08A 1IWDA
chains in the Genus database with same CATH superfamily
1NL6A 4YYWA 1KXRA 2BU3A 2JRIA 1EF7A 4X6JA 2R9CA 4ZUXU 2J7QA 2DC7A 3P5UA 4QRVA 1ZIVA 4P6GA 1EWLA 1KHQA 4OVZB 2ARYA 1MHWA 4D8BA 2NQGA 4W5CA 2DCBA 4KLBA 1CS8A 4GUAA 1U9WA 3DF0A 2AUXA 3AI8A 2AGAA 3IFUA 2G8JA 3N3KA 3RNVA 2YJ9A 1CPJA 2G7YA 1MS6A 2CB5A 4QBBA 5F02A 4AXLA 3ERVA 1K3BB 2DC8A 1QDQA 3HWNA 5J94A 4DMXA 2E01A 3B21A 2YJ8A 1AIMA 2XU1A 2NQDB 1BGOA 2AYOA 2CIOA 4FK5A 4MM3B 3KWZA 4PADA 4ZTBA 2OULA 3BBAA 3TRKA 5PADA 4BPVA 3GCBA 4M0WA 2PBHA 3W30A 3IMAA 5KO3A 1TLOA 3F75A 4HXDB 3BCNA 3H6SA 3PHWA 2HD5A 5JH3A 4IUMA 5CHTA 4REZA 1TU6A 2R9FA 2BDLA 3MORA 1PIPA 3OVXA 2E03A 1YZBA 4WA6A 4CDCB 2P86A 3PNRA 1NPZA 3O65A 1X9YA 4D8EA 4MZOA 2HHNA 4G54A 4P16A 3OF9A 4Q8HA 2DJGB 2PADA 1GCBA 4YV8A 4X6IA 1F29A 3K9MA 3KKUA 9PAPA 1TL9A 2O6XA 1AYVA 1GLOA 1QOLA 2H7JA 3PDFA 1YK7A 1DF0A 3F5VA 1EWMA 8PCHA 3NHEA 3QSDA 3ZUAA 2DZZA 2HWKA 3PSEA 2J7QC 1A6RA 1Q6KA 4BOQA 1ZCMA 1PPPA 3P5XA 3BC3A 4RF1A 2DC6A 5CVMA 4I07A 4BS5A 2FRQA 3K8UA 1GMYA 1NQCA 3E9SA 1YALA 4CDFB 2ATOA 3OISA 1AU4A 1STFE 4HWYA 5CVOB 1CJLA 3IHPA 1THEA 4K7CA 1MEMA 1YT7A 3H7DA 1MDWA 1PBHA 2YJCA 3MTNA 4FJCA 2NQIA 2AU1A 5JA7A 2FT2A 3MJ5A 2R9OA 1JQPA 1Y4HA 3I3TA 3PRPA 3O1GA 1ATKA 1PVJA 3KSEA 2BTWA 2FRAA 1AYWA 4A5UA 3IV2A 3BPFA 1CB5A 5JZEA 1U5IA 5A24A 3V6EA 4PI3A 3P5VA 3BY4A 2BDZA 2R9MA 3CBJA 2E00A 2OP3A 1CTEA 3RVXA 1PPDA 4XZXA 5E6JA 4MZSA 3H89A 1POPA 3LXSA 5EZSA 1AU3A 1AYUA 3HHIA 3N3GA 3C0RA 3KFQA 2XU4A 4YYVA 4RNAA 1O0EA 3K24A 3D6SA 1SP4B 2YJ2A 1HUCB 4BSQA 3MP2A 3S3QA 4YYQA 2VHFA 2YJBA 4OW0A 2PREA 4MSXA 5K16A 3C9EA 1DKIA 4OEMA 4YYRA 2DCDA 3KWBX 1EWOA 4PP2E 1NLJA 1CVZA 3CH3X 4CZWA 4YVAA 3BB7A 2Y5BA 1S4VA 4DMYA 4XR7A 1ITOA 1YK8A 2VHSA 4XUIA 3IOQA 3TNXA 1ME4A 1PPNA 1U9VA 1QMYA 2XU3A 2DCAA 2JTCA 3USVA 4OVZA 4N8WA 1ICFA 4FIPA 1YVBA 2DC9A 4X6HA 3PHUA 4OELA 2B1MA 3I06A 3PW3A 4QH6A 2B1NA 4AXMA 1U9XA 4Q8GA 1AECA 1AU2A 1BQIA 2GHUA 2JQGR 3PHXA 2DOSA 3WXEA 1CSBB 2R9NA 2AYNA 4IP3A 3WXFA 3PBHA 1XKGA 3PRMA 4BOPA 3S3RA 2R6NA 2HH5A 2P0RA 2IBIA 5CVNB 3W31A 2C0YA 2P7UA 3OF8A 1FH0A 1BY8A 4YYSA 3KX1A 1GECE 3QT4A 3O0UA 4W5BA 2Y6EA 1NB3A 2FE8A 4R3DA 2NQAA 2F1GA 1PXVA 1KFXL 3LFYA 4PT5A 1ME3A 3P5WA 4I05A 4N79A 2E02A 2AVWA 4BOZA 2WBFX 1SNKA 3U8EA 2HXZA 1AU0A 2AUZA 4CDDB 2F7DA 1PE6A 3RVVA 4P6EA 3ZNHA 1F2CA 3OVZA 4BS6A 4WURA 3BPMA 3H8CA 4N4ZA 4QRGA 2PNSA 3MHSA 1CQDA 2G6DA 5FPWA 4D8IA 3BOWA 4BOSA 5EGWA 2AS8A 2XU5A 3BWKA 3WXGA 4QRXA 5CHVA 1M6DA 1MEGA 3V6CA 7PCKA 3IUTA 3MHHA 3QJ3A 1BP4A 2BTWB 1U9QX 4W4UA 1CV8A 1F2BA 3PT2A 4YYUA 2DCCA 2JQFR 4CDEB 4RF0A 3B79A 6PADA 2FYEA 2FUDA 4RY2A 3OQCA 3MTVA 1DEUA 1QXPA 1VJVA 3M99A 3HHAA 3N4CA 1PCIA 4BOUA 1MIRA 4BQVA 3HD3A 2AIMA 2FTDA 2DZYA 2G8EA 2FQ9A 2IPPB 3IEJA 4MI7A 2Z84A 5EF4A 1VSNA 3CBKA 2GFOA 1NB5A 3KW9A 3H8BA 1F2AA 3TMPA 1EWPA 2FO5A 2UZJA 1PADA 4PP1A 3RVWA 3CH2X 2OZ2A 2ACTA 3E1ZB 4I04A 2DJFB 1UKFA 1PPOA 1KFUL 5EZQA 1KHPA 1Y08A 4RKXA 1IWDA
chains in the Genus database with same CATH topology
1NL6A 4YYWA 1KXRA 1EF7A 4X6JA 2VFBA 2R9CA 4ZUXU 2DC7A 3P5UA 4QRVA 1ZIVA 4P6GA 1EWLA 1KHQA 2ARYA 1MHWA 2NQGA 4W5CA 2DCBA 4KLBA 1CS8A 1U9WA 3DF0A 2AUXA 3AI8A 2G8JA 3N3KA 2YJ9A 1CPJA 2G7YA 1MS6A 2CB5A 4QBBA 5F02A 4AXLA 3ERVA 1K3BB 2DC8A 1QDQA 3HWNA 4BGFA 5J94A 4DMXA 2E01A 4C5PA 2YJ8A 1AIMA 2XU1A 2NQDB 1BGOA 2AYOA 2CIOA 4FK5A 3KWZA 4PADA 2OULA 5PADA 4BPVA 3GCBA 3LTWA 2PBHA 3IMAA 1TLOA 3F75A 3BCNA 3H6SA 2HD5A 5JH3A 5CHTA 1TU6A 2R9FA 2BDLA 3MORA 1PIPA 3OVXA 2E03A 4WA6A 4CDCB 2P86A 3PNRA 1NPZA 1X9YA 4MZOA 2HHNA 4G54A 3OF9A 4Q8HA 2DJGB 2PADA 1GCBA 4YV8A 4X6IA 1F29A 3K9MA 3KKUA 9PAPA 1TL9A 2O6XA 1AYVA 1GLOA 1QOLA 2H7JA 3PDFA 1YK7A 1DF0A 3F5VA 1EWMA 8PCHA 3NHEA 3QSDA 3ZUAA 2DZZA 1A6RA 1Q6KA 1ZCMA 1PPPA 3P5XA 1GX3A 3BC3A 2DC6A 2BSZA 5CVMA 4I07A 4BS5A 2FRQA 3K8UA 1GMYA 1NQCA 1YALA 4CDFB 2ATOA 3OISA 1AU4A 1STFE 4HWYA 5CVOB 1CJLA 3IHPA 1THEA 4K7CA 1MEMA 1YT7A 3H7DA 1MDWA 1PBHA 2YJCA 3MTNA 4FJCA 2NQIA 2AU1A 5JA7A 1W4TA 2FT2A 2R9OA 1JQPA 1Y4HA 3I3TA 1W6FA 3KSEA 1ATKA 3O1GA 2FRAA 1AYWA 3IV2A 3BPFA 1CB5A 1U5IA 5A24A 3V6EA 4PI3A 3P5VA 2BDZA 2R9MA 3CBJA 2E00A 2OP3A 1CTEA 3RVXA 1PPDA 4MZSA 3H89A 1POPA 3LXSA 1AU3A 1AYUA 3HHIA 3N3GA 3KFQA 2XU4A 4YYVA 1O0EA 3K24A 3D6SA 1SP4B 2YJ2A 1HUCB 4BSQA 3S3QA 4YYQA 2VHFA 2YJBA 2PREA 4MSXA 5K16A 3C9EA 4OEMA 4YYRA 2DCDA 3KWBX 1EWOA 4PP2E 1NLJA 1CVZA 3CH3X 4CZWA 4YVAA 2Y5BA 1S4VA 4DMYA 4XR7A 1ITOA 1YK8A 2VHSA 4XUIA 3IOQA 3TNXA 1ME4A 1PPNA 1U9VA 1QMYA 2XU3A 2DCAA 3USVA 4N8WA 1ICFA 4FIPA 1YVBA 2DC9A 4X6HA 4OELA 2B1MA 3I06A 3PW3A 4QH6A 2B1NA 4AXMA 1U9XA 4Q8GA 1AECA 1AU2A 1BQIA 2GHUA 2JQGR 3WXEA 1CSBB 2R9NA 2AYNA 3WXFA 3PBHA 1XKGA 3S3RA 2R6NA 2HH5A 2P0RA 2IBIA 5CVNB 2C0YA 2P7UA 3OF8A 1FH0A 1BY8A 4YYSA 3KX1A 1GECE 3QT4A 3O0UA 4W5BA 2Y6EA 1NB3A 2NQAA 2F1GA 1PXVA 1KFXL 3LFYA 1ME3A 3P5WA 4I05A 4N79A 2E02A 2AVWA 2WBFX 1SNKA 3U8EA 2HXZA 1AU0A 4NV8A 2AUZA 4CDDB 2F7DA 1PE6A 3RVVA 4P6EA 1F2CA 1W5RA 1E2TA 3OVZA 4BS6A 3BPMA 3H8CA 4N4ZA 4GUZA 2PNSA 3MHSA 1CQDA 2G6DA 4QRGA 5FPWA 3BOWA 5EGWA 2AS8A 2XU5A 3BWKA 3WXGA 4QRXA 5CHVA 1M6DA 1MEGA 3V6CA 7PCKA 3IUTA 3MHHA 3QJ3A 1BP4A 3D9WA 1U9QX 4W4UA 1CV8A 1F2BA 4YYUA 2DCCA 2JQFR 4CDEB 3B79A 6PADA 2FYEA 2FUDA 4RY2A 1DEUA 1QXPA 1VJVA 3M99A 3HHAA 3N4CA 1PCIA 4BQVA 1MIRA 3HD3A 2AIMA 2FTDA 2DZYA 2G8EA 2FQ9A 2IPPB 3IEJA 5EF4A 1VSNA 3CBKA 2GFOA 1NB5A 3KW9A 3H8BA 1F2AA 4B55A 2VFCA 1EWPA 2FO5A 1PADA 4PP1A 3RVWA 3CH2X 2OZ2A 2ACTA 3E1ZB 4I04A 2DJFB 1PPOA 1KFUL 1KHPA 1Y08A 4NV7A 1IWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NL6 A;  4YYW A;  1KXR A;  1EF7 A;  4X6J A;  2R9C A;  4ZUX U;  2DC7 A;  3P5U A;  4QRV A;  1ZIV A;  4P6G A;  1EWL A;  1KHQ A;  2ARY A;  1MHW A;  2NQG A;  4W5C A;  2DCB A;  4KLB A;  1CS8 A;  1U9W A;  3DF0 A;  2AUX A;  3AI8 A;  2G8J A;  3N3K A;  2YJ9 A;  1CPJ A;  2G7Y A;  1MS6 A;  2CB5 A;  4QBB A;  5F02 A;  4AXL A;  3ERV A;  1K3B B;  2DC8 A;  1QDQ A;  3HWN A;  5J94 A;  4DMX A;  2E01 A;  2YJ8 A;  1AIM A;  2XU1 A;  2NQD B;  1BGO A;  2AYO A;  2CIO A;  4FK5 A;  3KWZ A;  4PAD A;  2OUL A;  5PAD A;  4BPV A;  3GCB A;  2PBH A;  3IMA A;  1TLO A;  3F75 A;  3BCN A;  3H6S A;  2HD5 A;  5JH3 A;  5CHT A;  1TU6 A;  2R9F A;  2BDL A;  3MOR A;  1PIP A;  3OVX A;  2E03 A;  4WA6 A;  4CDC B;  2P86 A;  3PNR A;  1NPZ A;  1X9Y A;  4MZO A;  2HHN A;  4G54 A;  3OF9 A;  4Q8H A;  2DJG B;  2PAD A;  1GCB A;  4YV8 A;  4X6I A;  1F29 A;  3K9M A;  3KKU A;  9PAP A;  1TL9 A;  2O6X A;  1AYV A;  1GLO A;  1QOL A;  2H7J A;  3PDF A;  1YK7 A;  1DF0 A;  3F5V A;  1EWM A;  8PCH A;  3NHE A;  3QSD A;  3ZUA A;  2DZZ A;  1A6R A;  1Q6K A;  1ZCM A;  1PPP A;  3P5X A;  3BC3 A;  2DC6 A;  5CVM A;  4I07 A;  4BS5 A;  2FRQ A;  3K8U A;  1GMY A;  1NQC A;  1YAL A;  4CDF B;  2ATO A;  3OIS A;  1AU4 A;  1STF E;  4HWY A;  5CVO B;  1CJL A;  3IHP A;  1THE A;  4K7C A;  1MEM A;  1YT7 A;  3H7D A;  1MDW A;  1PBH A;  2YJC A;  3MTN A;  4FJC A;  2NQI A;  2AU1 A;  5JA7 A;  2FT2 A;  2R9O A;  1JQP A;  1Y4H A;  3I3T A;  3KSE A;  1ATK A;  3O1G A;  2FRA A;  1AYW A;  3IV2 A;  3BPF A;  1CB5 A;  1U5I A;  5A24 A;  3V6E A;  4PI3 A;  3P5V A;  2BDZ A;  2R9M A;  3CBJ A;  2E00 A;  2OP3 A;  1CTE A;  3RVX A;  1PPD A;  4MZS A;  3H89 A;  1POP A;  3LXS A;  1AU3 A;  1AYU A;  3HHI A;  3N3G A;  3KFQ A;  2XU4 A;  4YYV A;  1O0E A;  3K24 A;  3D6S A;  1SP4 B;  2YJ2 A;  1HUC B;  4BSQ A;  3S3Q A;  4YYQ A;  2VHF A;  2YJB A;  2PRE A;  4MSX A;  5K16 A;  3C9E A;  4OEM A;  4YYR A;  2DCD A;  3KWB X;  1EWO A;  4PP2 E;  1NLJ A;  1CVZ A;  3CH3 X;  4CZW A;  4YVA A;  2Y5B A;  1S4V A;  4DMY A;  4XR7 A;  1ITO A;  1YK8 A;  2VHS A;  4XUI A;  3IOQ A;  3TNX A;  1ME4 A;  1PPN A;  1U9V A;  1QMY A;  2XU3 A;  2DCA A;  3USV A;  4N8W A;  1ICF A;  4FIP A;  1YVB A;  2DC9 A;  4X6H A;  4OEL A;  2B1M A;  3I06 A;  3PW3 A;  4QH6 A;  2B1N A;  4AXM A;  1U9X A;  4Q8G A;  1AEC A;  1AU2 A;  1BQI A;  2GHU A;  2JQG R;  3WXE A;  1CSB B;  2R9N A;  2AYN A;  3WXF A;  3PBH A;  1XKG A;  3S3R A;  2R6N A;  2HH5 A;  2P0R A;  2IBI A;  5CVN B;  2C0Y A;  2P7U A;  3OF8 A;  1FH0 A;  1BY8 A;  4YYS A;  3KX1 A;  1GEC E;  3QT4 A;  3O0U A;  4W5B A;  2Y6E A;  1NB3 A;  2NQA A;  2F1G A;  1PXV A;  1KFX L;  3LFY A;  1ME3 A;  3P5W A;  4I05 A;  4N79 A;  2E02 A;  2AVW A;  2WBF X;  1SNK A;  3U8E A;  2HXZ A;  1AU0 A;  2AUZ A;  4CDD B;  2F7D A;  1PE6 A;  3RVV A;  4P6E A;  1F2C A;  3OVZ A;  4BS6 A;  3BPM A;  3H8C A;  4N4Z A;  4QRG A;  2PNS A;  3MHS A;  1CQD A;  2G6D A;  5FPW A;  3BOW A;  5EGW A;  2AS8 A;  2XU5 A;  3BWK A;  3WXG A;  4QRX A;  5CHV A;  1M6D A;  1MEG A;  3V6C A;  7PCK A;  3IUT A;  3MHH A;  3QJ3 A;  1BP4 A;  1U9Q X;  4W4U A;  1CV8 A;  1F2B A;  4YYU A;  2DCC A;  2JQF R;  4CDE B;  3B79 A;  6PAD A;  2FYE A;  2FUD A;  4RY2 A;  1DEU A;  1QXP A;  1VJV A;  3M99 A;  3HHA A;  3N4C A;  1PCI A;  4BQV A;  1MIR A;  3HD3 A;  2AIM A;  2FTD A;  2DZY A;  2G8E A;  2FQ9 A;  2IPP B;  3IEJ A;  5EF4 A;  1VSN A;  3CBK A;  2GFO A;  1NB5 A;  3KW9 A;  3H8B A;  1F2A A;  1EWP A;  2FO5 A;  1PAD A;  4PP1 A;  3RVW A;  3CH2 X;  2OZ2 A;  2ACT A;  3E1Z B;  4I04 A;  2DJF B;  1PPO A;  1KFU L;  1KHP A;  1Y08 A;  1IWD A; 
#chains in the Genus database with same CATH topology
 1NL6 A;  4YYW A;  1KXR A;  2BU3 A;  2JRI A;  1EF7 A;  4X6J A;  2R9C A;  4ZUX U;  2J7Q A;  2DC7 A;  3P5U A;  4QRV A;  1ZIV A;  4P6G A;  1EWL A;  1KHQ A;  4OVZ B;  2ARY A;  1MHW A;  4D8B A;  2NQG A;  4W5C A;  2DCB A;  4KLB A;  1CS8 A;  4GUA A;  1U9W A;  3DF0 A;  2AUX A;  3AI8 A;  2AGA A;  3IFU A;  2G8J A;  3N3K A;  3RNV A;  2YJ9 A;  1CPJ A;  2G7Y A;  1MS6 A;  2CB5 A;  4QBB A;  5F02 A;  4AXL A;  3ERV A;  1K3B B;  2DC8 A;  1QDQ A;  3HWN A;  5J94 A;  4DMX A;  2E01 A;  3B21 A;  2YJ8 A;  1AIM A;  2XU1 A;  2NQD B;  1BGO A;  2AYO A;  2CIO A;  4FK5 A;  4MM3 B;  3KWZ A;  4PAD A;  4ZTB A;  2OUL A;  3BBA A;  3TRK A;  5PAD A;  4BPV A;  3GCB A;  4M0W A;  2PBH A;  3W30 A;  3IMA A;  5KO3 A;  1TLO A;  3F75 A;  4HXD B;  3BCN A;  3H6S A;  3PHW A;  2HD5 A;  5JH3 A;  4IUM A;  5CHT A;  4REZ A;  1TU6 A;  2R9F A;  2BDL A;  3MOR A;  1PIP A;  3OVX A;  2E03 A;  1YZB A;  4WA6 A;  4CDC B;  2P86 A;  3PNR A;  1NPZ A;  3O65 A;  1X9Y A;  4D8E A;  4MZO A;  2HHN A;  4G54 A;  4P16 A;  3OF9 A;  4Q8H A;  2DJG B;  2PAD A;  1GCB A;  4YV8 A;  4X6I A;  1F29 A;  3K9M A;  3KKU A;  9PAP A;  1TL9 A;  2O6X A;  1AYV A;  1GLO A;  1QOL A;  2H7J A;  3PDF A;  1YK7 A;  1DF0 A;  3F5V A;  1EWM A;  8PCH A;  3NHE A;  3QSD A;  3ZUA A;  2DZZ A;  2HWK A;  3PSE A;  2J7Q C;  1A6R A;  1Q6K A;  4BOQ A;  1ZCM A;  1PPP A;  3P5X A;  3BC3 A;  4RF1 A;  2DC6 A;  5CVM A;  4I07 A;  4BS5 A;  2FRQ A;  3K8U A;  1GMY A;  1NQC A;  3E9S A;  1YAL A;  4CDF B;  2ATO A;  3OIS A;  1AU4 A;  1STF E;  4HWY A;  5CVO B;  1CJL A;  3IHP A;  1THE A;  4K7C A;  1MEM A;  1YT7 A;  3H7D A;  1MDW A;  1PBH A;  2YJC A;  3MTN A;  4FJC A;  2NQI A;  2AU1 A;  5JA7 A;  2FT2 A;  3MJ5 A;  2R9O A;  1JQP A;  1Y4H A;  3I3T A;  3PRP A;  3O1G A;  1ATK A;  1PVJ A;  3KSE A;  2BTW A;  2FRA A;  1AYW A;  4A5U A;  3IV2 A;  3BPF A;  1CB5 A;  5JZE A;  1U5I A;  5A24 A;  3V6E A;  4PI3 A;  3P5V A;  3BY4 A;  2BDZ A;  2R9M A;  3CBJ A;  2E00 A;  2OP3 A;  1CTE A;  3RVX A;  1PPD A;  4XZX A;  5E6J A;  4MZS A;  3H89 A;  1POP A;  3LXS A;  5EZS A;  1AU3 A;  1AYU A;  3HHI A;  3N3G A;  3C0R A;  3KFQ A;  2XU4 A;  4YYV A;  4RNA A;  1O0E A;  3K24 A;  3D6S A;  1SP4 B;  2YJ2 A;  1HUC B;  4BSQ A;  3MP2 A;  3S3Q A;  4YYQ A;  2VHF A;  2YJB A;  4OW0 A;  2PRE A;  4MSX A;  5K16 A;  3C9E A;  1DKI A;  4OEM A;  4YYR A;  2DCD A;  3KWB X;  1EWO A;  4PP2 E;  1NLJ A;  1CVZ A;  3CH3 X;  4CZW A;  4YVA A;  3BB7 A;  2Y5B A;  1S4V A;  4DMY A;  4XR7 A;  1ITO A;  1YK8 A;  2VHS A;  4XUI A;  3IOQ A;  3TNX A;  1ME4 A;  1PPN A;  1U9V A;  1QMY A;  2XU3 A;  2DCA A;  2JTC A;  3USV A;  4OVZ A;  4N8W A;  1ICF A;  4FIP A;  1YVB A;  2DC9 A;  4X6H A;  3PHU A;  4OEL A;  2B1M A;  3I06 A;  3PW3 A;  4QH6 A;  2B1N A;  4AXM A;  1U9X A;  4Q8G A;  1AEC A;  1AU2 A;  1BQI A;  2GHU A;  2JQG R;  3PHX A;  2DOS A;  3WXE A;  1CSB B;  2R9N A;  2AYN A;  4IP3 A;  3WXF A;  3PBH A;  1XKG A;  3PRM A;  4BOP A;  3S3R A;  2R6N A;  2HH5 A;  2P0R A;  2IBI A;  5CVN B;  3W31 A;  2C0Y A;  2P7U A;  3OF8 A;  1FH0 A;  1BY8 A;  4YYS A;  3KX1 A;  1GEC E;  3QT4 A;  3O0U A;  4W5B A;  2Y6E A;  1NB3 A;  2FE8 A;  4R3D A;  2NQA A;  2F1G A;  1PXV A;  1KFX L;  3LFY A;  4PT5 A;  1ME3 A;  3P5W A;  4I05 A;  4N79 A;  2E02 A;  2AVW A;  4BOZ A;  2WBF X;  1SNK A;  3U8E A;  2HXZ A;  1AU0 A;  2AUZ A;  4CDD B;  2F7D A;  1PE6 A;  3RVV A;  4P6E A;  3ZNH A;  1F2C A;  3OVZ A;  4BS6 A;  4WUR A;  3BPM A;  3H8C A;  4N4Z A;  4QRG A;  2PNS A;  3MHS A;  1CQD A;  2G6D A;  5FPW A;  4D8I A;  3BOW A;  4BOS A;  5EGW A;  2AS8 A;  2XU5 A;  3BWK A;  3WXG A;  4QRX A;  5CHV A;  1M6D A;  1MEG A;  3V6C A;  7PCK A;  3IUT A;  3MHH A;  3QJ3 A;  1BP4 A;  2BTW B;  1U9Q X;  4W4U A;  1CV8 A;  1F2B A;  3PT2 A;  4YYU A;  2DCC A;  2JQF R;  4CDE B;  4RF0 A;  3B79 A;  6PAD A;  2FYE A;  2FUD A;  4RY2 A;  3OQC A;  3MTV A;  1DEU A;  1QXP A;  1VJV A;  3M99 A;  3HHA A;  3N4C A;  1PCI A;  4BOU A;  1MIR A;  4BQV A;  3HD3 A;  2AIM A;  2FTD A;  2DZY A;  2G8E A;  2FQ9 A;  2IPP B;  3IEJ A;  4MI7 A;  2Z84 A;  5EF4 A;  1VSN A;  3CBK A;  2GFO A;  1NB5 A;  3KW9 A;  3H8B A;  1F2A A;  3TMP A;  1EWP A;  2FO5 A;  2UZJ A;  1PAD A;  4PP1 A;  3RVW A;  3CH2 X;  2OZ2 A;  2ACT A;  3E1Z B;  4I04 A;  2DJF B;  1UKF A;  1PPO A;  1KFU L;  5EZQ A;  1KHP A;  1Y08 A;  4RKX A;  1IWD A; 
#chains in the Genus database with same CATH homology
 1NL6 A;  4YYW A;  1KXR A;  1EF7 A;  4X6J A;  2VFB A;  2R9C A;  4ZUX U;  2DC7 A;  3P5U A;  4QRV A;  1ZIV A;  4P6G A;  1EWL A;  1KHQ A;  2ARY A;  1MHW A;  2NQG A;  4W5C A;  2DCB A;  4KLB A;  1CS8 A;  1U9W A;  3DF0 A;  2AUX A;  3AI8 A;  2G8J A;  3N3K A;  2YJ9 A;  1CPJ A;  2G7Y A;  1MS6 A;  2CB5 A;  4QBB A;  5F02 A;  4AXL A;  3ERV A;  1K3B B;  2DC8 A;  1QDQ A;  3HWN A;  4BGF A;  5J94 A;  4DMX A;  2E01 A;  4C5P A;  2YJ8 A;  1AIM A;  2XU1 A;  2NQD B;  1BGO A;  2AYO A;  2CIO A;  4FK5 A;  3KWZ A;  4PAD A;  2OUL A;  5PAD A;  4BPV A;  3GCB A;  3LTW A;  2PBH A;  3IMA A;  1TLO A;  3F75 A;  3BCN A;  3H6S A;  2HD5 A;  5JH3 A;  5CHT A;  1TU6 A;  2R9F A;  2BDL A;  3MOR A;  1PIP A;  3OVX A;  2E03 A;  4WA6 A;  4CDC B;  2P86 A;  3PNR A;  1NPZ A;  1X9Y A;  4MZO A;  2HHN A;  4G54 A;  3OF9 A;  4Q8H A;  2DJG B;  2PAD A;  1GCB A;  4YV8 A;  4X6I A;  1F29 A;  3K9M A;  3KKU A;  9PAP A;  1TL9 A;  2O6X A;  1AYV A;  1GLO A;  1QOL A;  2H7J A;  3PDF A;  1YK7 A;  1DF0 A;  3F5V A;  1EWM A;  8PCH A;  3NHE A;  3QSD A;  3ZUA A;  2DZZ A;  1A6R A;  1Q6K A;  1ZCM A;  1PPP A;  3P5X A;  1GX3 A;  3BC3 A;  2DC6 A;  2BSZ A;  5CVM A;  4I07 A;  4BS5 A;  2FRQ A;  3K8U A;  1GMY A;  1NQC A;  1YAL A;  4CDF B;  2ATO A;  3OIS A;  1AU4 A;  1STF E;  4HWY A;  5CVO B;  1CJL A;  3IHP A;  1THE A;  4K7C A;  1MEM A;  1YT7 A;  3H7D A;  1MDW A;  1PBH A;  2YJC A;  3MTN A;  4FJC A;  2NQI A;  2AU1 A;  5JA7 A;  1W4T A;  2FT2 A;  2R9O A;  1JQP A;  1Y4H A;  3I3T A;  1W6F A;  3KSE A;  1ATK A;  3O1G A;  2FRA A;  1AYW A;  3IV2 A;  3BPF A;  1CB5 A;  1U5I A;  5A24 A;  3V6E A;  4PI3 A;  3P5V A;  2BDZ A;  2R9M A;  3CBJ A;  2E00 A;  2OP3 A;  1CTE A;  3RVX A;  1PPD A;  4MZS A;  3H89 A;  1POP A;  3LXS A;  1AU3 A;  1AYU A;  3HHI A;  3N3G A;  3KFQ A;  2XU4 A;  4YYV A;  1O0E A;  3K24 A;  3D6S A;  1SP4 B;  2YJ2 A;  1HUC B;  4BSQ A;  3S3Q A;  4YYQ A;  2VHF A;  2YJB A;  2PRE A;  4MSX A;  5K16 A;  3C9E A;  4OEM A;  4YYR A;  2DCD A;  3KWB X;  1EWO A;  4PP2 E;  1NLJ A;  1CVZ A;  3CH3 X;  4CZW A;  4YVA A;  2Y5B A;  1S4V A;  4DMY A;  4XR7 A;  1ITO A;  1YK8 A;  2VHS A;  4XUI A;  3IOQ A;  3TNX A;  1ME4 A;  1PPN A;  1U9V A;  1QMY A;  2XU3 A;  2DCA A;  3USV A;  4N8W A;  1ICF A;  4FIP A;  1YVB A;  2DC9 A;  4X6H A;  4OEL A;  2B1M A;  3I06 A;  3PW3 A;  4QH6 A;  2B1N A;  4AXM A;  1U9X A;  4Q8G A;  1AEC A;  1AU2 A;  1BQI A;  2GHU A;  2JQG R;  3WXE A;  1CSB B;  2R9N A;  2AYN A;  3WXF A;  3PBH A;  1XKG A;  3S3R A;  2R6N A;  2HH5 A;  2P0R A;  2IBI A;  5CVN B;  2C0Y A;  2P7U A;  3OF8 A;  1FH0 A;  1BY8 A;  4YYS A;  3KX1 A;  1GEC E;  3QT4 A;  3O0U A;  4W5B A;  2Y6E A;  1NB3 A;  2NQA A;  2F1G A;  1PXV A;  1KFX L;  3LFY A;  1ME3 A;  3P5W A;  4I05 A;  4N79 A;  2E02 A;  2AVW A;  2WBF X;  1SNK A;  3U8E A;  2HXZ A;  1AU0 A;  4NV8 A;  2AUZ A;  4CDD B;  2F7D A;  1PE6 A;  3RVV A;  4P6E A;  1F2C A;  1W5R A;  1E2T A;  3OVZ A;  4BS6 A;  3BPM A;  3H8C A;  4N4Z A;  4GUZ A;  2PNS A;  3MHS A;  1CQD A;  2G6D A;  4QRG A;  5FPW A;  3BOW A;  5EGW A;  2AS8 A;  2XU5 A;  3BWK A;  3WXG A;  4QRX A;  5CHV A;  1M6D A;  1MEG A;  3V6C A;  7PCK A;  3IUT A;  3MHH A;  3QJ3 A;  1BP4 A;  3D9W A;  1U9Q X;  4W4U A;  1CV8 A;  1F2B A;  4YYU A;  2DCC A;  2JQF R;  4CDE B;  3B79 A;  6PAD A;  2FYE A;  2FUD A;  4RY2 A;  1DEU A;  1QXP A;  1VJV A;  3M99 A;  3HHA A;  3N4C A;  1PCI A;  4BQV A;  1MIR A;  3HD3 A;  2AIM A;  2FTD A;  2DZY A;  2G8E A;  2FQ9 A;  2IPP B;  3IEJ A;  5EF4 A;  1VSN A;  3CBK A;  2GFO A;  1NB5 A;  3KW9 A;  3H8B A;  1F2A A;  4B55 A;  2VFC A;  1EWP A;  2FO5 A;  1PAD A;  4PP1 A;  3RVW A;  3CH2 X;  2OZ2 A;  2ACT A;  3E1Z B;  4I04 A;  2DJF B;  1PPO A;  1KFU L;  1KHP A;  1Y08 A;  4NV7 A;  1IWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...