2AUZA

Cathepsin k complexed with a semicarbazone inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Semicarbazone-based inhibitors of cathepsin K, are they prodrugs for aldehyde inhibitors?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2auzA00
3MHHA 1ATKA 1U9WA 2AYNA 2XU5A 1FH0A 3S3QA 4BS6A 4XUIA 3P5WA 4CDEB 2AUXA 1NPZA 3OVXA 1AYVA 2CB5A 1EF7A 2G8JA 4K7CA 1YALA 2PBHA 3MHSA 4YYRA 2OP3A 1AU0A 1AECA 1U9XA 2DC8A 2R9MA 4AXLA 1AYUA 2AYOA 1TL9A 3N3KA 1DF0A 1QXPA 2XU1A 3IEJA 2YJ2A 5F02A 1STFE 3WXEA 3P5VA 2PREA 1Q6KA 2F1GA 3LFYA 3I3TA 2G7YA 1EWMA 1QDQA 2ATOA 2XU3A 2YJ8A 4N4ZA 4W5CA 4Q8HA 1BY8A 4YYSA 1PBHA 2P7UA 3D6SA 1AU2A 4DMXA 1ICFA 1AU4A 1IWDA 1AU3A 3IHPA 5CVMA 1BQIA 4QH6A 2PNSA 1KHPA 3QT4A 2HXZA 2DC6A 3H6SA 2NQIA 3IMAA 1Y4HA 4P6GA 2BDLA 1M6DA 3AI8A 1YT7A 1CPJA 3GCBA 2B1MA 4PADA 4P6EA 3S3RA 2O6XA 1NL6A 2FO5A 4YYWA 1Y08A 2JQGR 3M99A 1NB5A 1BGOA 2YJCA 2DC9A 5EF4A 3P5UA 3BC3A 5CVOB 5CVNB 2R6NA 1VJVA 1NB3A 1TU6A 2H7JA 5FPWA 1SP4B 2YJ9A 1F2BA 1PXVA 3KWBX 2FYEA 2R9NA 2CIOA 3F5VA 9PAPA 2R9CA 3CBKA 1U5IA 1AIMA 1U9VA 1PPDA 2NQDB 4OEMA 4YVAA 4ZUXU 3NHEA 2ARYA 3RVXA 3CH3X 1MIRA 3HHIA 3OF9A 4CZWA 3PDFA 2GHUA 3CBJA 2F7DA 2DCCA 2DJGB 5JH3A 2XU4A 3KSEA 2IBIA 1ME4A 3V6EA 3K24A 4N8WA 4YYQA 3E1ZB 3H8CA 1PPNA 4KLBA 4QBBA 1KFXL 3ERVA 3H8BA 2OULA 2VHSA 4QRGA 2AIMA 1JQPA 4Q8GA 2E02A 1U9QX 4PP1A 1GLOA 3QSDA 1GMYA 1HUCB 1CB5A 2B1NA 3RVVA 1PIPA 4OELA 3K9MA 2AVWA 3I06A 3MORA 1A6RA 1NQCA 3PBHA 2DCDA 4BS5A 2G8EA 1MEMA 2DJFB 1GCBA 1MEGA 2FTDA 3WXFA 2HHNA 2E03A 4I07A 1O0EA 2R9OA 4AXMA 6PADA 1MS6A 2AS8A 5A24A 1PPPA 3QJ3A 3PNRA 4BSQA 3LXSA 2VHFA 3KX1A 2NQAA 3N4CA 4G54A 3P5XA 3OF8A 2HD5A 4PP2E 1F29A 1XKGA 1CQDA 1TLOA 4FIPA 1PADA 5K16A 2DZZA 4W4UA 4QRXA 3WXGA 2AU1A 4QRVA 3V6CA 1S4VA 4I04A 1PPOA 1EWOA 2DC7A 3KKUA 1AYWA 1MDWA 2E00A 4CDFB 4CDDB 1NLJA 1ZCMA 4X6JA 4X6HA 3OISA 3TNXA 2YJBA 3BOWA 4MSXA 4RY2A 2NQGA 3DF0A 3BCNA 5CHVA 1X9YA 3K8UA 2GFOA 1CJLA 4FK5A 2IPPB 3BPFA 3IOQA 3IUTA 3KWZA 3HD3A 1CTEA 2P86A 1BP4A 2DCBA 4HWYA 3H89A 1PE6A 5PADA 1YK8A 2ACTA 1CSBB 2DCAA 2P0RA 1POPA 4XR7A 2FRAA 1CVZA 5JA7A 5CHTA 3O0UA 3RVWA 4BPVA 1VSNA 4W5BA 4YV8A 1YVBA 2BDZA 4PI3A 1KXRA 1KFUL 4YYUA 3HWNA 1THEA 4N79A 3ZUAA 2C0YA 3CH2X 1SNKA 8PCHA 3F75A 1PCIA 1KHQA 3BPMA 3U8EA 1YK7A 4X6IA 3KFQA 2FUDA 2Y5BA 5J94A 7PCKA 2FRQA 2OZ2A 2JQFR 1EWLA 3H7DA 1ITOA 3N3GA 1K3BB 2DZYA 3MTNA 1MHWA 2Y6EA 4MZSA 1ZIVA 3IV2A 2HH5A 4FJCA 1GECE 1DEUA 2G6DA 3O1GA 1QOLA 3OVZA 1ME3A 3C9EA 2FQ9A 3HHAA 2AUZA 2R9FA 1CV8A 1QMYA 4BQVA 4YYVA 1F2AA 2WBFX 3PW3A 3BWKA 4WA6A 3KW9A 1EWPA 2PADA 1CS8A 2E01A 1F2CA 4DMYA 5EGWA 4MZOA 4CDCB 3USVA 2FT2A 3B79A 4I05A
chains in the Genus database with same CATH superfamily
3E9SA 3MHHA 1ATKA 1U9WA 4RKXA 4M0WA 2AYNA 2XU5A 1FH0A 3S3QA 4BS6A 4XUIA 4RF1A 3P5WA 4CDEB 2AUXA 1NPZA 3OVXA 4RNAA 1AYVA 2CB5A 1EF7A 2G8JA 4K7CA 5EZSA 1YALA 2PBHA 3MHSA 4YYRA 3PSEA 2OP3A 1AU0A 3PHWA 1AECA 1U9XA 2DC8A 2R9MA 3BB7A 2J7QA 4AXLA 1AYUA 2AYOA 1TL9A 3N3KA 1DF0A 1QXPA 2XU1A 3IEJA 4D8EA 3W31A 2YJ2A 5F02A 1STFE 3WXEA 3P5VA 2PREA 1Q6KA 2F1GA 3LFYA 3I3TA 2G7YA 4BOUA 1EWMA 1QDQA 2ATOA 2XU3A 2YJ8A 4N4ZA 4W5CA 2BU3A 4Q8HA 1BY8A 4YYSA 1PBHA 2P7UA 3D6SA 1AU2A 4DMXA 1ICFA 1AU4A 1IWDA 1AU3A 3IHPA 5CVMA 3OQCA 1BQIA 4QH6A 2PNSA 1KHPA 3QT4A 2HXZA 2DC6A 3H6SA 2NQIA 3IMAA 1Y4HA 3O65A 4P6GA 2BDLA 3PHXA 1M6DA 3AI8A 1YT7A 1CPJA 3GCBA 2B1MA 4A5UA 4PADA 4P6EA 3S3RA 2O6XA 4R3DA 1NL6A 2FO5A 4YYWA 1Y08A 2JQGR 3M99A 1NB5A 3RNVA 1BGOA 4XZXA 2YJCA 2DC9A 5EF4A 3P5UA 3BC3A 5CVOB 3PRPA 2HWKA 5CVNB 2R6NA 2DOSA 1VJVA 4GUAA 1NB3A 1TU6A 2H7JA 5FPWA 1SP4B 2YJ9A 1F2BA 1PXVA 3KWBX 2FYEA 1UKFA 2R9NA 2CIOA 3F5VA 9PAPA 2R9CA 3CBKA 1U5IA 1AIMA 1U9VA 1PPDA 2NQDB 4OEMA 4MM3B 4YVAA 3B21A 4ZUXU 5E6JA 3NHEA 2ARYA 3RVXA 3CH3X 1MIRA 3HHIA 3OF9A 4CZWA 3PDFA 2GHUA 3CBJA 2F7DA 2DCCA 2DJGB 5JH3A 2XU4A 3KSEA 2IBIA 1ME4A 4IUMA 3V6EA 3K24A 4N8WA 4YYQA 3E1ZB 3H8CA 4IP3A 1PPNA 4KLBA 4QBBA 1KFXL 3ERVA 3H8BA 2OULA 2VHSA 4QRGA 2AIMA 1JQPA 4Q8GA 2E02A 1U9QX 4PP1A 3MP2A 3BBAA 1GLOA 3QSDA 1GMYA 1HUCB 1CB5A 4BOPA 2B1NA 3RVVA 1PIPA 4OELA 3K9MA 2AVWA 3I06A 3MORA 1A6RA 1NQCA 3PBHA 2DCDA 4BS5A 5EZQA 2G8EA 1MEMA 2DJFB 5JZEA 1GCBA 1MEGA 2JTCA 2FTDA 2JRIA 2FE8A 3WXFA 2HHNA 2E03A 4I07A 1O0EA 2R9OA 4AXMA 4REZA 6PADA 1MS6A 2AS8A 5A24A 1PPPA 3QJ3A 3PNRA 4BSQA 3LXSA 2Z84A 2VHFA 3KX1A 2NQAA 3N4CA 4G54A 3P5XA 3OF8A 2HD5A 4PP2E 1F29A 1XKGA 4D8BA 1CQDA 3W30A 1TLOA 4FIPA 1PADA 5K16A 2DZZA 4W4UA 4QRXA 3PT2A 3WXGA 2AU1A 4QRVA 3V6CA 1S4VA 1YZBA 4I04A 1PPOA 1EWOA 1PVJA 2DC7A 3KKUA 3TRKA 1AYWA 1MDWA 2E00A 4CDFB 4BOSA 4CDDB 1NLJA 5KO3A 1ZCMA 4X6JA 4X6HA 3OISA 3TNXA 2UZJA 2YJBA 3TMPA 3BOWA 4MSXA 4RY2A 2NQGA 3DF0A 3BCNA 5CHVA 3K8UA 1X9YA 2GFOA 1CJLA 4FK5A 2IPPB 3BPFA 3IOQA 3IUTA 3KWZA 4HXDB 4P16A 3HD3A 1CTEA 2P86A 2BTWA 1BP4A 3PRMA 2DCBA 4HWYA 3H89A 1PE6A 5PADA 1YK8A 2ACTA 1CSBB 4BOZA 2DCAA 4OW0A 2P0RA 3BY4A 1POPA 4XR7A 2FRAA 1CVZA 5JA7A 5CHTA 3O0UA 3RVWA 4BPVA 3MJ5A 1VSNA 4W5BA 4YV8A 1YVBA 2BDZA 4PI3A 1KXRA 1KFUL 4YYUA 3HWNA 1THEA 4N79A 3ZNHA 3ZUAA 2C0YA 3CH2X 1SNKA 8PCHA 3F75A 1PCIA 1KHQA 4OVZA 2BTWB 3BPMA 3U8EA 4BOQA 1YK7A 4X6IA 1DKIA 3KFQA 2FUDA 2Y5BA 5J94A 7PCKA 2FRQA 2OZ2A 3IFUA 2JQFR 1EWLA 3H7DA 1ITOA 3N3GA 4ZTBA 4WURA 1K3BB 2DZYA 3MTNA 1MHWA 2Y6EA 4MZSA 1ZIVA 3IV2A 4MI7A 2HH5A 3MTVA 4RF0A 4FJCA 1GECE 1DEUA 2G6DA 3O1GA 2AGAA 1QOLA 3OVZA 1ME3A 3C9EA 2FQ9A 3HHAA 2AUZA 2R9FA 1CV8A 4OVZB 4D8IA 1QMYA 4BQVA 4YYVA 1F2AA 2WBFX 3PW3A 3BWKA 4WA6A 3KW9A 2J7QC 1EWPA 4PT5A 2PADA 3C0RA 1CS8A 2E01A 1F2CA 4DMYA 5EGWA 4MZOA 4CDCB 3PHUA 3USVA 2FT2A 3B79A 4I05A
chains in the Genus database with same CATH topology
3MHHA 1ATKA 1U9WA 2AYNA 2XU5A 1FH0A 3S3QA 4BS6A 4XUIA 3P5WA 4CDEB 2AUXA 1NPZA 3OVXA 4B55A 1AYVA 2CB5A 1EF7A 2G8JA 4K7CA 1YALA 2PBHA 3MHSA 4YYRA 2OP3A 1AU0A 1AECA 1U9XA 2DC8A 2R9MA 4AXLA 1AYUA 2AYOA 1TL9A 3N3KA 1DF0A 1QXPA 2XU1A 3IEJA 2YJ2A 5F02A 1STFE 3WXEA 3P5VA 2PREA 1Q6KA 2F1GA 4BGFA 3LFYA 3I3TA 2G7YA 1EWMA 1QDQA 2ATOA 2XU3A 2YJ8A 4N4ZA 4W5CA 4Q8HA 1BY8A 4YYSA 1PBHA 2P7UA 3D6SA 1AU2A 4DMXA 1ICFA 1AU4A 1IWDA 1AU3A 3IHPA 5CVMA 1BQIA 4QH6A 2PNSA 1KHPA 3QT4A 2HXZA 2DC6A 3H6SA 2NQIA 1E2TA 3IMAA 1Y4HA 4P6GA 2BDLA 1M6DA 3AI8A 1YT7A 1CPJA 3GCBA 2B1MA 4PADA 4P6EA 3S3RA 2O6XA 1NL6A 2FO5A 4YYWA 1Y08A 2JQGR 3M99A 1NB5A 1BGOA 2YJCA 2DC9A 5EF4A 3P5UA 3BC3A 5CVOB 5CVNB 2R6NA 1VJVA 1NB3A 1TU6A 2H7JA 5FPWA 1SP4B 2YJ9A 1F2BA 1PXVA 3KWBX 2FYEA 2R9NA 3LTWA 2CIOA 3F5VA 9PAPA 2R9CA 3CBKA 1U5IA 1AIMA 1U9VA 1PPDA 2NQDB 4OEMA 4YVAA 2VFCA 4ZUXU 3NHEA 2ARYA 3RVXA 3CH3X 1MIRA 3HHIA 3OF9A 4CZWA 3PDFA 2GHUA 3CBJA 2F7DA 2DCCA 2DJGB 5JH3A 2XU4A 3KSEA 2IBIA 1ME4A 3V6EA 3K24A 4N8WA 4YYQA 3E1ZB 3H8CA 1PPNA 4KLBA 4QBBA 1KFXL 3ERVA 3H8BA 2OULA 2VHSA 4QRGA 2AIMA 1JQPA 4Q8GA 2E02A 1U9QX 4PP1A 1GLOA 3QSDA 1GMYA 3D9WA 1HUCB 1CB5A 2B1NA 3RVVA 1PIPA 4OELA 3K9MA 2AVWA 3I06A 3MORA 1A6RA 1NQCA 3PBHA 2DCDA 4BS5A 1GX3A 2G8EA 1MEMA 2DJFB 1GCBA 1MEGA 2FTDA 3WXFA 2HHNA 2E03A 4I07A 2VFBA 1O0EA 2R9OA 4AXMA 6PADA 1MS6A 2AS8A 5A24A 1PPPA 3QJ3A 3PNRA 4BSQA 3LXSA 2VHFA 3KX1A 2NQAA 3N4CA 4G54A 3P5XA 3OF8A 2BSZA 1W5RA 2HD5A 4PP2E 1F29A 1XKGA 1CQDA 1TLOA 4FIPA 1PADA 5K16A 2DZZA 4W4UA 4QRXA 3WXGA 2AU1A 4QRVA 3V6CA 4GUZA 1S4VA 4I04A 4NV7A 1PPOA 1EWOA 2DC7A 3KKUA 1AYWA 1MDWA 2E00A 4CDFB 4CDDB 1NLJA 1ZCMA 4X6JA 4X6HA 3OISA 3TNXA 2YJBA 3BOWA 4MSXA 4RY2A 2NQGA 3DF0A 3BCNA 5CHVA 1X9YA 3K8UA 2GFOA 1CJLA 4FK5A 2IPPB 3BPFA 3IOQA 3IUTA 3KWZA 3HD3A 1W4TA 1CTEA 2P86A 1W6FA 1BP4A 2DCBA 4HWYA 4C5PA 3H89A 1PE6A 5PADA 1YK8A 2ACTA 1CSBB 4NV8A 2DCAA 2P0RA 1POPA 4XR7A 2FRAA 1CVZA 5JA7A 5CHTA 3O0UA 3RVWA 4BPVA 1VSNA 4W5BA 4YV8A 1YVBA 2BDZA 4PI3A 1KXRA 1KFUL 4YYUA 3HWNA 1THEA 4N79A 3ZUAA 2C0YA 3CH2X 1SNKA 8PCHA 3F75A 1PCIA 1KHQA 3BPMA 3U8EA 1YK7A 4X6IA 3KFQA 2FUDA 2Y5BA 5J94A 7PCKA 2FRQA 2OZ2A 2JQFR 1EWLA 3H7DA 1ITOA 3N3GA 1K3BB 2DZYA 3MTNA 1MHWA 2Y6EA 4MZSA 1ZIVA 3IV2A 2HH5A 4FJCA 1GECE 1DEUA 2G6DA 3O1GA 1QOLA 3OVZA 1ME3A 3C9EA 2FQ9A 3HHAA 2AUZA 2R9FA 1CV8A 1QMYA 4BQVA 4YYVA 1F2AA 2WBFX 3PW3A 3BWKA 4WA6A 3KW9A 1EWPA 2PADA 1CS8A 2E01A 1F2CA 4DMYA 5EGWA 4MZOA 4CDCB 3USVA 2FT2A 3B79A 4I05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH A;  1ATK A;  1U9W A;  2AYN A;  2XU5 A;  1FH0 A;  3S3Q A;  4BS6 A;  4XUI A;  3P5W A;  4CDE B;  2AUX A;  1NPZ A;  3OVX A;  1AYV A;  2CB5 A;  1EF7 A;  2G8J A;  4K7C A;  1YAL A;  2PBH A;  3MHS A;  4YYR A;  2OP3 A;  1AU0 A;  1AEC A;  1U9X A;  2DC8 A;  2R9M A;  4AXL A;  1AYU A;  2AYO A;  1TL9 A;  3N3K A;  1DF0 A;  1QXP A;  2XU1 A;  3IEJ A;  2YJ2 A;  5F02 A;  1STF E;  3WXE A;  3P5V A;  2PRE A;  1Q6K A;  2F1G A;  3LFY A;  3I3T A;  2G7Y A;  1EWM A;  1QDQ A;  2ATO A;  2XU3 A;  2YJ8 A;  4N4Z A;  4W5C A;  4Q8H A;  1BY8 A;  4YYS A;  1PBH A;  2P7U A;  3D6S A;  1AU2 A;  4DMX A;  1ICF A;  1AU4 A;  1IWD A;  1AU3 A;  3IHP A;  5CVM A;  1BQI A;  4QH6 A;  2PNS A;  1KHP A;  3QT4 A;  2HXZ A;  2DC6 A;  3H6S A;  2NQI A;  3IMA A;  1Y4H A;  4P6G A;  2BDL A;  1M6D A;  3AI8 A;  1YT7 A;  1CPJ A;  3GCB A;  2B1M A;  4PAD A;  4P6E A;  3S3R A;  2O6X A;  1NL6 A;  2FO5 A;  4YYW A;  1Y08 A;  2JQG R;  3M99 A;  1NB5 A;  1BGO A;  2YJC A;  2DC9 A;  5EF4 A;  3P5U A;  3BC3 A;  5CVO B;  5CVN B;  2R6N A;  1VJV A;  1NB3 A;  1TU6 A;  2H7J A;  5FPW A;  1SP4 B;  2YJ9 A;  1F2B A;  1PXV A;  3KWB X;  2FYE A;  2R9N A;  2CIO A;  3F5V A;  9PAP A;  2R9C A;  3CBK A;  1U5I A;  1AIM A;  1U9V A;  1PPD A;  2NQD B;  4OEM A;  4YVA A;  4ZUX U;  3NHE A;  2ARY A;  3RVX A;  3CH3 X;  1MIR A;  3HHI A;  3OF9 A;  4CZW A;  3PDF A;  2GHU A;  3CBJ A;  2F7D A;  2DCC A;  2DJG B;  5JH3 A;  2XU4 A;  3KSE A;  2IBI A;  1ME4 A;  3V6E A;  3K24 A;  4N8W A;  4YYQ A;  3E1Z B;  3H8C A;  1PPN A;  4KLB A;  4QBB A;  1KFX L;  3ERV A;  3H8B A;  2OUL A;  2VHS A;  4QRG A;  2AIM A;  1JQP A;  4Q8G A;  2E02 A;  1U9Q X;  4PP1 A;  1GLO A;  3QSD A;  1GMY A;  1HUC B;  1CB5 A;  2B1N A;  3RVV A;  1PIP A;  4OEL A;  3K9M A;  2AVW A;  3I06 A;  3MOR A;  1A6R A;  1NQC A;  3PBH A;  2DCD A;  4BS5 A;  2G8E A;  1MEM A;  2DJF B;  1GCB A;  1MEG A;  2FTD A;  3WXF A;  2HHN A;  2E03 A;  4I07 A;  1O0E A;  2R9O A;  4AXM A;  6PAD A;  1MS6 A;  2AS8 A;  5A24 A;  1PPP A;  3QJ3 A;  3PNR A;  4BSQ A;  3LXS A;  2VHF A;  3KX1 A;  2NQA A;  3N4C A;  4G54 A;  3P5X A;  3OF8 A;  2HD5 A;  4PP2 E;  1F29 A;  1XKG A;  1CQD A;  1TLO A;  4FIP A;  1PAD A;  5K16 A;  2DZZ A;  4W4U A;  4QRX A;  3WXG A;  2AU1 A;  4QRV A;  3V6C A;  1S4V A;  4I04 A;  1PPO A;  1EWO A;  2DC7 A;  3KKU A;  1AYW A;  1MDW A;  2E00 A;  4CDF B;  4CDD B;  1NLJ A;  1ZCM A;  4X6J A;  4X6H A;  3OIS A;  3TNX A;  2YJB A;  3BOW A;  4MSX A;  4RY2 A;  2NQG A;  3DF0 A;  3BCN A;  5CHV A;  1X9Y A;  3K8U A;  2GFO A;  1CJL A;  4FK5 A;  2IPP B;  3BPF A;  3IOQ A;  3IUT A;  3KWZ A;  3HD3 A;  1CTE A;  2P86 A;  1BP4 A;  2DCB A;  4HWY A;  3H89 A;  1PE6 A;  5PAD A;  1YK8 A;  2ACT A;  1CSB B;  2DCA A;  2P0R A;  1POP A;  4XR7 A;  2FRA A;  1CVZ A;  5JA7 A;  5CHT A;  3O0U A;  3RVW A;  4BPV A;  1VSN A;  4W5B A;  4YV8 A;  1YVB A;  2BDZ A;  4PI3 A;  1KXR A;  1KFU L;  4YYU A;  3HWN A;  1THE A;  4N79 A;  3ZUA A;  2C0Y A;  3CH2 X;  1SNK A;  8PCH A;  3F75 A;  1PCI A;  1KHQ A;  3BPM A;  3U8E A;  1YK7 A;  4X6I A;  3KFQ A;  2FUD A;  2Y5B A;  5J94 A;  7PCK A;  2FRQ A;  2OZ2 A;  2JQF R;  1EWL A;  3H7D A;  1ITO A;  3N3G A;  1K3B B;  2DZY A;  3MTN A;  1MHW A;  2Y6E A;  4MZS A;  1ZIV A;  3IV2 A;  2HH5 A;  4FJC A;  1GEC E;  1DEU A;  2G6D A;  3O1G A;  1QOL A;  3OVZ A;  1ME3 A;  3C9E A;  2FQ9 A;  3HHA A;  2AUZ A;  2R9F A;  1CV8 A;  1QMY A;  4BQV A;  4YYV A;  1F2A A;  2WBF X;  3PW3 A;  3BWK A;  4WA6 A;  3KW9 A;  1EWP A;  2PAD A;  1CS8 A;  2E01 A;  1F2C A;  4DMY A;  5EGW A;  4MZO A;  4CDC B;  3USV A;  2FT2 A;  3B79 A;  4I05 A; 
#chains in the Genus database with same CATH topology
 3E9S A;  3MHH A;  1ATK A;  1U9W A;  4RKX A;  4M0W A;  2AYN A;  2XU5 A;  1FH0 A;  3S3Q A;  4BS6 A;  4XUI A;  4RF1 A;  3P5W A;  4CDE B;  2AUX A;  1NPZ A;  3OVX A;  4RNA A;  1AYV A;  2CB5 A;  1EF7 A;  2G8J A;  4K7C A;  5EZS A;  1YAL A;  2PBH A;  3MHS A;  4YYR A;  3PSE A;  2OP3 A;  1AU0 A;  3PHW A;  1AEC A;  1U9X A;  2DC8 A;  2R9M A;  3BB7 A;  2J7Q A;  4AXL A;  1AYU A;  2AYO A;  1TL9 A;  3N3K A;  1DF0 A;  1QXP A;  2XU1 A;  3IEJ A;  4D8E A;  3W31 A;  2YJ2 A;  5F02 A;  1STF E;  3WXE A;  3P5V A;  2PRE A;  1Q6K A;  2F1G A;  3LFY A;  3I3T A;  2G7Y A;  4BOU A;  1EWM A;  1QDQ A;  2ATO A;  2XU3 A;  2YJ8 A;  4N4Z A;  4W5C A;  2BU3 A;  4Q8H A;  1BY8 A;  4YYS A;  1PBH A;  2P7U A;  3D6S A;  1AU2 A;  4DMX A;  1ICF A;  1AU4 A;  1IWD A;  1AU3 A;  3IHP A;  5CVM A;  3OQC A;  1BQI A;  4QH6 A;  2PNS A;  1KHP A;  3QT4 A;  2HXZ A;  2DC6 A;  3H6S A;  2NQI A;  3IMA A;  1Y4H A;  3O65 A;  4P6G A;  2BDL A;  3PHX A;  1M6D A;  3AI8 A;  1YT7 A;  1CPJ A;  3GCB A;  2B1M A;  4A5U A;  4PAD A;  4P6E A;  3S3R A;  2O6X A;  4R3D A;  1NL6 A;  2FO5 A;  4YYW A;  1Y08 A;  2JQG R;  3M99 A;  1NB5 A;  3RNV A;  1BGO A;  4XZX A;  2YJC A;  2DC9 A;  5EF4 A;  3P5U A;  3BC3 A;  5CVO B;  3PRP A;  2HWK A;  5CVN B;  2R6N A;  2DOS A;  1VJV A;  4GUA A;  1NB3 A;  1TU6 A;  2H7J A;  5FPW A;  1SP4 B;  2YJ9 A;  1F2B A;  1PXV A;  3KWB X;  2FYE A;  1UKF A;  2R9N A;  2CIO A;  3F5V A;  9PAP A;  2R9C A;  3CBK A;  1U5I A;  1AIM A;  1U9V A;  1PPD A;  2NQD B;  4OEM A;  4MM3 B;  4YVA A;  3B21 A;  4ZUX U;  5E6J A;  3NHE A;  2ARY A;  3RVX A;  3CH3 X;  1MIR A;  3HHI A;  3OF9 A;  4CZW A;  3PDF A;  2GHU A;  3CBJ A;  2F7D A;  2DCC A;  2DJG B;  5JH3 A;  2XU4 A;  3KSE A;  2IBI A;  1ME4 A;  4IUM A;  3V6E A;  3K24 A;  4N8W A;  4YYQ A;  3E1Z B;  3H8C A;  4IP3 A;  1PPN A;  4KLB A;  4QBB A;  1KFX L;  3ERV A;  3H8B A;  2OUL A;  2VHS A;  4QRG A;  2AIM A;  1JQP A;  4Q8G A;  2E02 A;  1U9Q X;  4PP1 A;  3MP2 A;  3BBA A;  1GLO A;  3QSD A;  1GMY A;  1HUC B;  1CB5 A;  4BOP A;  2B1N A;  3RVV A;  1PIP A;  4OEL A;  3K9M A;  2AVW A;  3I06 A;  3MOR A;  1A6R A;  1NQC A;  3PBH A;  2DCD A;  4BS5 A;  5EZQ A;  2G8E A;  1MEM A;  2DJF B;  5JZE A;  1GCB A;  1MEG A;  2JTC A;  2FTD A;  2JRI A;  2FE8 A;  3WXF A;  2HHN A;  2E03 A;  4I07 A;  1O0E A;  2R9O A;  4AXM A;  4REZ A;  6PAD A;  1MS6 A;  2AS8 A;  5A24 A;  1PPP A;  3QJ3 A;  3PNR A;  4BSQ A;  3LXS A;  2Z84 A;  2VHF A;  3KX1 A;  2NQA A;  3N4C A;  4G54 A;  3P5X A;  3OF8 A;  2HD5 A;  4PP2 E;  1F29 A;  1XKG A;  4D8B A;  1CQD A;  3W30 A;  1TLO A;  4FIP A;  1PAD A;  5K16 A;  2DZZ A;  4W4U A;  4QRX A;  3PT2 A;  3WXG A;  2AU1 A;  4QRV A;  3V6C A;  1S4V A;  1YZB A;  4I04 A;  1PPO A;  1EWO A;  1PVJ A;  2DC7 A;  3KKU A;  3TRK A;  1AYW A;  1MDW A;  2E00 A;  4CDF B;  4BOS A;  4CDD B;  1NLJ A;  5KO3 A;  1ZCM A;  4X6J A;  4X6H A;  3OIS A;  3TNX A;  2UZJ A;  2YJB A;  3TMP A;  3BOW A;  4MSX A;  4RY2 A;  2NQG A;  3DF0 A;  3BCN A;  5CHV A;  3K8U A;  1X9Y A;  2GFO A;  1CJL A;  4FK5 A;  2IPP B;  3BPF A;  3IOQ A;  3IUT A;  3KWZ A;  4HXD B;  4P16 A;  3HD3 A;  1CTE A;  2P86 A;  2BTW A;  1BP4 A;  3PRM A;  2DCB A;  4HWY A;  3H89 A;  1PE6 A;  5PAD A;  1YK8 A;  2ACT A;  1CSB B;  4BOZ A;  2DCA A;  4OW0 A;  2P0R A;  3BY4 A;  1POP A;  4XR7 A;  2FRA A;  1CVZ A;  5JA7 A;  5CHT A;  3O0U A;  3RVW A;  4BPV A;  3MJ5 A;  1VSN A;  4W5B A;  4YV8 A;  1YVB A;  2BDZ A;  4PI3 A;  1KXR A;  1KFU L;  4YYU A;  3HWN A;  1THE A;  4N79 A;  3ZNH A;  3ZUA A;  2C0Y A;  3CH2 X;  1SNK A;  8PCH A;  3F75 A;  1PCI A;  1KHQ A;  4OVZ A;  2BTW B;  3BPM A;  3U8E A;  4BOQ A;  1YK7 A;  4X6I A;  1DKI A;  3KFQ A;  2FUD A;  2Y5B A;  5J94 A;  7PCK A;  2FRQ A;  2OZ2 A;  3IFU A;  2JQF R;  1EWL A;  3H7D A;  1ITO A;  3N3G A;  4ZTB A;  4WUR A;  1K3B B;  2DZY A;  3MTN A;  1MHW A;  2Y6E A;  4MZS A;  1ZIV A;  3IV2 A;  4MI7 A;  2HH5 A;  3MTV A;  4RF0 A;  4FJC A;  1GEC E;  1DEU A;  2G6D A;  3O1G A;  2AGA A;  1QOL A;  3OVZ A;  1ME3 A;  3C9E A;  2FQ9 A;  3HHA A;  2AUZ A;  2R9F A;  1CV8 A;  4OVZ B;  4D8I A;  1QMY A;  4BQV A;  4YYV A;  1F2A A;  2WBF X;  3PW3 A;  3BWK A;  4WA6 A;  3KW9 A;  2J7Q C;  1EWP A;  4PT5 A;  2PAD A;  3C0R A;  1CS8 A;  2E01 A;  1F2C A;  4DMY A;  5EGW A;  4MZO A;  4CDC B;  3PHU A;  3USV A;  2FT2 A;  3B79 A;  4I05 A; 
#chains in the Genus database with same CATH homology
 3MHH A;  1ATK A;  1U9W A;  2AYN A;  2XU5 A;  1FH0 A;  3S3Q A;  4BS6 A;  4XUI A;  3P5W A;  4CDE B;  2AUX A;  1NPZ A;  3OVX A;  4B55 A;  1AYV A;  2CB5 A;  1EF7 A;  2G8J A;  4K7C A;  1YAL A;  2PBH A;  3MHS A;  4YYR A;  2OP3 A;  1AU0 A;  1AEC A;  1U9X A;  2DC8 A;  2R9M A;  4AXL A;  1AYU A;  2AYO A;  1TL9 A;  3N3K A;  1DF0 A;  1QXP A;  2XU1 A;  3IEJ A;  2YJ2 A;  5F02 A;  1STF E;  3WXE A;  3P5V A;  2PRE A;  1Q6K A;  2F1G A;  4BGF A;  3LFY A;  3I3T A;  2G7Y A;  1EWM A;  1QDQ A;  2ATO A;  2XU3 A;  2YJ8 A;  4N4Z A;  4W5C A;  4Q8H A;  1BY8 A;  4YYS A;  1PBH A;  2P7U A;  3D6S A;  1AU2 A;  4DMX A;  1ICF A;  1AU4 A;  1IWD A;  1AU3 A;  3IHP A;  5CVM A;  1BQI A;  4QH6 A;  2PNS A;  1KHP A;  3QT4 A;  2HXZ A;  2DC6 A;  3H6S A;  2NQI A;  1E2T A;  3IMA A;  1Y4H A;  4P6G A;  2BDL A;  1M6D A;  3AI8 A;  1YT7 A;  1CPJ A;  3GCB A;  2B1M A;  4PAD A;  4P6E A;  3S3R A;  2O6X A;  1NL6 A;  2FO5 A;  4YYW A;  1Y08 A;  2JQG R;  3M99 A;  1NB5 A;  1BGO A;  2YJC A;  2DC9 A;  5EF4 A;  3P5U A;  3BC3 A;  5CVO B;  5CVN B;  2R6N A;  1VJV A;  1NB3 A;  1TU6 A;  2H7J A;  5FPW A;  1SP4 B;  2YJ9 A;  1F2B A;  1PXV A;  3KWB X;  2FYE A;  2R9N A;  3LTW A;  2CIO A;  3F5V A;  9PAP A;  2R9C A;  3CBK A;  1U5I A;  1AIM A;  1U9V A;  1PPD A;  2NQD B;  4OEM A;  4YVA A;  2VFC A;  4ZUX U;  3NHE A;  2ARY A;  3RVX A;  3CH3 X;  1MIR A;  3HHI A;  3OF9 A;  4CZW A;  3PDF A;  2GHU A;  3CBJ A;  2F7D A;  2DCC A;  2DJG B;  5JH3 A;  2XU4 A;  3KSE A;  2IBI A;  1ME4 A;  3V6E A;  3K24 A;  4N8W A;  4YYQ A;  3E1Z B;  3H8C A;  1PPN A;  4KLB A;  4QBB A;  1KFX L;  3ERV A;  3H8B A;  2OUL A;  2VHS A;  4QRG A;  2AIM A;  1JQP A;  4Q8G A;  2E02 A;  1U9Q X;  4PP1 A;  1GLO A;  3QSD A;  1GMY A;  3D9W A;  1HUC B;  1CB5 A;  2B1N A;  3RVV A;  1PIP A;  4OEL A;  3K9M A;  2AVW A;  3I06 A;  3MOR A;  1A6R A;  1NQC A;  3PBH A;  2DCD A;  4BS5 A;  1GX3 A;  2G8E A;  1MEM A;  2DJF B;  1GCB A;  1MEG A;  2FTD A;  3WXF A;  2HHN A;  2E03 A;  4I07 A;  2VFB A;  1O0E A;  2R9O A;  4AXM A;  6PAD A;  1MS6 A;  2AS8 A;  5A24 A;  1PPP A;  3QJ3 A;  3PNR A;  4BSQ A;  3LXS A;  2VHF A;  3KX1 A;  2NQA A;  3N4C A;  4G54 A;  3P5X A;  3OF8 A;  2BSZ A;  1W5R A;  2HD5 A;  4PP2 E;  1F29 A;  1XKG A;  1CQD A;  1TLO A;  4FIP A;  1PAD A;  5K16 A;  2DZZ A;  4W4U A;  4QRX A;  3WXG A;  2AU1 A;  4QRV A;  3V6C A;  4GUZ A;  1S4V A;  4I04 A;  4NV7 A;  1PPO A;  1EWO A;  2DC7 A;  3KKU A;  1AYW A;  1MDW A;  2E00 A;  4CDF B;  4CDD B;  1NLJ A;  1ZCM A;  4X6J A;  4X6H A;  3OIS A;  3TNX A;  2YJB A;  3BOW A;  4MSX A;  4RY2 A;  2NQG A;  3DF0 A;  3BCN A;  5CHV A;  1X9Y A;  3K8U A;  2GFO A;  1CJL A;  4FK5 A;  2IPP B;  3BPF A;  3IOQ A;  3IUT A;  3KWZ A;  3HD3 A;  1W4T A;  1CTE A;  2P86 A;  1W6F A;  1BP4 A;  2DCB A;  4HWY A;  4C5P A;  3H89 A;  1PE6 A;  5PAD A;  1YK8 A;  2ACT A;  1CSB B;  4NV8 A;  2DCA A;  2P0R A;  1POP A;  4XR7 A;  2FRA A;  1CVZ A;  5JA7 A;  5CHT A;  3O0U A;  3RVW A;  4BPV A;  1VSN A;  4W5B A;  4YV8 A;  1YVB A;  2BDZ A;  4PI3 A;  1KXR A;  1KFU L;  4YYU A;  3HWN A;  1THE A;  4N79 A;  3ZUA A;  2C0Y A;  3CH2 X;  1SNK A;  8PCH A;  3F75 A;  1PCI A;  1KHQ A;  3BPM A;  3U8E A;  1YK7 A;  4X6I A;  3KFQ A;  2FUD A;  2Y5B A;  5J94 A;  7PCK A;  2FRQ A;  2OZ2 A;  2JQF R;  1EWL A;  3H7D A;  1ITO A;  3N3G A;  1K3B B;  2DZY A;  3MTN A;  1MHW A;  2Y6E A;  4MZS A;  1ZIV A;  3IV2 A;  2HH5 A;  4FJC A;  1GEC E;  1DEU A;  2G6D A;  3O1G A;  1QOL A;  3OVZ A;  1ME3 A;  3C9E A;  2FQ9 A;  3HHA A;  2AUZ A;  2R9F A;  1CV8 A;  1QMY A;  4BQV A;  4YYV A;  1F2A A;  2WBF X;  3PW3 A;  3BWK A;  4WA6 A;  3KW9 A;  1EWP A;  2PAD A;  1CS8 A;  2E01 A;  1F2C A;  4DMY A;  5EGW A;  4MZO A;  4CDC B;  3USV A;  2FT2 A;  3B79 A;  4I05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...