3O0UA

Cathepsin k covalently bound to a cyano-pyrimidine inhibitor with improved selectivity over herg
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3o0uA00
3S3QA 1Y08A 1PIPA 2FO5A 1PBHA 2IPPB 2P0RA 4CDCB 1KHPA 4CDDB 1F2AA 1AYUA 3V6EA 1YT7A 2HXZA 5CVMA 3WXFA 1MEMA 2GFOA 2AIMA 4P6GA 3RVVA 2P7UA 1CS8A 4QRXA 2OZ2A 3CH2X 3RVWA 3QT4A 2R9MA 4YVAA 2FUDA 2E02A 3ZUAA 1AYVA 2HH5A 4YYRA 1QXPA 1POPA 2WBFX 1X9YA 2BDLA 2ATOA 1EF7A 1NQCA 1AU2A 2PNSA 3BCNA 1CQDA 8PCHA 4FK5A 5CVNB 4PP2E 4DMYA 3K9MA 4YYQA 4BPVA 2DJGB 4MZSA 3PBHA 7PCKA 4Q8HA 5PADA 4XUIA 3D6SA 1BY8A 4X6HA 1ATKA 1CPJA 2FQ9A 2AS8A 4P6EA 1FH0A 5K16A 9PAPA 4YYWA 1EWPA 3P5VA 1VSNA 2XU1A 3IMAA 4N79A 1SNKA 1YK8A 2ACTA 2E03A 1Y4HA 3M99A 2YJ2A 2VHSA 3MTNA 1U9WA 1U9XA 2E01A 4K7CA 1KXRA 2FRQA 4W5CA 1AYWA 3F5VA 1ICFA 3E1ZB 4I05A 1EWMA 1NLJA 1F2BA 1F2CA 4I04A 1CSBB 2DCCA 3S3RA 4QRVA 1Q6KA 1AECA 1NB5A 1PPDA 2OP3A 1TU6A 3C9EA 3LXSA 2R6NA 3OF9A 3KW9A 5CHTA 3LFYA 2B1MA 3USVA 1PCIA 3N3GA 3BC3A 1IWDA 2CB5A 1EWOA 2XU5A 3KX1A 3CH3X 2NQIA 4AXMA 4G54A 4CDEB 3KFQA 4DMXA 1A6RA 3KWZA 4X6IA 4PADA 4W5BA 1PPOA 1QMYA 2DCAA 3CBKA 1PXVA 2FT2A 1AU3A 5EF4A 2F7DA 3I06A 3KSEA 1DEUA 3P5XA 3WXEA 2DC9A 5JA7A 4RY2A 3ERVA 2DC6A 1YK7A 1KFUL 3QSDA 2Y6EA 1M6DA 3IEJA 4ZUXU 4CZWA 4OEMA 1CVZA 2OULA 2AUXA 2AYOA 1ZCMA 3NHEA 4BS6A 4QBBA 3F75A 1PPPA 4I07A 3P5UA 3BPMA 1GECE 2AU1A 2DZZA 4KLBA 5EGWA 3BPFA 2PREA 2DCBA 1DF0A 1F29A 3PW3A 3H8CA 2PBHA 1JQPA 2VHFA 4QH6A 3IHPA 4YV8A 4PI3A 2Y5BA 3MORA 1QOLA 2DJFB 2G8EA 1KHQA 2NQAA 3HHAA 3K24A 3I3TA 2E00A 3V6CA 1SP4B 2R9FA 3IOQA 3BWKA 4N4ZA 2DC7A 1NB3A 4BQVA 1GLOA 5A24A 3P5WA 1K3BB 4WA6A 1MIRA 1BQIA 2FRAA 1U9QX 3K8UA 3PNRA 2DC8A 4HWYA 3OF8A 1GCBA 3KWBX 3OVZA 2XU3A 4QRGA 1VJVA 1U9VA 3OVXA 2PADA 2CIOA 2HHNA 1CB5A 1XKGA 1TL9A 3CBJA 6PADA 1PPNA 2HD5A 2YJ8A 4XR7A 4CDFB 4X6JA 3DF0A 3OISA 1MS6A 2BDZA 2FYEA 2GHUA 1HUCB 3KKUA 3PDFA 4Q8GA 1STFE 2R9CA 3O0UA 3BOWA 1CJLA 1GMYA 2NQDB 1CV8A 4BSQA 4FIPA 1S4VA 1AU0A 1YVBA 3MHSA 1TLOA 3H8BA 2R9OA 3O1GA 2DZYA 2YJ9A 5CVOB 5FPWA 2ARYA 2AVWA 3TNXA 3H89A 5JH3A 2G8JA 1PE6A 3H6SA 1AU4A 2B1NA 1U5IA 1CTEA 4AXLA 1ZIVA 2P86A 3HD3A 4YYUA 1BP4A 1PADA 3MHHA 1YALA 2NQGA 1ME3A 2AUZA 2YJCA 4OELA 3WXGA 4FJCA 4MSXA 3GCBA 2XU4A 3QJ3A 4YYSA 1KFXL 1MEGA 1ME4A 5CHVA 3IV2A 4PP1A 1NL6A 5J94A 3HWNA 1O0EA 3IUTA 1BGOA 4YYVA 1AIMA 3H7DA 2F1GA 2FTDA 1QDQA 2JQGR 1ITOA 1MDWA 3N4CA 3U8EA 2DCDA 4BS5A 2YJBA 2IBIA 3B79A 2AYNA 5F02A 2R9NA 1MHWA 2O6XA 3HHIA 3RVXA 3N3KA 2G7YA 2JQFR 2H7JA 4MZOA 2C0YA 2G6DA 4N8WA 1NPZA 1THEA 4W4UA 1EWLA 3AI8A
chains in the Genus database with same CATH superfamily
3S3QA 1Y08A 2BTWB 2J7QC 1PIPA 2FO5A 1PBHA 2IPPB 2P0RA 4CDCB 1KHPA 3PRMA 4CDDB 1F2AA 1AYUA 3V6EA 1YT7A 2HXZA 5CVMA 3WXFA 1MEMA 2GFOA 2AIMA 4P6GA 3RVVA 2P7UA 1CS8A 4QRXA 2OZ2A 3CH2X 3RVWA 3QT4A 2R9MA 4WURA 4YVAA 4D8EA 2FUDA 2E02A 3ZUAA 1AYVA 2HH5A 1PVJA 4YYRA 4A5UA 1QXPA 1POPA 2WBFX 1X9YA 2BDLA 3OQCA 4IUMA 4RF1A 2JRIA 2ATOA 1EF7A 1NQCA 1AU2A 2PNSA 3BCNA 1CQDA 8PCHA 4FK5A 5CVNB 3TMPA 4PP2E 4DMYA 3K9MA 4YYQA 3BBAA 4BPVA 2DJGB 4MZSA 3PBHA 7PCKA 2HWKA 4Q8HA 5PADA 4XUIA 3D6SA 1BY8A 4X6HA 1ATKA 1CPJA 2FQ9A 2AS8A 4P6EA 1FH0A 5EZQA 5K16A 9PAPA 4YYWA 1EWPA 3P5VA 1VSNA 2XU1A 3IMAA 4N79A 1SNKA 1YK8A 2ACTA 2E03A 3E9SA 1Y4HA 3M99A 2YJ2A 3ZNHA 2VHSA 3MTNA 4BOZA 1U9WA 1U9XA 4D8BA 5JZEA 2E01A 4K7CA 1KXRA 2FRQA 3TRKA 2FE8A 4W5CA 1AYWA 3F5VA 1ICFA 3E1ZB 4I05A 1EWMA 1NLJA 1F2BA 1F2CA 4I04A 1CSBB 2DCCA 3PHWA 3S3RA 4QRVA 1Q6KA 1AECA 1NB5A 1PPDA 4OW0A 2OP3A 1TU6A 3C9EA 3MTVA 3LXSA 2R6NA 4IP3A 3OF9A 3MP2A 3KW9A 3C0RA 5CHTA 3LFYA 3PRPA 2B1MA 3USVA 1PCIA 1UKFA 3N3GA 2DOSA 3BC3A 1IWDA 2CB5A 1EWOA 2XU5A 3KX1A 3CH3X 2NQIA 4AXMA 3PHXA 4G54A 4CDEB 3KFQA 4DMXA 1A6RA 3KWZA 4X6IA 4PADA 4W5BA 1PPOA 1QMYA 2DCAA 3CBKA 4PT5A 1PXVA 2AGAA 2FT2A 1AU3A 5EF4A 2F7DA 3I06A 3KSEA 1DEUA 3P5XA 3WXEA 2DC9A 5JA7A 4RY2A 3ERVA 2DC6A 1YK7A 3O65A 1KFUL 2UZJA 3QSDA 2Y6EA 1M6DA 3IEJA 4ZUXU 4CZWA 4OEMA 1CVZA 2OULA 2AUXA 4MI7A 2AYOA 1ZCMA 3NHEA 4BS6A 4QBBA 3F75A 1PPPA 4I07A 3P5UA 3BPMA 1GECE 2AU1A 2DZZA 4KLBA 3B21A 3MJ5A 5EGWA 3W30A 5E6JA 3BPFA 2PREA 2DCBA 1DF0A 1F29A 3W31A 4OVZA 3PW3A 3H8CA 4RNAA 2PBHA 1JQPA 2VHFA 4QH6A 3IHPA 4YV8A 4PI3A 5KO3A 2Y5BA 3MORA 1QOLA 2DJFB 2G8EA 1KHQA 2NQAA 3HHAA 3K24A 3I3TA 2E00A 3V6CA 4REZA 1SP4B 2R9FA 2BU3A 3IOQA 3BWKA 4N4ZA 2DC7A 1NB3A 4BQVA 1GLOA 5A24A 3P5WA 1K3BB 4WA6A 1YZBA 1MIRA 1BQIA 2FRAA 1U9QX 3K8UA 3PNRA 2DC8A 4HWYA 3OF8A 4D8IA 1GCBA 4GUAA 3KWBX 3OVZA 4BOPA 2XU3A 4QRGA 1VJVA 1U9VA 4R3DA 3OVXA 2PADA 2CIOA 2HHNA 1CB5A 1XKGA 1DKIA 1TL9A 3CBJA 4RKXA 6PADA 1PPNA 4M0WA 2HD5A 2YJ8A 4XR7A 4CDFB 4X6JA 3DF0A 3OISA 1MS6A 2BDZA 4BOQA 2FYEA 2GHUA 1HUCB 3KKUA 3PDFA 4Q8GA 1STFE 4BOSA 3PSEA 2R9CA 3PT2A 4OVZB 4HXDB 4XZXA 3O0UA 3BOWA 1CJLA 4RF0A 1GMYA 2NQDB 1CV8A 4BSQA 4FIPA 1S4VA 1AU0A 1YVBA 3MHSA 1TLOA 3H8BA 2R9OA 3O1GA 2DZYA 2JTCA 2YJ9A 5CVOB 5FPWA 2ARYA 2BTWA 2AVWA 3TNXA 3H89A 5JH3A 2G8JA 1PE6A 3H6SA 1AU4A 2B1NA 3BY4A 1U5IA 1CTEA 4AXLA 1ZIVA 2P86A 2Z84A 3HD3A 4YYUA 1BP4A 1PADA 3MHHA 1YALA 2NQGA 1ME3A 2AUZA 2YJCA 4OELA 3WXGA 4FJCA 4MSXA 3GCBA 2XU4A 4BOUA 3QJ3A 4YYSA 4ZTBA 1KFXL 1MEGA 1ME4A 3RNVA 3BB7A 5CHVA 3IV2A 4PP1A 1NL6A 5J94A 3HWNA 1O0EA 3IUTA 1BGOA 4MM3B 4P16A 4YYVA 1AIMA 3H7DA 2F1GA 2FTDA 1QDQA 2JQGR 1ITOA 1MDWA 3N4CA 3U8EA 2DCDA 4BS5A 2YJBA 5EZSA 2IBIA 3B79A 2AYNA 3IFUA 5F02A 2J7QA 2R9NA 1MHWA 2O6XA 3HHIA 3RVXA 3N3KA 2G7YA 2JQFR 2H7JA 3PHUA 4MZOA 2C0YA 2G6DA 4N8WA 1NPZA 1THEA 4W4UA 1EWLA 3AI8A
chains in the Genus database with same CATH topology
3S3QA 1Y08A 1PIPA 2FO5A 1PBHA 2IPPB 2P0RA 4CDCB 1KHPA 4CDDB 1F2AA 1AYUA 3V6EA 1YT7A 2HXZA 5CVMA 3WXFA 1MEMA 2GFOA 2AIMA 4P6GA 3RVVA 2P7UA 1CS8A 4QRXA 1W4TA 2OZ2A 3CH2X 3RVWA 3QT4A 2R9MA 4YVAA 2FUDA 2E02A 3ZUAA 1AYVA 2HH5A 4YYRA 4NV7A 1QXPA 1POPA 2WBFX 1X9YA 2VFCA 2BDLA 2ATOA 4NV8A 1EF7A 1NQCA 1AU2A 2PNSA 3BCNA 1CQDA 8PCHA 4FK5A 5CVNB 2BSZA 4PP2E 3K9MA 4DMYA 4YYQA 4BPVA 2DJGB 4MZSA 3PBHA 7PCKA 4Q8HA 5PADA 4XUIA 3D6SA 1BY8A 4BGFA 4X6HA 1ATKA 3D9WA 1CPJA 2FQ9A 2AS8A 1E2TA 4P6EA 1FH0A 3LTWA 5K16A 9PAPA 4YYWA 1EWPA 3P5VA 1VSNA 2XU1A 3IMAA 4N79A 1SNKA 1YK8A 2ACTA 2E03A 1Y4HA 3M99A 2YJ2A 2VHSA 3MTNA 1U9WA 1U9XA 2E01A 4K7CA 1KXRA 2FRQA 4W5CA 1AYWA 3F5VA 1ICFA 3E1ZB 4I05A 1EWMA 1NLJA 1F2BA 1F2CA 4I04A 1CSBB 2DCCA 3S3RA 4QRVA 1Q6KA 1AECA 1NB5A 1PPDA 2OP3A 1TU6A 3C9EA 3LXSA 2R6NA 3OF9A 3KW9A 5CHTA 3LFYA 2B1MA 3USVA 1PCIA 3N3GA 3BC3A 1IWDA 2CB5A 1EWOA 2XU5A 3KX1A 3CH3X 2NQIA 4AXMA 4G54A 4CDEB 3KFQA 4DMXA 1A6RA 3KWZA 4X6IA 4PADA 4W5BA 1PPOA 1QMYA 2DCAA 3CBKA 1PXVA 2FT2A 1AU3A 5EF4A 2F7DA 3I06A 3KSEA 1DEUA 3P5XA 3WXEA 2DC9A 5JA7A 4RY2A 3ERVA 2DC6A 1YK7A 1KFUL 3QSDA 2Y6EA 1M6DA 3IEJA 4ZUXU 4CZWA 4OEMA 1CVZA 2OULA 2AUXA 2AYOA 1ZCMA 3NHEA 4BS6A 4QBBA 3F75A 1PPPA 4I07A 3P5UA 3BPMA 1GECE 2AU1A 2DZZA 4KLBA 5EGWA 3BPFA 2PREA 2DCBA 1DF0A 1F29A 3PW3A 3H8CA 2PBHA 1JQPA 2VHFA 4QH6A 3IHPA 4YV8A 4PI3A 2Y5BA 3MORA 1QOLA 2DJFB 2G8EA 1KHQA 2NQAA 3HHAA 3K24A 3I3TA 2E00A 3V6CA 1SP4B 2R9FA 3IOQA 3BWKA 4N4ZA 2DC7A 1NB3A 4BQVA 1GLOA 5A24A 3P5WA 1K3BB 4WA6A 1MIRA 1BQIA 2FRAA 1U9QX 3K8UA 3PNRA 1W6FA 2DC8A 4HWYA 4GUZA 3OF8A 1GCBA 3KWBX 3OVZA 2XU3A 4QRGA 1VJVA 1U9VA 3OVXA 2PADA 2CIOA 2HHNA 1CB5A 1XKGA 1TL9A 3CBJA 6PADA 1PPNA 2HD5A 2YJ8A 4XR7A 4CDFB 4X6JA 3DF0A 3OISA 1MS6A 2BDZA 2FYEA 2GHUA 1HUCB 3KKUA 3PDFA 4Q8GA 1STFE 2R9CA 3O0UA 3BOWA 1CJLA 1GMYA 2NQDB 1CV8A 4BSQA 4FIPA 1S4VA 1GX3A 1AU0A 1YVBA 3MHSA 1TLOA 3H8BA 2R9OA 3O1GA 2DZYA 2YJ9A 5CVOB 5FPWA 2ARYA 2AVWA 3TNXA 3H89A 5JH3A 2G8JA 1PE6A 3H6SA 1AU4A 2B1NA 1U5IA 1CTEA 4AXLA 1ZIVA 2P86A 3HD3A 4YYUA 1BP4A 1PADA 3MHHA 1YALA 2NQGA 1ME3A 2AUZA 2YJCA 4OELA 3WXGA 1W5RA 4FJCA 4MSXA 3GCBA 2XU4A 3QJ3A 4YYSA 1KFXL 1MEGA 1ME4A 5CHVA 3IV2A 4PP1A 1NL6A 5J94A 3HWNA 1O0EA 3IUTA 1BGOA 4YYVA 1AIMA 3H7DA 2F1GA 2FTDA 1QDQA 2JQGR 1ITOA 1MDWA 3N4CA 3U8EA 2DCDA 4BS5A 2YJBA 2IBIA 3B79A 2AYNA 5F02A 2R9NA 4C5PA 1MHWA 2O6XA 3HHIA 3RVXA 3N3KA 2G7YA 2JQFR 2H7JA 4B55A 2VFBA 4MZOA 2C0YA 2G6DA 4N8WA 1NPZA 1THEA 4W4UA 1EWLA 3AI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3Q A;  1Y08 A;  1PIP A;  2FO5 A;  1PBH A;  2IPP B;  2P0R A;  4CDC B;  1KHP A;  4CDD B;  1F2A A;  1AYU A;  3V6E A;  1YT7 A;  2HXZ A;  5CVM A;  3WXF A;  1MEM A;  2GFO A;  2AIM A;  4P6G A;  3RVV A;  2P7U A;  1CS8 A;  4QRX A;  2OZ2 A;  3CH2 X;  3RVW A;  3QT4 A;  2R9M A;  4YVA A;  2FUD A;  2E02 A;  3ZUA A;  1AYV A;  2HH5 A;  4YYR A;  1QXP A;  1POP A;  2WBF X;  1X9Y A;  2BDL A;  2ATO A;  1EF7 A;  1NQC A;  1AU2 A;  2PNS A;  3BCN A;  1CQD A;  8PCH A;  4FK5 A;  5CVN B;  4PP2 E;  4DMY A;  3K9M A;  4YYQ A;  4BPV A;  2DJG B;  4MZS A;  3PBH A;  7PCK A;  4Q8H A;  5PAD A;  4XUI A;  3D6S A;  1BY8 A;  4X6H A;  1ATK A;  1CPJ A;  2FQ9 A;  2AS8 A;  4P6E A;  1FH0 A;  5K16 A;  9PAP A;  4YYW A;  1EWP A;  3P5V A;  1VSN A;  2XU1 A;  3IMA A;  4N79 A;  1SNK A;  1YK8 A;  2ACT A;  2E03 A;  1Y4H A;  3M99 A;  2YJ2 A;  2VHS A;  3MTN A;  1U9W A;  1U9X A;  2E01 A;  4K7C A;  1KXR A;  2FRQ A;  4W5C A;  1AYW A;  3F5V A;  1ICF A;  3E1Z B;  4I05 A;  1EWM A;  1NLJ A;  1F2B A;  1F2C A;  4I04 A;  1CSB B;  2DCC A;  3S3R A;  4QRV A;  1Q6K A;  1AEC A;  1NB5 A;  1PPD A;  2OP3 A;  1TU6 A;  3C9E A;  3LXS A;  2R6N A;  3OF9 A;  3KW9 A;  5CHT A;  3LFY A;  2B1M A;  3USV A;  1PCI A;  3N3G A;  3BC3 A;  1IWD A;  2CB5 A;  1EWO A;  2XU5 A;  3KX1 A;  3CH3 X;  2NQI A;  4AXM A;  4G54 A;  4CDE B;  3KFQ A;  4DMX A;  1A6R A;  3KWZ A;  4X6I A;  4PAD A;  4W5B A;  1PPO A;  1QMY A;  2DCA A;  3CBK A;  1PXV A;  2FT2 A;  1AU3 A;  5EF4 A;  2F7D A;  3I06 A;  3KSE A;  1DEU A;  3P5X A;  3WXE A;  2DC9 A;  5JA7 A;  4RY2 A;  3ERV A;  2DC6 A;  1YK7 A;  1KFU L;  3QSD A;  2Y6E A;  1M6D A;  3IEJ A;  4ZUX U;  4CZW A;  4OEM A;  1CVZ A;  2OUL A;  2AUX A;  2AYO A;  1ZCM A;  3NHE A;  4BS6 A;  4QBB A;  3F75 A;  1PPP A;  4I07 A;  3P5U A;  3BPM A;  1GEC E;  2AU1 A;  2DZZ A;  4KLB A;  5EGW A;  3BPF A;  2PRE A;  2DCB A;  1DF0 A;  1F29 A;  3PW3 A;  3H8C A;  2PBH A;  1JQP A;  2VHF A;  4QH6 A;  3IHP A;  4YV8 A;  4PI3 A;  2Y5B A;  3MOR A;  1QOL A;  2DJF B;  2G8E A;  1KHQ A;  2NQA A;  3HHA A;  3K24 A;  3I3T A;  2E00 A;  3V6C A;  1SP4 B;  2R9F A;  3IOQ A;  3BWK A;  4N4Z A;  2DC7 A;  1NB3 A;  4BQV A;  1GLO A;  5A24 A;  3P5W A;  1K3B B;  4WA6 A;  1MIR A;  1BQI A;  2FRA A;  1U9Q X;  3K8U A;  3PNR A;  2DC8 A;  4HWY A;  3OF8 A;  1GCB A;  3KWB X;  3OVZ A;  2XU3 A;  4QRG A;  1VJV A;  1U9V A;  3OVX A;  2PAD A;  2CIO A;  2HHN A;  1CB5 A;  1XKG A;  1TL9 A;  3CBJ A;  6PAD A;  1PPN A;  2HD5 A;  2YJ8 A;  4XR7 A;  4CDF B;  4X6J A;  3DF0 A;  3OIS A;  1MS6 A;  2BDZ A;  2FYE A;  2GHU A;  1HUC B;  3KKU A;  3PDF A;  4Q8G A;  1STF E;  2R9C A;  3O0U A;  3BOW A;  1CJL A;  1GMY A;  2NQD B;  1CV8 A;  4BSQ A;  4FIP A;  1S4V A;  1AU0 A;  1YVB A;  3MHS A;  1TLO A;  3H8B A;  2R9O A;  3O1G A;  2DZY A;  2YJ9 A;  5CVO B;  5FPW A;  2ARY A;  2AVW A;  3TNX A;  3H89 A;  5JH3 A;  2G8J A;  1PE6 A;  3H6S A;  1AU4 A;  2B1N A;  1U5I A;  1CTE A;  4AXL A;  1ZIV A;  2P86 A;  3HD3 A;  4YYU A;  1BP4 A;  1PAD A;  3MHH A;  1YAL A;  2NQG A;  1ME3 A;  2AUZ A;  2YJC A;  4OEL A;  3WXG A;  4FJC A;  4MSX A;  3GCB A;  2XU4 A;  3QJ3 A;  4YYS A;  1KFX L;  1MEG A;  1ME4 A;  5CHV A;  3IV2 A;  4PP1 A;  1NL6 A;  5J94 A;  3HWN A;  1O0E A;  3IUT A;  1BGO A;  4YYV A;  1AIM A;  3H7D A;  2F1G A;  2FTD A;  1QDQ A;  2JQG R;  1ITO A;  1MDW A;  3N4C A;  3U8E A;  2DCD A;  4BS5 A;  2YJB A;  2IBI A;  3B79 A;  2AYN A;  5F02 A;  2R9N A;  1MHW A;  2O6X A;  3HHI A;  3RVX A;  3N3K A;  2G7Y A;  2JQF R;  2H7J A;  4MZO A;  2C0Y A;  2G6D A;  4N8W A;  1NPZ A;  1THE A;  4W4U A;  1EWL A;  3AI8 A; 
#chains in the Genus database with same CATH topology
 3S3Q A;  1Y08 A;  2BTW B;  2J7Q C;  1PIP A;  2FO5 A;  1PBH A;  2IPP B;  2P0R A;  4CDC B;  1KHP A;  3PRM A;  4CDD B;  1F2A A;  1AYU A;  3V6E A;  1YT7 A;  2HXZ A;  5CVM A;  3WXF A;  1MEM A;  2GFO A;  2AIM A;  4P6G A;  3RVV A;  2P7U A;  1CS8 A;  4QRX A;  2OZ2 A;  3CH2 X;  3RVW A;  3QT4 A;  2R9M A;  4WUR A;  4YVA A;  4D8E A;  2FUD A;  2E02 A;  3ZUA A;  1AYV A;  2HH5 A;  1PVJ A;  4YYR A;  4A5U A;  1QXP A;  1POP A;  2WBF X;  1X9Y A;  2BDL A;  3OQC A;  4IUM A;  4RF1 A;  2JRI A;  2ATO A;  1EF7 A;  1NQC A;  1AU2 A;  2PNS A;  3BCN A;  1CQD A;  8PCH A;  4FK5 A;  5CVN B;  3TMP A;  4PP2 E;  4DMY A;  3K9M A;  4YYQ A;  3BBA A;  4BPV A;  2DJG B;  4MZS A;  3PBH A;  7PCK A;  2HWK A;  4Q8H A;  5PAD A;  4XUI A;  3D6S A;  1BY8 A;  4X6H A;  1ATK A;  1CPJ A;  2FQ9 A;  2AS8 A;  4P6E A;  1FH0 A;  5EZQ A;  5K16 A;  9PAP A;  4YYW A;  1EWP A;  3P5V A;  1VSN A;  2XU1 A;  3IMA A;  4N79 A;  1SNK A;  1YK8 A;  2ACT A;  2E03 A;  3E9S A;  1Y4H A;  3M99 A;  2YJ2 A;  3ZNH A;  2VHS A;  3MTN A;  4BOZ A;  1U9W A;  1U9X A;  4D8B A;  5JZE A;  2E01 A;  4K7C A;  1KXR A;  2FRQ A;  3TRK A;  2FE8 A;  4W5C A;  1AYW A;  3F5V A;  1ICF A;  3E1Z B;  4I05 A;  1EWM A;  1NLJ A;  1F2B A;  1F2C A;  4I04 A;  1CSB B;  2DCC A;  3PHW A;  3S3R A;  4QRV A;  1Q6K A;  1AEC A;  1NB5 A;  1PPD A;  4OW0 A;  2OP3 A;  1TU6 A;  3C9E A;  3MTV A;  3LXS A;  2R6N A;  4IP3 A;  3OF9 A;  3MP2 A;  3KW9 A;  3C0R A;  5CHT A;  3LFY A;  3PRP A;  2B1M A;  3USV A;  1PCI A;  1UKF A;  3N3G A;  2DOS A;  3BC3 A;  1IWD A;  2CB5 A;  1EWO A;  2XU5 A;  3KX1 A;  3CH3 X;  2NQI A;  4AXM A;  3PHX A;  4G54 A;  4CDE B;  3KFQ A;  4DMX A;  1A6R A;  3KWZ A;  4X6I A;  4PAD A;  4W5B A;  1PPO A;  1QMY A;  2DCA A;  3CBK A;  4PT5 A;  1PXV A;  2AGA A;  2FT2 A;  1AU3 A;  5EF4 A;  2F7D A;  3I06 A;  3KSE A;  1DEU A;  3P5X A;  3WXE A;  2DC9 A;  5JA7 A;  4RY2 A;  3ERV A;  2DC6 A;  1YK7 A;  3O65 A;  1KFU L;  2UZJ A;  3QSD A;  2Y6E A;  1M6D A;  3IEJ A;  4ZUX U;  4CZW A;  4OEM A;  1CVZ A;  2OUL A;  2AUX A;  4MI7 A;  2AYO A;  1ZCM A;  3NHE A;  4BS6 A;  4QBB A;  3F75 A;  1PPP A;  4I07 A;  3P5U A;  3BPM A;  1GEC E;  2AU1 A;  2DZZ A;  4KLB A;  3B21 A;  3MJ5 A;  5EGW A;  3W30 A;  5E6J A;  3BPF A;  2PRE A;  2DCB A;  1DF0 A;  1F29 A;  3W31 A;  4OVZ A;  3PW3 A;  3H8C A;  4RNA A;  2PBH A;  1JQP A;  2VHF A;  4QH6 A;  3IHP A;  4YV8 A;  4PI3 A;  5KO3 A;  2Y5B A;  3MOR A;  1QOL A;  2DJF B;  2G8E A;  1KHQ A;  2NQA A;  3HHA A;  3K24 A;  3I3T A;  2E00 A;  3V6C A;  4REZ A;  1SP4 B;  2R9F A;  2BU3 A;  3IOQ A;  3BWK A;  4N4Z A;  2DC7 A;  1NB3 A;  4BQV A;  1GLO A;  5A24 A;  3P5W A;  1K3B B;  4WA6 A;  1YZB A;  1MIR A;  1BQI A;  2FRA A;  1U9Q X;  3K8U A;  3PNR A;  2DC8 A;  4HWY A;  3OF8 A;  4D8I A;  1GCB A;  4GUA A;  3KWB X;  3OVZ A;  4BOP A;  2XU3 A;  4QRG A;  1VJV A;  1U9V A;  4R3D A;  3OVX A;  2PAD A;  2CIO A;  2HHN A;  1CB5 A;  1XKG A;  1DKI A;  1TL9 A;  3CBJ A;  4RKX A;  6PAD A;  1PPN A;  4M0W A;  2HD5 A;  2YJ8 A;  4XR7 A;  4CDF B;  4X6J A;  3DF0 A;  3OIS A;  1MS6 A;  2BDZ A;  4BOQ A;  2FYE A;  2GHU A;  1HUC B;  3KKU A;  3PDF A;  4Q8G A;  1STF E;  4BOS A;  3PSE A;  2R9C A;  3PT2 A;  4OVZ B;  4HXD B;  4XZX A;  3O0U A;  3BOW A;  1CJL A;  4RF0 A;  1GMY A;  2NQD B;  1CV8 A;  4BSQ A;  4FIP A;  1S4V A;  1AU0 A;  1YVB A;  3MHS A;  1TLO A;  3H8B A;  2R9O A;  3O1G A;  2DZY A;  2JTC A;  2YJ9 A;  5CVO B;  5FPW A;  2ARY A;  2BTW A;  2AVW A;  3TNX A;  3H89 A;  5JH3 A;  2G8J A;  1PE6 A;  3H6S A;  1AU4 A;  2B1N A;  3BY4 A;  1U5I A;  1CTE A;  4AXL A;  1ZIV A;  2P86 A;  2Z84 A;  3HD3 A;  4YYU A;  1BP4 A;  1PAD A;  3MHH A;  1YAL A;  2NQG A;  1ME3 A;  2AUZ A;  2YJC A;  4OEL A;  3WXG A;  4FJC A;  4MSX A;  3GCB A;  2XU4 A;  4BOU A;  3QJ3 A;  4YYS A;  4ZTB A;  1KFX L;  1MEG A;  1ME4 A;  3RNV A;  3BB7 A;  5CHV A;  3IV2 A;  4PP1 A;  1NL6 A;  5J94 A;  3HWN A;  1O0E A;  3IUT A;  1BGO A;  4MM3 B;  4P16 A;  4YYV A;  1AIM A;  3H7D A;  2F1G A;  2FTD A;  1QDQ A;  2JQG R;  1ITO A;  1MDW A;  3N4C A;  3U8E A;  2DCD A;  4BS5 A;  2YJB A;  5EZS A;  2IBI A;  3B79 A;  2AYN A;  3IFU A;  5F02 A;  2J7Q A;  2R9N A;  1MHW A;  2O6X A;  3HHI A;  3RVX A;  3N3K A;  2G7Y A;  2JQF R;  2H7J A;  3PHU A;  4MZO A;  2C0Y A;  2G6D A;  4N8W A;  1NPZ A;  1THE A;  4W4U A;  1EWL A;  3AI8 A; 
#chains in the Genus database with same CATH homology
 3S3Q A;  1Y08 A;  1PIP A;  2FO5 A;  1PBH A;  2IPP B;  2P0R A;  4CDC B;  1KHP A;  4CDD B;  1F2A A;  1AYU A;  3V6E A;  1YT7 A;  2HXZ A;  5CVM A;  3WXF A;  1MEM A;  2GFO A;  2AIM A;  4P6G A;  3RVV A;  2P7U A;  1CS8 A;  4QRX A;  1W4T A;  2OZ2 A;  3CH2 X;  3RVW A;  3QT4 A;  2R9M A;  4YVA A;  2FUD A;  2E02 A;  3ZUA A;  1AYV A;  2HH5 A;  4YYR A;  4NV7 A;  1QXP A;  1POP A;  2WBF X;  1X9Y A;  2VFC A;  2BDL A;  2ATO A;  4NV8 A;  1EF7 A;  1NQC A;  1AU2 A;  2PNS A;  3BCN A;  1CQD A;  8PCH A;  4FK5 A;  5CVN B;  2BSZ A;  4PP2 E;  3K9M A;  4DMY A;  4YYQ A;  4BPV A;  2DJG B;  4MZS A;  3PBH A;  7PCK A;  4Q8H A;  5PAD A;  4XUI A;  3D6S A;  1BY8 A;  4BGF A;  4X6H A;  1ATK A;  3D9W A;  1CPJ A;  2FQ9 A;  2AS8 A;  1E2T A;  4P6E A;  1FH0 A;  3LTW A;  5K16 A;  9PAP A;  4YYW A;  1EWP A;  3P5V A;  1VSN A;  2XU1 A;  3IMA A;  4N79 A;  1SNK A;  1YK8 A;  2ACT A;  2E03 A;  1Y4H A;  3M99 A;  2YJ2 A;  2VHS A;  3MTN A;  1U9W A;  1U9X A;  2E01 A;  4K7C A;  1KXR A;  2FRQ A;  4W5C A;  1AYW A;  3F5V A;  1ICF A;  3E1Z B;  4I05 A;  1EWM A;  1NLJ A;  1F2B A;  1F2C A;  4I04 A;  1CSB B;  2DCC A;  3S3R A;  4QRV A;  1Q6K A;  1AEC A;  1NB5 A;  1PPD A;  2OP3 A;  1TU6 A;  3C9E A;  3LXS A;  2R6N A;  3OF9 A;  3KW9 A;  5CHT A;  3LFY A;  2B1M A;  3USV A;  1PCI A;  3N3G A;  3BC3 A;  1IWD A;  2CB5 A;  1EWO A;  2XU5 A;  3KX1 A;  3CH3 X;  2NQI A;  4AXM A;  4G54 A;  4CDE B;  3KFQ A;  4DMX A;  1A6R A;  3KWZ A;  4X6I A;  4PAD A;  4W5B A;  1PPO A;  1QMY A;  2DCA A;  3CBK A;  1PXV A;  2FT2 A;  1AU3 A;  5EF4 A;  2F7D A;  3I06 A;  3KSE A;  1DEU A;  3P5X A;  3WXE A;  2DC9 A;  5JA7 A;  4RY2 A;  3ERV A;  2DC6 A;  1YK7 A;  1KFU L;  3QSD A;  2Y6E A;  1M6D A;  3IEJ A;  4ZUX U;  4CZW A;  4OEM A;  1CVZ A;  2OUL A;  2AUX A;  2AYO A;  1ZCM A;  3NHE A;  4BS6 A;  4QBB A;  3F75 A;  1PPP A;  4I07 A;  3P5U A;  3BPM A;  1GEC E;  2AU1 A;  2DZZ A;  4KLB A;  5EGW A;  3BPF A;  2PRE A;  2DCB A;  1DF0 A;  1F29 A;  3PW3 A;  3H8C A;  2PBH A;  1JQP A;  2VHF A;  4QH6 A;  3IHP A;  4YV8 A;  4PI3 A;  2Y5B A;  3MOR A;  1QOL A;  2DJF B;  2G8E A;  1KHQ A;  2NQA A;  3HHA A;  3K24 A;  3I3T A;  2E00 A;  3V6C A;  1SP4 B;  2R9F A;  3IOQ A;  3BWK A;  4N4Z A;  2DC7 A;  1NB3 A;  4BQV A;  1GLO A;  5A24 A;  3P5W A;  1K3B B;  4WA6 A;  1MIR A;  1BQI A;  2FRA A;  1U9Q X;  3K8U A;  3PNR A;  1W6F A;  2DC8 A;  4HWY A;  4GUZ A;  3OF8 A;  1GCB A;  3KWB X;  3OVZ A;  2XU3 A;  4QRG A;  1VJV A;  1U9V A;  3OVX A;  2PAD A;  2CIO A;  2HHN A;  1CB5 A;  1XKG A;  1TL9 A;  3CBJ A;  6PAD A;  1PPN A;  2HD5 A;  2YJ8 A;  4XR7 A;  4CDF B;  4X6J A;  3DF0 A;  3OIS A;  1MS6 A;  2BDZ A;  2FYE A;  2GHU A;  1HUC B;  3KKU A;  3PDF A;  4Q8G A;  1STF E;  2R9C A;  3O0U A;  3BOW A;  1CJL A;  1GMY A;  2NQD B;  1CV8 A;  4BSQ A;  4FIP A;  1S4V A;  1GX3 A;  1AU0 A;  1YVB A;  3MHS A;  1TLO A;  3H8B A;  2R9O A;  3O1G A;  2DZY A;  2YJ9 A;  5CVO B;  5FPW A;  2ARY A;  2AVW A;  3TNX A;  3H89 A;  5JH3 A;  2G8J A;  1PE6 A;  3H6S A;  1AU4 A;  2B1N A;  1U5I A;  1CTE A;  4AXL A;  1ZIV A;  2P86 A;  3HD3 A;  4YYU A;  1BP4 A;  1PAD A;  3MHH A;  1YAL A;  2NQG A;  1ME3 A;  2AUZ A;  2YJC A;  4OEL A;  3WXG A;  1W5R A;  4FJC A;  4MSX A;  3GCB A;  2XU4 A;  3QJ3 A;  4YYS A;  1KFX L;  1MEG A;  1ME4 A;  5CHV A;  3IV2 A;  4PP1 A;  1NL6 A;  5J94 A;  3HWN A;  1O0E A;  3IUT A;  1BGO A;  4YYV A;  1AIM A;  3H7D A;  2F1G A;  2FTD A;  1QDQ A;  2JQG R;  1ITO A;  1MDW A;  3N4C A;  3U8E A;  2DCD A;  4BS5 A;  2YJB A;  2IBI A;  3B79 A;  2AYN A;  5F02 A;  2R9N A;  4C5P A;  1MHW A;  2O6X A;  3HHI A;  3RVX A;  3N3K A;  2G7Y A;  2JQF R;  2H7J A;  4B55 A;  2VFB A;  4MZO A;  2C0Y A;  2G6D A;  4N8W A;  1NPZ A;  1THE A;  4W4U A;  1EWL A;  3AI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...