2AUZA

Cathepsin k complexed with a semicarbazone inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Semicarbazone-based inhibitors of cathepsin K, are they prodrugs for aldehyde inhibitors?
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2auzA00
2DZYA 3KKUA 4BS6A 4BS5A 5JA7A 3KWBX 1AU3A 1DEUA 4QRGA 1MDWA 1MEMA 1HUCB 1ZCMA 1TU6A 5CHTA 2YJCA 1CS8A 5CHVA 3AI8A 7PCKA 1CPJA 1TLOA 2IPPB 4FK5A 1SP4B 1M6DA 3IEJA 1SNKA 1PBHA 3QJ3A 2PNSA 2DC7A 3RVVA 2Y6EA 1ICFA 1PPDA 3WXGA 3KW9A 3CBKA 3K8UA 2FUDA 3MHSA 2VHFA 1PXVA 4CDFB 2AYOA 1QXPA 1KHPA 4BPVA 4HWYA 3QT4A 2ACTA 4W5CA 1PCIA 4OELA 3KX1A 1QDQA 1Y08A 2E02A 5EF4A 1CQDA 5J94A 1ME4A 3BOWA 2CIOA 2YJBA 4YVAA 5K16A 1DF0A 1X9YA 3IHPA 2HHNA 1BGOA 1ME3A 1ITOA 2E00A 1F2AA 3BC3A 1GCBA 4MZOA 3P5UA 6PADA 5FPWA 1F29A 2OULA 4YYUA 4AXMA 3HWNA 2FO5A 1PPOA 3LXSA 3IV2A 3RVWA 2DCBA 4I05A 1CTEA 2PADA 1CVZA 1F2CA 3OF8A 2YJ9A 2JQGR 1MHWA 1AECA 1CSBB 2NQGA 3H7DA 3IOQA 3WXFA 2AU1A 1U9WA 2AUZA 2H7JA 4YYWA 2BDZA 1U5IA 3KSEA 2BDLA 2F1GA 4X6HA 1NB3A 2AVWA 1MIRA 2R9NA 1NB5A 1A6RA 1ZIVA 3BCNA 4Q8GA 1NPZA 3V6EA 1NL6A 1YK8A 2DC8A 1NLJA 2G6DA 2ARYA 3P5XA 2O6XA 2OZ2A 1KXRA 2XU1A 2AIMA 4BSQA 1BQIA 2GFOA 1F2BA 1BP4A 4YYRA 1BY8A 4MZSA 3OVXA 4N4ZA 5PADA 4QRVA 4XR7A 1PPPA 4DMYA 2FRQA 2XU4A 2G7YA 1YK7A 4MSXA 1QOLA 3QSDA 2DC6A 2C0YA 2FQ9A 1IWDA 2P0RA 3M99A 3BPFA 1ATKA 4X6JA 1U9QX 1XKGA 4BQVA 4YYSA 4N79A 4ZUXU 3RVXA 3PW3A 3O0UA 8PCHA 5F02A 3BWKA 1KHQA 1TL9A 5CVNB 3D6SA 3N4CA 3IUTA 2PREA 2AS8A 5EGWA 3HHAA 2FRAA 3K24A 3U8EA 3E1ZB 2DJFB 1NQCA 3BPMA 2P7UA 1EWMA 4YYQA 3ERVA 4PADA 3WXEA 5CVOB 2NQAA 3H89A 3H8CA 1O0EA 4CDEB 9PAPA 4XUIA 3KFQA 1AYVA 3PDFA 1MEGA 1PPNA 4N8WA 3USVA 3O1GA 3P5VA 3IMAA 2FTDA 1THEA 4PP1A 1CJLA 2VHSA 3DF0A 1GLOA 4I07A 3B79A 2FT2A 3PNRA 3GCBA 4FJCA 3V6CA 4WA6A 1AIMA 2HXZA 4QBBA 3CH2X 4P6EA 2DCAA 1AU0A 1EWLA 2R9OA 1PE6A 4FIPA 4I04A 3I06A 2AUXA 3HD3A 2WBFX 5CVMA 1K3BB 3ZUAA 2HD5A 1FH0A 3NHEA 1PADA 1YALA 3KWZA 1Q6KA 4KLBA 4W4UA 3MHHA 3OVZA 3N3KA 5A24A 4YV8A 2E03A 1VSNA 1PIPA 1VJVA 3CBJA 3P5WA 2NQIA 4CDCB 4X6IA 2PBHA 2Y5BA 2DCDA 4PI3A 1Y4HA 2R6NA 2XU5A 3N3GA 2DC9A 2R9MA 4YYVA 1GMYA 4W5BA 2AYNA 5JH3A 1S4VA 3C9EA 1U9VA 2DCCA 1EWPA 2CB5A 2B1NA 3PBHA 2ATOA 4OEMA 3MORA 1AU4A 1STFE 2NQDB 4CZWA 4Q8HA 2F7DA 1GECE 4G54A 2B1MA 2G8JA 3OF9A 2P86A 4QH6A 1YVBA 4DMXA 2IBIA 2OP3A 1KFUL 1CB5A 2YJ2A 3S3RA 2R9FA 3K9MA 2FYEA 1U9XA 3CH3X 1AYWA 1EWOA 4QRXA 1POPA 4CDDB 2GHUA 1JQPA 2HH5A 2E01A 4RY2A 2DZZA 1AU2A 2XU3A 2JQFR 3H6SA 3S3QA 3HHIA 3LFYA 3H8BA 1QMYA 1MS6A 4P6GA 3OISA 4AXLA 1AYUA 2R9CA 2DJGB 4PP2E 1CV8A 1EF7A 2YJ8A 3F75A 3I3TA 3F5VA 1KFXL 4K7CA 3TNXA 2G8EA 1YT7A 3MTNA
chains in the Genus database with same CATH superfamily
2DZYA 3KKUA 4BS6A 4BS5A 5JA7A 3KWBX 1AU3A 1DEUA 2JTCA 5EZQA 4QRGA 1MDWA 4ZTBA 1MEMA 1HUCB 1ZCMA 1TU6A 5CHTA 4A5UA 1DKIA 3PHXA 4WURA 2YJCA 1CS8A 2HWKA 5CHVA 3AI8A 7PCKA 1CPJA 1TLOA 2IPPB 4FK5A 4RF1A 1SP4B 1M6DA 3IEJA 1SNKA 1PBHA 3QJ3A 2PNSA 2DC7A 3RVVA 2Y6EA 1ICFA 3ZNHA 1PPDA 3WXGA 3KW9A 3CBKA 3K8UA 2FUDA 3MHSA 2VHFA 1PXVA 4CDFB 2AYOA 1QXPA 1KHPA 4BPVA 4HWYA 3QT4A 2ACTA 4W5CA 1PCIA 4OELA 3KX1A 2BTWA 3PRMA 1QDQA 1Y08A 2E02A 5EF4A 1CQDA 5J94A 1ME4A 3BOWA 2CIOA 2YJBA 4D8IA 4YVAA 5K16A 1DF0A 1X9YA 3IHPA 2HHNA 1BGOA 2DOSA 2JRIA 1ME3A 1ITOA 2E00A 1F2AA 3BC3A 4RKXA 1GCBA 4MZOA 4R3DA 3P5UA 6PADA 5FPWA 1F29A 2OULA 4YYUA 4RNAA 4AXMA 4OVZA 2BU3A 1UKFA 3HWNA 2FO5A 1PPOA 3LXSA 3BY4A 3IV2A 3RVWA 2DCBA 2J7QC 4I05A 4IUMA 1CTEA 2PADA 3PHWA 1CVZA 4BOQA 1F2CA 3OF8A 2YJ9A 2JQGR 1MHWA 1AECA 1CSBB 2NQGA 3E9SA 3H7DA 3IOQA 3WXFA 2AU1A 1U9WA 2AUZA 2H7JA 4YYWA 2AGAA 2BDZA 1U5IA 3KSEA 2BDLA 2F1GA 4MM3B 1NB3A 2AVWA 1MIRA 4X6HA 2R9NA 1NB5A 4GUAA 1A6RA 1ZIVA 3BCNA 4Q8GA 1NPZA 3V6EA 1NL6A 1YK8A 5E6JA 3O65A 3TMPA 2DC8A 1NLJA 2G6DA 2ARYA 3P5XA 2O6XA 2OZ2A 1KXRA 2XU1A 2AIMA 4BSQA 1BQIA 2GFOA 1F2BA 1BP4A 4YYRA 1BY8A 4MZSA 3OVXA 4N4ZA 5PADA 4PT5A 4QRVA 4XR7A 1PPPA 4DMYA 2FRQA 2XU4A 2G7YA 1YK7A 4MSXA 1QOLA 3QSDA 2DC6A 4REZA 2C0YA 2FQ9A 4IP3A 3PRPA 1IWDA 2P0RA 3M99A 3BPFA 1ATKA 4X6JA 1U9QX 1XKGA 4BQVA 4YYSA 4N79A 4ZUXU 3RVXA 3PW3A 3PT2A 3O0UA 8PCHA 5F02A 3RNVA 3BWKA 1KHQA 1TL9A 5CVNB 3D6SA 4BOZA 4HXDB 3N4CA 3IUTA 3BB7A 2PREA 2AS8A 5EGWA 3HHAA 2FRAA 3K24A 3U8EA 3E1ZB 2DJFB 2Z84A 1NQCA 3BPMA 2P7UA 1EWMA 4RF0A 4YYQA 3ERVA 4PADA 3WXEA 5CVOB 2NQAA 3H89A 2BTWB 3H8CA 1O0EA 4CDEB 9PAPA 4XUIA 4OW0A 3KFQA 1PVJA 1AYVA 3PDFA 1MEGA 1PPNA 4N8WA 3USVA 3O1GA 3P5VA 3IMAA 2FTDA 3B21A 1THEA 4PP1A 1CJLA 2VHSA 3DF0A 4MI7A 1GLOA 3TRKA 4I07A 3B79A 2FT2A 3MTVA 3PNRA 4OVZB 3GCBA 4FJCA 3V6CA 4WA6A 1AIMA 2HXZA 4QBBA 3CH2X 4P6EA 2DCAA 1AU0A 1EWLA 2R9OA 1PE6A 4FIPA 4I04A 5KO3A 3I06A 2AUXA 3HD3A 2WBFX 3W31A 4BOPA 5CVMA 1K3BB 3ZUAA 2HD5A 1FH0A 3NHEA 1PADA 1YALA 3KWZA 1Q6KA 2FE8A 4KLBA 4W4UA 3MHHA 3OVZA 3N3KA 5A24A 4YV8A 2E03A 1VSNA 1PIPA 4XZXA 1VJVA 3BBAA 3CBJA 3P5WA 2NQIA 4CDCB 4X6IA 2PBHA 4P16A 2Y5BA 2DCDA 4PI3A 1Y4HA 2R6NA 2XU5A 3N3GA 2DC9A 2R9MA 4YYVA 1GMYA 4W5BA 2AYNA 5JH3A 1S4VA 3PSEA 3C9EA 1U9VA 2DCCA 1EWPA 2CB5A 2B1NA 3PBHA 2ATOA 3PHUA 4OEMA 3MORA 3OQCA 5JZEA 1AU4A 1STFE 2NQDB 4CZWA 3MJ5A 4Q8HA 2F7DA 1GECE 4G54A 1YZBA 2B1MA 2G8JA 3OF9A 2P86A 4QH6A 1YVBA 3C0RA 4DMXA 4BOSA 2IBIA 2UZJA 2OP3A 1KFUL 1CB5A 3W30A 2YJ2A 3S3RA 2R9FA 3K9MA 2FYEA 4M0WA 1U9XA 3CH3X 4BOUA 4D8BA 3IFUA 1AYWA 1EWOA 4QRXA 4D8EA 1POPA 4CDDB 3MP2A 2GHUA 1JQPA 2HH5A 2E01A 4RY2A 2DZZA 1AU2A 2XU3A 2JQFR 3H6SA 3S3QA 3HHIA 3LFYA 3H8BA 1QMYA 1MS6A 4P6GA 2J7QA 3OISA 4AXLA 1AYUA 5EZSA 2R9CA 2DJGB 4PP2E 1CV8A 1EF7A 2YJ8A 3F75A 3I3TA 3F5VA 1KFXL 4K7CA 3TNXA 2G8EA 1YT7A 3MTNA
chains in the Genus database with same CATH topology
2DZYA 3KKUA 4BS6A 4BS5A 5JA7A 3KWBX 1AU3A 1DEUA 4QRGA 1MDWA 1MEMA 1HUCB 1ZCMA 1TU6A 5CHTA 2YJCA 1CS8A 5CHVA 3AI8A 7PCKA 1CPJA 1TLOA 2IPPB 4FK5A 1SP4B 1M6DA 3IEJA 1SNKA 1PBHA 3QJ3A 2PNSA 2DC7A 3RVVA 2Y6EA 1ICFA 1GX3A 1PPDA 3WXGA 3KW9A 3CBKA 3K8UA 2FUDA 3MHSA 2VHFA 1PXVA 4CDFB 2AYOA 1QXPA 1KHPA 4BPVA 4HWYA 3QT4A 2ACTA 4W5CA 1PCIA 4OELA 3KX1A 1QDQA 1Y08A 2E02A 5EF4A 1CQDA 5J94A 1ME4A 3BOWA 1E2TA 2CIOA 2YJBA 4YVAA 5K16A 1DF0A 1X9YA 3IHPA 2HHNA 1BGOA 1W5RA 1ME3A 1ITOA 2E00A 1F2AA 3BC3A 1GCBA 4MZOA 3P5UA 6PADA 5FPWA 1F29A 2OULA 4YYUA 4AXMA 3HWNA 1W6FA 2FO5A 1PPOA 3LXSA 3IV2A 3RVWA 2DCBA 4I05A 1CTEA 2PADA 1CVZA 1F2CA 3OF8A 2YJ9A 2JQGR 1MHWA 1AECA 1CSBB 2NQGA 3H7DA 3IOQA 3WXFA 2AU1A 1U9WA 2AUZA 2H7JA 4YYWA 2BDZA 1U5IA 3KSEA 2BDLA 1W4TA 2F1GA 1NB3A 2AVWA 1MIRA 4X6HA 2R9NA 1NB5A 1A6RA 3D9WA 1ZIVA 3BCNA 4Q8GA 1NPZA 3V6EA 1NL6A 1YK8A 2DC8A 1NLJA 2G6DA 2ARYA 3P5XA 2O6XA 2OZ2A 1KXRA 2XU1A 2AIMA 4BSQA 1BQIA 2GFOA 1F2BA 1BP4A 4YYRA 1BY8A 4MZSA 3OVXA 4N4ZA 5PADA 4QRVA 4XR7A 1PPPA 4DMYA 2FRQA 2XU4A 2G7YA 1YK7A 4MSXA 1QOLA 3QSDA 2DC6A 2C0YA 2FQ9A 1IWDA 2P0RA 3M99A 3BPFA 1ATKA 4X6JA 1U9QX 1XKGA 4BQVA 4YYSA 4N79A 4ZUXU 3RVXA 3PW3A 3O0UA 8PCHA 5F02A 4NV8A 3BWKA 1KHQA 1TL9A 5CVNB 3D6SA 3N4CA 3IUTA 2PREA 2AS8A 5EGWA 3HHAA 2FRAA 3K24A 3U8EA 3E1ZB 2DJFB 1NQCA 3BPMA 2P7UA 1EWMA 4YYQA 3ERVA 4PADA 3WXEA 5CVOB 4GUZA 2NQAA 3H89A 3H8CA 1O0EA 4CDEB 9PAPA 4XUIA 3KFQA 1AYVA 3PDFA 1MEGA 1PPNA 4N8WA 2VFBA 3USVA 3O1GA 3P5VA 3IMAA 2FTDA 1THEA 4PP1A 1CJLA 2VHSA 3DF0A 2VFCA 1GLOA 4I07A 3B79A 2FT2A 3PNRA 3GCBA 4FJCA 3V6CA 4WA6A 1AIMA 2HXZA 4QBBA 3CH2X 4P6EA 2DCAA 1AU0A 1EWLA 2R9OA 1PE6A 4FIPA 4I04A 4C5PA 3I06A 2AUXA 3HD3A 2WBFX 5CVMA 1K3BB 3ZUAA 2HD5A 1FH0A 3NHEA 1PADA 1YALA 3KWZA 1Q6KA 4KLBA 4W4UA 2BSZA 3MHHA 3OVZA 3N3KA 5A24A 4YV8A 2E03A 1VSNA 1PIPA 1VJVA 3CBJA 3P5WA 2NQIA 4CDCB 4X6IA 2PBHA 2Y5BA 2DCDA 4PI3A 1Y4HA 2R6NA 2XU5A 3LTWA 3N3GA 2DC9A 2R9MA 4YYVA 1GMYA 4W5BA 2AYNA 5JH3A 1S4VA 3C9EA 1U9VA 4B55A 2DCCA 1EWPA 2CB5A 2B1NA 3PBHA 2ATOA 4OEMA 3MORA 1AU4A 1STFE 2NQDB 4CZWA 4Q8HA 2F7DA 1GECE 4NV7A 4G54A 2B1MA 2G8JA 3OF9A 2P86A 4QH6A 1YVBA 4DMXA 2IBIA 2OP3A 1KFUL 1CB5A 4BGFA 2YJ2A 3S3RA 2R9FA 3K9MA 2FYEA 1U9XA 3CH3X 1AYWA 1EWOA 4QRXA 1POPA 4CDDB 2GHUA 1JQPA 2HH5A 2E01A 4RY2A 2DZZA 1AU2A 2XU3A 2JQFR 3H6SA 3S3QA 3HHIA 3LFYA 3H8BA 1QMYA 1MS6A 4P6GA 3OISA 4AXLA 1AYUA 2R9CA 2DJGB 4PP2E 1CV8A 1EF7A 2YJ8A 3F75A 3I3TA 3F5VA 1KFXL 4K7CA 3TNXA 2G8EA 1YT7A 3MTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZY A;  3KKU A;  4BS6 A;  4BS5 A;  5JA7 A;  3KWB X;  1AU3 A;  1DEU A;  4QRG A;  1MDW A;  1MEM A;  1HUC B;  1ZCM A;  1TU6 A;  5CHT A;  2YJC A;  1CS8 A;  5CHV A;  3AI8 A;  7PCK A;  1CPJ A;  1TLO A;  2IPP B;  4FK5 A;  1SP4 B;  1M6D A;  3IEJ A;  1SNK A;  1PBH A;  3QJ3 A;  2PNS A;  2DC7 A;  3RVV A;  2Y6E A;  1ICF A;  1PPD A;  3WXG A;  3KW9 A;  3CBK A;  3K8U A;  2FUD A;  3MHS A;  2VHF A;  1PXV A;  4CDF B;  2AYO A;  1QXP A;  1KHP A;  4BPV A;  4HWY A;  3QT4 A;  2ACT A;  4W5C A;  1PCI A;  4OEL A;  3KX1 A;  1QDQ A;  1Y08 A;  2E02 A;  5EF4 A;  1CQD A;  5J94 A;  1ME4 A;  3BOW A;  2CIO A;  2YJB A;  4YVA A;  5K16 A;  1DF0 A;  1X9Y A;  3IHP A;  2HHN A;  1BGO A;  1ME3 A;  1ITO A;  2E00 A;  1F2A A;  3BC3 A;  1GCB A;  4MZO A;  3P5U A;  6PAD A;  5FPW A;  1F29 A;  2OUL A;  4YYU A;  4AXM A;  3HWN A;  2FO5 A;  1PPO A;  3LXS A;  3IV2 A;  3RVW A;  2DCB A;  4I05 A;  1CTE A;  2PAD A;  1CVZ A;  1F2C A;  3OF8 A;  2YJ9 A;  2JQG R;  1MHW A;  1AEC A;  1CSB B;  2NQG A;  3H7D A;  3IOQ A;  3WXF A;  2AU1 A;  1U9W A;  2AUZ A;  2H7J A;  4YYW A;  2BDZ A;  1U5I A;  3KSE A;  2BDL A;  2F1G A;  4X6H A;  1NB3 A;  2AVW A;  1MIR A;  2R9N A;  1NB5 A;  1A6R A;  1ZIV A;  3BCN A;  4Q8G A;  1NPZ A;  3V6E A;  1NL6 A;  1YK8 A;  2DC8 A;  1NLJ A;  2G6D A;  2ARY A;  3P5X A;  2O6X A;  2OZ2 A;  1KXR A;  2XU1 A;  2AIM A;  4BSQ A;  1BQI A;  2GFO A;  1F2B A;  1BP4 A;  4YYR A;  1BY8 A;  4MZS A;  3OVX A;  4N4Z A;  5PAD A;  4QRV A;  4XR7 A;  1PPP A;  4DMY A;  2FRQ A;  2XU4 A;  2G7Y A;  1YK7 A;  4MSX A;  1QOL A;  3QSD A;  2DC6 A;  2C0Y A;  2FQ9 A;  1IWD A;  2P0R A;  3M99 A;  3BPF A;  1ATK A;  4X6J A;  1U9Q X;  1XKG A;  4BQV A;  4YYS A;  4N79 A;  4ZUX U;  3RVX A;  3PW3 A;  3O0U A;  8PCH A;  5F02 A;  3BWK A;  1KHQ A;  1TL9 A;  5CVN B;  3D6S A;  3N4C A;  3IUT A;  2PRE A;  2AS8 A;  5EGW A;  3HHA A;  2FRA A;  3K24 A;  3U8E A;  3E1Z B;  2DJF B;  1NQC A;  3BPM A;  2P7U A;  1EWM A;  4YYQ A;  3ERV A;  4PAD A;  3WXE A;  5CVO B;  2NQA A;  3H89 A;  3H8C A;  1O0E A;  4CDE B;  9PAP A;  4XUI A;  3KFQ A;  1AYV A;  3PDF A;  1MEG A;  1PPN A;  4N8W A;  3USV A;  3O1G A;  3P5V A;  3IMA A;  2FTD A;  1THE A;  4PP1 A;  1CJL A;  2VHS A;  3DF0 A;  1GLO A;  4I07 A;  3B79 A;  2FT2 A;  3PNR A;  3GCB A;  4FJC A;  3V6C A;  4WA6 A;  1AIM A;  2HXZ A;  4QBB A;  3CH2 X;  4P6E A;  2DCA A;  1AU0 A;  1EWL A;  2R9O A;  1PE6 A;  4FIP A;  4I04 A;  3I06 A;  2AUX A;  3HD3 A;  2WBF X;  5CVM A;  1K3B B;  3ZUA A;  2HD5 A;  1FH0 A;  3NHE A;  1PAD A;  1YAL A;  3KWZ A;  1Q6K A;  4KLB A;  4W4U A;  3MHH A;  3OVZ A;  3N3K A;  5A24 A;  4YV8 A;  2E03 A;  1VSN A;  1PIP A;  1VJV A;  3CBJ A;  3P5W A;  2NQI A;  4CDC B;  4X6I A;  2PBH A;  2Y5B A;  2DCD A;  4PI3 A;  1Y4H A;  2R6N A;  2XU5 A;  3N3G A;  2DC9 A;  2R9M A;  4YYV A;  1GMY A;  4W5B A;  2AYN A;  5JH3 A;  1S4V A;  3C9E A;  1U9V A;  2DCC A;  1EWP A;  2CB5 A;  2B1N A;  3PBH A;  2ATO A;  4OEM A;  3MOR A;  1AU4 A;  1STF E;  2NQD B;  4CZW A;  4Q8H A;  2F7D A;  1GEC E;  4G54 A;  2B1M A;  2G8J A;  3OF9 A;  2P86 A;  4QH6 A;  1YVB A;  4DMX A;  2IBI A;  2OP3 A;  1KFU L;  1CB5 A;  2YJ2 A;  3S3R A;  2R9F A;  3K9M A;  2FYE A;  1U9X A;  3CH3 X;  1AYW A;  1EWO A;  4QRX A;  1POP A;  4CDD B;  2GHU A;  1JQP A;  2HH5 A;  2E01 A;  4RY2 A;  2DZZ A;  1AU2 A;  2XU3 A;  2JQF R;  3H6S A;  3S3Q A;  3HHI A;  3LFY A;  3H8B A;  1QMY A;  1MS6 A;  4P6G A;  3OIS A;  4AXL A;  1AYU A;  2R9C A;  2DJG B;  4PP2 E;  1CV8 A;  1EF7 A;  2YJ8 A;  3F75 A;  3I3T A;  3F5V A;  1KFX L;  4K7C A;  3TNX A;  2G8E A;  1YT7 A;  3MTN A; 
#chains in the Genus database with same CATH topology
 2DZY A;  3KKU A;  4BS6 A;  4BS5 A;  5JA7 A;  3KWB X;  1AU3 A;  1DEU A;  2JTC A;  5EZQ A;  4QRG A;  1MDW A;  4ZTB A;  1MEM A;  1HUC B;  1ZCM A;  1TU6 A;  5CHT A;  4A5U A;  1DKI A;  3PHX A;  4WUR A;  2YJC A;  1CS8 A;  2HWK A;  5CHV A;  3AI8 A;  7PCK A;  1CPJ A;  1TLO A;  2IPP B;  4FK5 A;  4RF1 A;  1SP4 B;  1M6D A;  3IEJ A;  1SNK A;  1PBH A;  3QJ3 A;  2PNS A;  2DC7 A;  3RVV A;  2Y6E A;  1ICF A;  3ZNH A;  1PPD A;  3WXG A;  3KW9 A;  3CBK A;  3K8U A;  2FUD A;  3MHS A;  2VHF A;  1PXV A;  4CDF B;  2AYO A;  1QXP A;  1KHP A;  4BPV A;  4HWY A;  3QT4 A;  2ACT A;  4W5C A;  1PCI A;  4OEL A;  3KX1 A;  2BTW A;  3PRM A;  1QDQ A;  1Y08 A;  2E02 A;  5EF4 A;  1CQD A;  5J94 A;  1ME4 A;  3BOW A;  2CIO A;  2YJB A;  4D8I A;  4YVA A;  5K16 A;  1DF0 A;  1X9Y A;  3IHP A;  2HHN A;  1BGO A;  2DOS A;  2JRI A;  1ME3 A;  1ITO A;  2E00 A;  1F2A A;  3BC3 A;  4RKX A;  1GCB A;  4MZO A;  4R3D A;  3P5U A;  6PAD A;  5FPW A;  1F29 A;  2OUL A;  4YYU A;  4RNA A;  4AXM A;  4OVZ A;  2BU3 A;  1UKF A;  3HWN A;  2FO5 A;  1PPO A;  3LXS A;  3BY4 A;  3IV2 A;  3RVW A;  2DCB A;  2J7Q C;  4I05 A;  4IUM A;  1CTE A;  2PAD A;  3PHW A;  1CVZ A;  4BOQ A;  1F2C A;  3OF8 A;  2YJ9 A;  2JQG R;  1MHW A;  1AEC A;  1CSB B;  2NQG A;  3E9S A;  3H7D A;  3IOQ A;  3WXF A;  2AU1 A;  1U9W A;  2AUZ A;  2H7J A;  4YYW A;  2AGA A;  2BDZ A;  1U5I A;  3KSE A;  2BDL A;  2F1G A;  4MM3 B;  1NB3 A;  2AVW A;  1MIR A;  4X6H A;  2R9N A;  1NB5 A;  4GUA A;  1A6R A;  1ZIV A;  3BCN A;  4Q8G A;  1NPZ A;  3V6E A;  1NL6 A;  1YK8 A;  5E6J A;  3O65 A;  3TMP A;  2DC8 A;  1NLJ A;  2G6D A;  2ARY A;  3P5X A;  2O6X A;  2OZ2 A;  1KXR A;  2XU1 A;  2AIM A;  4BSQ A;  1BQI A;  2GFO A;  1F2B A;  1BP4 A;  4YYR A;  1BY8 A;  4MZS A;  3OVX A;  4N4Z A;  5PAD A;  4PT5 A;  4QRV A;  4XR7 A;  1PPP A;  4DMY A;  2FRQ A;  2XU4 A;  2G7Y A;  1YK7 A;  4MSX A;  1QOL A;  3QSD A;  2DC6 A;  4REZ A;  2C0Y A;  2FQ9 A;  4IP3 A;  3PRP A;  1IWD A;  2P0R A;  3M99 A;  3BPF A;  1ATK A;  4X6J A;  1U9Q X;  1XKG A;  4BQV A;  4YYS A;  4N79 A;  4ZUX U;  3RVX A;  3PW3 A;  3PT2 A;  3O0U A;  8PCH A;  5F02 A;  3RNV A;  3BWK A;  1KHQ A;  1TL9 A;  5CVN B;  3D6S A;  4BOZ A;  4HXD B;  3N4C A;  3IUT A;  3BB7 A;  2PRE A;  2AS8 A;  5EGW A;  3HHA A;  2FRA A;  3K24 A;  3U8E A;  3E1Z B;  2DJF B;  2Z84 A;  1NQC A;  3BPM A;  2P7U A;  1EWM A;  4RF0 A;  4YYQ A;  3ERV A;  4PAD A;  3WXE A;  5CVO B;  2NQA A;  3H89 A;  2BTW B;  3H8C A;  1O0E A;  4CDE B;  9PAP A;  4XUI A;  4OW0 A;  3KFQ A;  1PVJ A;  1AYV A;  3PDF A;  1MEG A;  1PPN A;  4N8W A;  3USV A;  3O1G A;  3P5V A;  3IMA A;  2FTD A;  3B21 A;  1THE A;  4PP1 A;  1CJL A;  2VHS A;  3DF0 A;  4MI7 A;  1GLO A;  3TRK A;  4I07 A;  3B79 A;  2FT2 A;  3MTV A;  3PNR A;  4OVZ B;  3GCB A;  4FJC A;  3V6C A;  4WA6 A;  1AIM A;  2HXZ A;  4QBB A;  3CH2 X;  4P6E A;  2DCA A;  1AU0 A;  1EWL A;  2R9O A;  1PE6 A;  4FIP A;  4I04 A;  5KO3 A;  3I06 A;  2AUX A;  3HD3 A;  2WBF X;  3W31 A;  4BOP A;  5CVM A;  1K3B B;  3ZUA A;  2HD5 A;  1FH0 A;  3NHE A;  1PAD A;  1YAL A;  3KWZ A;  1Q6K A;  2FE8 A;  4KLB A;  4W4U A;  3MHH A;  3OVZ A;  3N3K A;  5A24 A;  4YV8 A;  2E03 A;  1VSN A;  1PIP A;  4XZX A;  1VJV A;  3BBA A;  3CBJ A;  3P5W A;  2NQI A;  4CDC B;  4X6I A;  2PBH A;  4P16 A;  2Y5B A;  2DCD A;  4PI3 A;  1Y4H A;  2R6N A;  2XU5 A;  3N3G A;  2DC9 A;  2R9M A;  4YYV A;  1GMY A;  4W5B A;  2AYN A;  5JH3 A;  1S4V A;  3PSE A;  3C9E A;  1U9V A;  2DCC A;  1EWP A;  2CB5 A;  2B1N A;  3PBH A;  2ATO A;  3PHU A;  4OEM A;  3MOR A;  3OQC A;  5JZE A;  1AU4 A;  1STF E;  2NQD B;  4CZW A;  3MJ5 A;  4Q8H A;  2F7D A;  1GEC E;  4G54 A;  1YZB A;  2B1M A;  2G8J A;  3OF9 A;  2P86 A;  4QH6 A;  1YVB A;  3C0R A;  4DMX A;  4BOS A;  2IBI A;  2UZJ A;  2OP3 A;  1KFU L;  1CB5 A;  3W30 A;  2YJ2 A;  3S3R A;  2R9F A;  3K9M A;  2FYE A;  4M0W A;  1U9X A;  3CH3 X;  4BOU A;  4D8B A;  3IFU A;  1AYW A;  1EWO A;  4QRX A;  4D8E A;  1POP A;  4CDD B;  3MP2 A;  2GHU A;  1JQP A;  2HH5 A;  2E01 A;  4RY2 A;  2DZZ A;  1AU2 A;  2XU3 A;  2JQF R;  3H6S A;  3S3Q A;  3HHI A;  3LFY A;  3H8B A;  1QMY A;  1MS6 A;  4P6G A;  2J7Q A;  3OIS A;  4AXL A;  1AYU A;  5EZS A;  2R9C A;  2DJG B;  4PP2 E;  1CV8 A;  1EF7 A;  2YJ8 A;  3F75 A;  3I3T A;  3F5V A;  1KFX L;  4K7C A;  3TNX A;  2G8E A;  1YT7 A;  3MTN A; 
#chains in the Genus database with same CATH homology
 2DZY A;  3KKU A;  4BS6 A;  4BS5 A;  5JA7 A;  3KWB X;  1AU3 A;  1DEU A;  4QRG A;  1MDW A;  1MEM A;  1HUC B;  1ZCM A;  1TU6 A;  5CHT A;  2YJC A;  1CS8 A;  5CHV A;  3AI8 A;  7PCK A;  1CPJ A;  1TLO A;  2IPP B;  4FK5 A;  1SP4 B;  1M6D A;  3IEJ A;  1SNK A;  1PBH A;  3QJ3 A;  2PNS A;  2DC7 A;  3RVV A;  2Y6E A;  1ICF A;  1GX3 A;  1PPD A;  3WXG A;  3KW9 A;  3CBK A;  3K8U A;  2FUD A;  3MHS A;  2VHF A;  1PXV A;  4CDF B;  2AYO A;  1QXP A;  1KHP A;  4BPV A;  4HWY A;  3QT4 A;  2ACT A;  4W5C A;  1PCI A;  4OEL A;  3KX1 A;  1QDQ A;  1Y08 A;  2E02 A;  5EF4 A;  1CQD A;  5J94 A;  1ME4 A;  3BOW A;  1E2T A;  2CIO A;  2YJB A;  4YVA A;  5K16 A;  1DF0 A;  1X9Y A;  3IHP A;  2HHN A;  1BGO A;  1W5R A;  1ME3 A;  1ITO A;  2E00 A;  1F2A A;  3BC3 A;  1GCB A;  4MZO A;  3P5U A;  6PAD A;  5FPW A;  1F29 A;  2OUL A;  4YYU A;  4AXM A;  3HWN A;  1W6F A;  2FO5 A;  1PPO A;  3LXS A;  3IV2 A;  3RVW A;  2DCB A;  4I05 A;  1CTE A;  2PAD A;  1CVZ A;  1F2C A;  3OF8 A;  2YJ9 A;  2JQG R;  1MHW A;  1AEC A;  1CSB B;  2NQG A;  3H7D A;  3IOQ A;  3WXF A;  2AU1 A;  1U9W A;  2AUZ A;  2H7J A;  4YYW A;  2BDZ A;  1U5I A;  3KSE A;  2BDL A;  1W4T A;  2F1G A;  1NB3 A;  2AVW A;  1MIR A;  4X6H A;  2R9N A;  1NB5 A;  1A6R A;  3D9W A;  1ZIV A;  3BCN A;  4Q8G A;  1NPZ A;  3V6E A;  1NL6 A;  1YK8 A;  2DC8 A;  1NLJ A;  2G6D A;  2ARY A;  3P5X A;  2O6X A;  2OZ2 A;  1KXR A;  2XU1 A;  2AIM A;  4BSQ A;  1BQI A;  2GFO A;  1F2B A;  1BP4 A;  4YYR A;  1BY8 A;  4MZS A;  3OVX A;  4N4Z A;  5PAD A;  4QRV A;  4XR7 A;  1PPP A;  4DMY A;  2FRQ A;  2XU4 A;  2G7Y A;  1YK7 A;  4MSX A;  1QOL A;  3QSD A;  2DC6 A;  2C0Y A;  2FQ9 A;  1IWD A;  2P0R A;  3M99 A;  3BPF A;  1ATK A;  4X6J A;  1U9Q X;  1XKG A;  4BQV A;  4YYS A;  4N79 A;  4ZUX U;  3RVX A;  3PW3 A;  3O0U A;  8PCH A;  5F02 A;  4NV8 A;  3BWK A;  1KHQ A;  1TL9 A;  5CVN B;  3D6S A;  3N4C A;  3IUT A;  2PRE A;  2AS8 A;  5EGW A;  3HHA A;  2FRA A;  3K24 A;  3U8E A;  3E1Z B;  2DJF B;  1NQC A;  3BPM A;  2P7U A;  1EWM A;  4YYQ A;  3ERV A;  4PAD A;  3WXE A;  5CVO B;  4GUZ A;  2NQA A;  3H89 A;  3H8C A;  1O0E A;  4CDE B;  9PAP A;  4XUI A;  3KFQ A;  1AYV A;  3PDF A;  1MEG A;  1PPN A;  4N8W A;  2VFB A;  3USV A;  3O1G A;  3P5V A;  3IMA A;  2FTD A;  1THE A;  4PP1 A;  1CJL A;  2VHS A;  3DF0 A;  2VFC A;  1GLO A;  4I07 A;  3B79 A;  2FT2 A;  3PNR A;  3GCB A;  4FJC A;  3V6C A;  4WA6 A;  1AIM A;  2HXZ A;  4QBB A;  3CH2 X;  4P6E A;  2DCA A;  1AU0 A;  1EWL A;  2R9O A;  1PE6 A;  4FIP A;  4I04 A;  4C5P A;  3I06 A;  2AUX A;  3HD3 A;  2WBF X;  5CVM A;  1K3B B;  3ZUA A;  2HD5 A;  1FH0 A;  3NHE A;  1PAD A;  1YAL A;  3KWZ A;  1Q6K A;  4KLB A;  4W4U A;  2BSZ A;  3MHH A;  3OVZ A;  3N3K A;  5A24 A;  4YV8 A;  2E03 A;  1VSN A;  1PIP A;  1VJV A;  3CBJ A;  3P5W A;  2NQI A;  4CDC B;  4X6I A;  2PBH A;  2Y5B A;  2DCD A;  4PI3 A;  1Y4H A;  2R6N A;  2XU5 A;  3LTW A;  3N3G A;  2DC9 A;  2R9M A;  4YYV A;  1GMY A;  4W5B A;  2AYN A;  5JH3 A;  1S4V A;  3C9E A;  1U9V A;  4B55 A;  2DCC A;  1EWP A;  2CB5 A;  2B1N A;  3PBH A;  2ATO A;  4OEM A;  3MOR A;  1AU4 A;  1STF E;  2NQD B;  4CZW A;  4Q8H A;  2F7D A;  1GEC E;  4NV7 A;  4G54 A;  2B1M A;  2G8J A;  3OF9 A;  2P86 A;  4QH6 A;  1YVB A;  4DMX A;  2IBI A;  2OP3 A;  1KFU L;  1CB5 A;  4BGF A;  2YJ2 A;  3S3R A;  2R9F A;  3K9M A;  2FYE A;  1U9X A;  3CH3 X;  1AYW A;  1EWO A;  4QRX A;  1POP A;  4CDD B;  2GHU A;  1JQP A;  2HH5 A;  2E01 A;  4RY2 A;  2DZZ A;  1AU2 A;  2XU3 A;  2JQF R;  3H6S A;  3S3Q A;  3HHI A;  3LFY A;  3H8B A;  1QMY A;  1MS6 A;  4P6G A;  3OIS A;  4AXL A;  1AYU A;  2R9C A;  2DJG B;  4PP2 E;  1CV8 A;  1EF7 A;  2YJ8 A;  3F75 A;  3I3T A;  3F5V A;  1KFX L;  4K7C A;  3TNX A;  2G8E A;  1YT7 A;  3MTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...