2IPPB

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
molecule tags Hydrolase
molecule keywords Cathepsin B
total genus 46
structure length 205
sequence length 205
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ippB00
3RVWA 2P86A 2G8EA 1ATKA 2C0YA 4X6HA 3HHIA 2PREA 3CBJA 4QH6A 1ITOA 4YYWA 3BCNA 4W5BA 2F1GA 1U9XA 4QRXA 1ZCMA 4OELA 1AYWA 4AXMA 5F02A 1VJVA 1QXPA 1EWMA 1CB5A 1Y08A 3WXEA 1MS6A 3H7DA 1ZIVA 1AU0A 3OISA 2PBHA 4W5CA 3V6CA 1AIMA 1STFE 1PPOA 3F75A 2DZZA 5CVMA 1PPNA 3O0UA 3K8UA 4PP1A 4CDEB 4FIPA 3HHAA 3IOQA 2GFOA 3P5VA 1BGOA 5A24A 1Q6KA 1GMYA 2DJFB 3HWNA 1KHQA 1PE6A 2H7JA 2OULA 2B1NA 3PBHA 1YK8A 2P0RA 1GECE 2ARYA 3TNXA 2YJCA 1MHWA 2AU1A 3QT4A 2AVWA 2O6XA 1F2BA 1SP4B 3RVXA 1QMYA 1K3BB 1CV8A 2VHSA 1CQDA 9PAPA 1PADA 3WXGA 1Y4HA 1CS8A 2YJ2A 2OZ2A 3USVA 3P5XA 3ZUAA 1O0EA 2DC8A 2HH5A 3IEJA 4BS5A 3MHSA 3RVVA 3BOWA 5PADA 1PXVA 3BPMA 2AYOA 2HXZA 4YVAA 2HD5A 2CB5A 3KKUA 2DC7A 3F5VA 2DC9A 3KSEA 5EF4A 2FYEA 4WA6A 4PI3A 4BSQA 1PBHA 4HWYA 3D6SA 1IWDA 1YALA 3IUTA 5CVOB 3K9MA 3P5UA 1EF7A 1AYUA 3H8BA 1PPDA 3IV2A 5JH3A 1AECA 4N4ZA 4YYUA 3KW9A 1EWLA 4XR7A 4BQVA 2WBFX 3ERVA 1YK7A 1HUCB 3OVXA 3OF8A 2FRQA 1M6DA 1U5IA 2B1MA 2R9OA 3C9EA 2G8JA 4N8WA 2Y5BA 1BQIA 4DMYA 1POPA 3QSDA 4YYSA 3HD3A 1F29A 3B79A 2DJGB 1EWOA 2FO5A 3KWBX 1NQCA 2AYNA 3H6SA 4OEMA 2DCCA 2P7UA 2HHNA 2FQ9A 1DEUA 4QRVA 2DZYA 1QOLA 2DCBA 4K7CA 1TL9A 1CJLA 2YJ8A 3IMAA 3I06A 5FPWA 2JQFR 4MSXA 2G7YA 2JQGR 1U9QX 2BDLA 3U8EA 1TU6A 1KHPA 2NQIA 2AS8A 2OP3A 1GCBA 2R9MA 4I04A 4YYQA 1U9WA 3KX1A 4FK5A 2F7DA 4MZOA 2G6DA 2E01A 1DF0A 3BWKA 1NLJA 2NQAA 1A6RA 1ICFA 3I3TA 2AUXA 1FH0A 3CBKA 1S4VA 2DC6A 2R9NA 1AU2A 3KWZA 3BPFA 2IPPB 2PNSA 1CSBB 4DMXA 1KFUL 1MEGA 3KFQA 4PADA 1PPPA 2E00A 3DF0A 4BS6A 2IBIA 3H8CA 3M99A 5CHVA 1SNKA 2R9FA 1CTEA 3MTNA 3OVZA 3PDFA 4XUIA 1JQPA 1TLOA 1BY8A 4X6JA 2AUZA 1F2CA 4PP2E 5K16A 3PNRA 1KFXL 3LFYA 2R9CA 2E03A 2NQGA 1GLOA 1VSNA 3N4CA 3PW3A 1YT7A 4YYVA 3P5WA 3GCBA 3MHHA 1NB5A 1QDQA 3CH3X 2NQDB 2YJ9A 4MZSA 4Q8GA 2FTDA 1NB3A 7PCKA 2FUDA 1PCIA 4P6EA 1F2AA 2XU4A 5CHTA 1KXRA 2XU5A 8PCHA 4G54A 3O1GA 3S3QA 3LXSA 3N3KA 1AU3A 4X6IA 2Y6EA 4P6GA 5J94A 4BPVA 3BC3A 4CDCB 2XU1A 4YV8A 5JA7A 4CZWA 1MDWA 5EGWA 2GHUA 1XKGA 1THEA 1CVZA 2ATOA 2VHFA 2XU3A 4N79A 3QJ3A 3K24A 4FJCA 3NHEA 3N3GA 1CPJA 1PIPA 2DCAA 1AU4A 3H89A 2CIOA 2E02A 4Q8HA 1YVBA 4QRGA 2DCDA 4CDFB 4AXLA 2FRAA 1NPZA 2R6NA 4I05A 2FT2A 1MEMA 3CH2X 1AYVA 2PADA 1BP4A 2AIMA 2ACTA 4RY2A 1X9YA 4KLBA 1ME4A 4CDDB 3OF9A 4W4UA 1ME3A 1NL6A 3IHPA 4ZUXU 1U9VA 3AI8A 3S3RA 4I07A 1EWPA 1MIRA 2BDZA 3MORA 5CVNB 4YYRA 4QBBA 3V6EA 6PADA 2YJBA 3E1ZB 3WXFA
chains in the Genus database with same CATH superfamily
3RVWA 2P86A 2G8EA 1ATKA 3OQCA 2C0YA 3PRPA 4X6HA 3HHIA 2PREA 3CBJA 4QH6A 4XZXA 1ITOA 4YYWA 3BCNA 4W5BA 2F1GA 1U9XA 4QRXA 1ZCMA 4OELA 1AYWA 3ZNHA 4AXMA 4RF0A 1VJVA 5F02A 1PVJA 1QXPA 1EWMA 1CB5A 1Y08A 3PRMA 3WXEA 3PSEA 1MS6A 3H7DA 1ZIVA 1AU0A 3OISA 2PBHA 4W5CA 3IFUA 3V6CA 1AIMA 1STFE 1PPOA 3F75A 3MP2A 2DZZA 5CVMA 1PPNA 3O0UA 3K8UA 4PP1A 4CDEB 4FIPA 3HHAA 3IOQA 2GFOA 3P5VA 1BGOA 5A24A 1Q6KA 3RNVA 3E9SA 4WURA 1GMYA 4MM3B 2DJFB 3HWNA 3PT2A 1KHQA 1PE6A 1DKIA 2H7JA 2OULA 2B1NA 2FE8A 3PBHA 2HWKA 3O65A 1YK8A 2P0RA 4GUAA 1GECE 4BOSA 4R3DA 2ARYA 3TNXA 2YJCA 1MHWA 2AU1A 3QT4A 2AVWA 2O6XA 1F2BA 1SP4B 3RVXA 4RKXA 1QMYA 1K3BB 4REZA 2DOSA 1CV8A 2VHSA 1CQDA 2AGAA 1PADA 9PAPA 3WXGA 1Y4HA 1CS8A 2YJ2A 4D8BA 2OZ2A 3USVA 3P5XA 3ZUAA 1O0EA 2DC8A 4BOUA 2HH5A 3IEJA 4BS5A 2BTWB 3MHSA 3RVVA 3BOWA 5PADA 1PXVA 2BU3A 3BPMA 2JTCA 2AYOA 2HXZA 4YVAA 4ZTBA 2HD5A 2CB5A 3KKUA 2DC7A 3F5VA 2DC9A 3KSEA 5EF4A 2FYEA 4P16A 4WA6A 4PI3A 4BSQA 1PBHA 4HWYA 3D6SA 1IWDA 1YALA 3IUTA 5CVOB 3W31A 2Z84A 2J7QA 3K9MA 2JRIA 3P5UA 3BY4A 1EF7A 1AYUA 3H8BA 1PPDA 4BOQA 3IV2A 5JH3A 1AECA 4N4ZA 4YYUA 3KW9A 1EWLA 4XR7A 4BQVA 2WBFX 3ERVA 1YK7A 1HUCB 3OVXA 3OF8A 2FRQA 1M6DA 1U5IA 2B1MA 2R9OA 3TRKA 3C9EA 2G8JA 4N8WA 2Y5BA 1BQIA 4DMYA 1POPA 3QSDA 4YYSA 3HD3A 1F29A 3B79A 2DJGB 1EWOA 4D8IA 2FO5A 3KWBX 1NQCA 2AYNA 3H6SA 4OEMA 2DCCA 5EZSA 1YZBA 2P7UA 2HHNA 2FQ9A 1DEUA 2DZYA 4QRVA 1QOLA 2J7QC 2DCBA 4K7CA 1TL9A 1CJLA 2YJ8A 3IMAA 3I06A 5FPWA 2JQFR 4RNAA 4MSXA 2G7YA 2JQGR 3PHWA 4IUMA 1U9QX 2BDLA 3U8EA 1TU6A 1KHPA 2NQIA 2AS8A 2OP3A 1GCBA 2R9MA 4I04A 4YYQA 1U9WA 3KX1A 3BB7A 4FK5A 2F7DA 4MZOA 2G6DA 2E01A 1DF0A 3BWKA 4BOPA 1NLJA 2NQAA 1A6RA 1ICFA 3I3TA 2AUXA 1FH0A 3CBKA 1S4VA 2DC6A 2R9NA 1AU2A 3KWZA 3BPFA 2IPPB 2PNSA 1CSBB 4OW0A 4DMXA 1KFUL 1MEGA 3KFQA 4PADA 1PPPA 2E00A 3DF0A 4BS6A 2IBIA 3H8CA 4IP3A 4PT5A 3M99A 3B21A 5CHVA 4M0WA 4HXDB 1SNKA 2R9FA 1CTEA 3MTNA 3OVZA 3MJ5A 3PDFA 3TMPA 4XUIA 1JQPA 1TLOA 1BY8A 3PHUA 4X6JA 3C0RA 2AUZA 1F2CA 4PP2E 4OVZB 5K16A 3PNRA 1KFXL 3LFYA 1UKFA 2BTWA 2R9CA 2E03A 2NQGA 1GLOA 1VSNA 3N4CA 3PW3A 1YT7A 4YYVA 3MTVA 3P5WA 3GCBA 3MHHA 1NB5A 1QDQA 3CH3X 2NQDB 2YJ9A 4MZSA 4Q8GA 2FTDA 4A5UA 1NB3A 7PCKA 2FUDA 1PCIA 4P6EA 1F2AA 2XU4A 5CHTA 1KXRA 2XU5A 8PCHA 4G54A 3O1GA 3S3QA 3LXSA 3N3KA 1AU3A 4X6IA 2Y6EA 5E6JA 4P6GA 5J94A 4BPVA 3BC3A 4CDCB 2XU1A 4YV8A 5JA7A 4CZWA 5JZEA 1MDWA 5EGWA 2GHUA 1XKGA 1THEA 1CVZA 2ATOA 2VHFA 2XU3A 4N79A 4BOZA 3QJ3A 3K24A 4RF1A 4FJCA 3NHEA 3N3GA 1CPJA 1PIPA 4D8EA 2DCAA 1AU4A 3H89A 2CIOA 2E02A 4Q8HA 4MI7A 1YVBA 4QRGA 2DCDA 4CDFB 4AXLA 2FRAA 1NPZA 2R6NA 4I05A 2FT2A 4OVZA 1MEMA 3CH2X 3PHXA 1AYVA 2PADA 1BP4A 2AIMA 2ACTA 4RY2A 1X9YA 4KLBA 1ME4A 4CDDB 3OF9A 4W4UA 1ME3A 1NL6A 3IHPA 5KO3A 3BBAA 4ZUXU 1U9VA 3AI8A 3S3RA 5EZQA 4I07A 1EWPA 1MIRA 2BDZA 3W30A 3MORA 5CVNB 4YYRA 4QBBA 3V6EA 6PADA 2YJBA 3E1ZB 2UZJA 3WXFA
chains in the Genus database with same CATH topology
3RVWA 2P86A 2G8EA 1ATKA 2C0YA 4X6HA 3HHIA 2PREA 3CBJA 4QH6A 1ITOA 4YYWA 3BCNA 4W5BA 2F1GA 1U9XA 4QRXA 1ZCMA 4OELA 1AYWA 4AXMA 5F02A 1VJVA 1QXPA 1EWMA 1CB5A 1Y08A 3WXEA 1MS6A 3H7DA 1ZIVA 1AU0A 3OISA 2PBHA 4W5CA 3V6CA 1AIMA 1STFE 1PPOA 3F75A 2DZZA 5CVMA 1PPNA 3O0UA 3K8UA 4PP1A 4CDEB 4FIPA 3HHAA 3IOQA 2GFOA 3P5VA 1BGOA 1W5RA 5A24A 1Q6KA 2VFBA 1GMYA 2DJFB 3HWNA 1KHQA 1PE6A 2H7JA 2OULA 2B1NA 3PBHA 1YK8A 2P0RA 1GECE 2ARYA 3TNXA 2YJCA 1MHWA 2AU1A 3QT4A 2AVWA 2O6XA 4GUZA 1F2BA 1SP4B 3RVXA 1QMYA 1K3BB 1CV8A 2VHSA 1CQDA 9PAPA 1PADA 3WXGA 1Y4HA 1CS8A 2YJ2A 2OZ2A 3USVA 3P5XA 3ZUAA 4NV7A 1O0EA 2DC8A 2HH5A 3IEJA 4BS5A 3MHSA 3RVVA 3BOWA 5PADA 1PXVA 3BPMA 2AYOA 2HXZA 4YVAA 2HD5A 3LTWA 2CB5A 3KKUA 1W4TA 2DC7A 3F5VA 2DC9A 3KSEA 4BGFA 5EF4A 2FYEA 4WA6A 4PI3A 4BSQA 1PBHA 4HWYA 3D6SA 1IWDA 1YALA 3IUTA 5CVOB 3K9MA 3P5UA 1EF7A 1AYUA 3H8BA 1PPDA 3IV2A 5JH3A 1AECA 2BSZA 4N4ZA 4YYUA 3KW9A 1EWLA 4XR7A 4BQVA 2WBFX 3ERVA 1YK7A 2VFCA 1HUCB 3OVXA 3OF8A 2FRQA 1M6DA 1U5IA 1E2TA 2B1MA 2R9OA 3C9EA 2G8JA 4N8WA 2Y5BA 1BQIA 4DMYA 1POPA 3QSDA 4YYSA 3HD3A 1F29A 3B79A 2DJGB 1EWOA 2FO5A 3KWBX 1NQCA 2AYNA 3H6SA 4OEMA 2DCCA 2P7UA 2HHNA 2FQ9A 1DEUA 4QRVA 2DZYA 1QOLA 2DCBA 4K7CA 1TL9A 1CJLA 2YJ8A 3IMAA 3I06A 5FPWA 2JQFR 4MSXA 2G7YA 2JQGR 1U9QX 2BDLA 3U8EA 1TU6A 1KHPA 2NQIA 2AS8A 2OP3A 1GCBA 2R9MA 4I04A 4YYQA 1U9WA 3KX1A 4FK5A 2F7DA 4MZOA 2G6DA 2E01A 1DF0A 3BWKA 1NLJA 2NQAA 1A6RA 1ICFA 3I3TA 2AUXA 1FH0A 3CBKA 1S4VA 3D9WA 2DC6A 2R9NA 1AU2A 3KWZA 3BPFA 2IPPB 2PNSA 1CSBB 4DMXA 1KFUL 1MEGA 3KFQA 4PADA 1PPPA 2E00A 3DF0A 4BS6A 2IBIA 3H8CA 3M99A 5CHVA 1SNKA 2R9FA 1CTEA 3MTNA 3OVZA 3PDFA 4XUIA 1JQPA 1TLOA 1BY8A 4NV8A 4X6JA 2AUZA 1F2CA 4PP2E 5K16A 3PNRA 1KFXL 3LFYA 2R9CA 2E03A 2NQGA 1GLOA 1VSNA 3N4CA 3PW3A 1YT7A 4YYVA 3P5WA 3GCBA 3MHHA 1NB5A 1QDQA 3CH3X 2NQDB 2YJ9A 4MZSA 4Q8GA 2FTDA 1NB3A 7PCKA 2FUDA 1PCIA 4P6EA 1F2AA 2XU4A 5CHTA 1KXRA 2XU5A 8PCHA 4G54A 3O1GA 3S3QA 3LXSA 3N3KA 1AU3A 4X6IA 2Y6EA 4P6GA 5J94A 4BPVA 3BC3A 4CDCB 2XU1A 4YV8A 5JA7A 4CZWA 1MDWA 5EGWA 2GHUA 1XKGA 1THEA 1CVZA 2ATOA 2VHFA 2XU3A 1GX3A 4N79A 3QJ3A 3K24A 4FJCA 3NHEA 3N3GA 1CPJA 1PIPA 2DCAA 1AU4A 3H89A 2CIOA 2E02A 4Q8HA 4C5PA 1YVBA 4QRGA 2DCDA 4CDFB 4AXLA 2FRAA 1NPZA 2R6NA 4I05A 2FT2A 1MEMA 3CH2X 1AYVA 2PADA 1BP4A 2AIMA 2ACTA 4RY2A 1X9YA 4KLBA 1ME4A 4CDDB 3OF9A 4W4UA 1ME3A 1NL6A 3IHPA 4B55A 4ZUXU 1U9VA 1W6FA 3AI8A 3S3RA 4I07A 1EWPA 1MIRA 2BDZA 3MORA 5CVNB 4YYRA 4QBBA 3V6EA 6PADA 2YJBA 3E1ZB 3WXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVW A;  2P86 A;  2G8E A;  1ATK A;  2C0Y A;  4X6H A;  3HHI A;  2PRE A;  3CBJ A;  4QH6 A;  1ITO A;  4YYW A;  3BCN A;  4W5B A;  2F1G A;  1U9X A;  4QRX A;  1ZCM A;  4OEL A;  1AYW A;  4AXM A;  5F02 A;  1VJV A;  1QXP A;  1EWM A;  1CB5 A;  1Y08 A;  3WXE A;  1MS6 A;  3H7D A;  1ZIV A;  1AU0 A;  3OIS A;  2PBH A;  4W5C A;  3V6C A;  1AIM A;  1STF E;  1PPO A;  3F75 A;  2DZZ A;  5CVM A;  1PPN A;  3O0U A;  3K8U A;  4PP1 A;  4CDE B;  4FIP A;  3HHA A;  3IOQ A;  2GFO A;  3P5V A;  1BGO A;  5A24 A;  1Q6K A;  1GMY A;  2DJF B;  3HWN A;  1KHQ A;  1PE6 A;  2H7J A;  2OUL A;  2B1N A;  3PBH A;  1YK8 A;  2P0R A;  1GEC E;  2ARY A;  3TNX A;  2YJC A;  1MHW A;  2AU1 A;  3QT4 A;  2AVW A;  2O6X A;  1F2B A;  1SP4 B;  3RVX A;  1QMY A;  1K3B B;  1CV8 A;  2VHS A;  1CQD A;  9PAP A;  1PAD A;  3WXG A;  1Y4H A;  1CS8 A;  2YJ2 A;  2OZ2 A;  3USV A;  3P5X A;  3ZUA A;  1O0E A;  2DC8 A;  2HH5 A;  3IEJ A;  4BS5 A;  3MHS A;  3RVV A;  3BOW A;  5PAD A;  1PXV A;  3BPM A;  2AYO A;  2HXZ A;  4YVA A;  2HD5 A;  2CB5 A;  3KKU A;  2DC7 A;  3F5V A;  2DC9 A;  3KSE A;  5EF4 A;  2FYE A;  4WA6 A;  4PI3 A;  4BSQ A;  1PBH A;  4HWY A;  3D6S A;  1IWD A;  1YAL A;  3IUT A;  5CVO B;  3K9M A;  3P5U A;  1EF7 A;  1AYU A;  3H8B A;  1PPD A;  3IV2 A;  5JH3 A;  1AEC A;  4N4Z A;  4YYU A;  3KW9 A;  1EWL A;  4XR7 A;  4BQV A;  2WBF X;  3ERV A;  1YK7 A;  1HUC B;  3OVX A;  3OF8 A;  2FRQ A;  1M6D A;  1U5I A;  2B1M A;  2R9O A;  3C9E A;  2G8J A;  4N8W A;  2Y5B A;  1BQI A;  4DMY A;  1POP A;  3QSD A;  4YYS A;  3HD3 A;  1F29 A;  3B79 A;  2DJG B;  1EWO A;  2FO5 A;  3KWB X;  1NQC A;  2AYN A;  3H6S A;  4OEM A;  2DCC A;  2P7U A;  2HHN A;  2FQ9 A;  1DEU A;  4QRV A;  2DZY A;  1QOL A;  2DCB A;  4K7C A;  1TL9 A;  1CJL A;  2YJ8 A;  3IMA A;  3I06 A;  5FPW A;  2JQF R;  4MSX A;  2G7Y A;  2JQG R;  1U9Q X;  2BDL A;  3U8E A;  1TU6 A;  1KHP A;  2NQI A;  2AS8 A;  2OP3 A;  1GCB A;  2R9M A;  4I04 A;  4YYQ A;  1U9W A;  3KX1 A;  4FK5 A;  2F7D A;  4MZO A;  2G6D A;  2E01 A;  1DF0 A;  3BWK A;  1NLJ A;  2NQA A;  1A6R A;  1ICF A;  3I3T A;  2AUX A;  1FH0 A;  3CBK A;  1S4V A;  2DC6 A;  2R9N A;  1AU2 A;  3KWZ A;  3BPF A;  2IPP B;  2PNS A;  1CSB B;  4DMX A;  1KFU L;  1MEG A;  3KFQ A;  4PAD A;  1PPP A;  2E00 A;  3DF0 A;  4BS6 A;  2IBI A;  3H8C A;  3M99 A;  5CHV A;  1SNK A;  2R9F A;  1CTE A;  3MTN A;  3OVZ A;  3PDF A;  4XUI A;  1JQP A;  1TLO A;  1BY8 A;  4X6J A;  2AUZ A;  1F2C A;  4PP2 E;  5K16 A;  3PNR A;  1KFX L;  3LFY A;  2R9C A;  2E03 A;  2NQG A;  1GLO A;  1VSN A;  3N4C A;  3PW3 A;  1YT7 A;  4YYV A;  3P5W A;  3GCB A;  3MHH A;  1NB5 A;  1QDQ A;  3CH3 X;  2NQD B;  2YJ9 A;  4MZS A;  4Q8G A;  2FTD A;  1NB3 A;  7PCK A;  2FUD A;  1PCI A;  4P6E A;  1F2A A;  2XU4 A;  5CHT A;  1KXR A;  2XU5 A;  8PCH A;  4G54 A;  3O1G A;  3S3Q A;  3LXS A;  3N3K A;  1AU3 A;  4X6I A;  2Y6E A;  4P6G A;  5J94 A;  4BPV A;  3BC3 A;  4CDC B;  2XU1 A;  4YV8 A;  5JA7 A;  4CZW A;  1MDW A;  5EGW A;  2GHU A;  1XKG A;  1THE A;  1CVZ A;  2ATO A;  2VHF A;  2XU3 A;  4N79 A;  3QJ3 A;  3K24 A;  4FJC A;  3NHE A;  3N3G A;  1CPJ A;  1PIP A;  2DCA A;  1AU4 A;  3H89 A;  2CIO A;  2E02 A;  4Q8H A;  1YVB A;  4QRG A;  2DCD A;  4CDF B;  4AXL A;  2FRA A;  1NPZ A;  2R6N A;  4I05 A;  2FT2 A;  1MEM A;  3CH2 X;  1AYV A;  2PAD A;  1BP4 A;  2AIM A;  2ACT A;  4RY2 A;  1X9Y A;  4KLB A;  1ME4 A;  4CDD B;  3OF9 A;  4W4U A;  1ME3 A;  1NL6 A;  3IHP A;  4ZUX U;  1U9V A;  3AI8 A;  3S3R A;  4I07 A;  1EWP A;  1MIR A;  2BDZ A;  3MOR A;  5CVN B;  4YYR A;  4QBB A;  3V6E A;  6PAD A;  2YJB A;  3E1Z B;  3WXF A; 
#chains in the Genus database with same CATH topology
 3RVW A;  2P86 A;  2G8E A;  1ATK A;  3OQC A;  2C0Y A;  3PRP A;  4X6H A;  3HHI A;  2PRE A;  3CBJ A;  4QH6 A;  4XZX A;  1ITO A;  4YYW A;  3BCN A;  4W5B A;  2F1G A;  1U9X A;  4QRX A;  1ZCM A;  4OEL A;  1AYW A;  3ZNH A;  4AXM A;  4RF0 A;  1VJV A;  5F02 A;  1PVJ A;  1QXP A;  1EWM A;  1CB5 A;  1Y08 A;  3PRM A;  3WXE A;  3PSE A;  1MS6 A;  3H7D A;  1ZIV A;  1AU0 A;  3OIS A;  2PBH A;  4W5C A;  3IFU A;  3V6C A;  1AIM A;  1STF E;  1PPO A;  3F75 A;  3MP2 A;  2DZZ A;  5CVM A;  1PPN A;  3O0U A;  3K8U A;  4PP1 A;  4CDE B;  4FIP A;  3HHA A;  3IOQ A;  2GFO A;  3P5V A;  1BGO A;  5A24 A;  1Q6K A;  3RNV A;  3E9S A;  4WUR A;  1GMY A;  4MM3 B;  2DJF B;  3HWN A;  3PT2 A;  1KHQ A;  1PE6 A;  1DKI A;  2H7J A;  2OUL A;  2B1N A;  2FE8 A;  3PBH A;  2HWK A;  3O65 A;  1YK8 A;  2P0R A;  4GUA A;  1GEC E;  4BOS A;  4R3D A;  2ARY A;  3TNX A;  2YJC A;  1MHW A;  2AU1 A;  3QT4 A;  2AVW A;  2O6X A;  1F2B A;  1SP4 B;  3RVX A;  4RKX A;  1QMY A;  1K3B B;  4REZ A;  2DOS A;  1CV8 A;  2VHS A;  1CQD A;  2AGA A;  1PAD A;  9PAP A;  3WXG A;  1Y4H A;  1CS8 A;  2YJ2 A;  4D8B A;  2OZ2 A;  3USV A;  3P5X A;  3ZUA A;  1O0E A;  2DC8 A;  4BOU A;  2HH5 A;  3IEJ A;  4BS5 A;  2BTW B;  3MHS A;  3RVV A;  3BOW A;  5PAD A;  1PXV A;  2BU3 A;  3BPM A;  2JTC A;  2AYO A;  2HXZ A;  4YVA A;  4ZTB A;  2HD5 A;  2CB5 A;  3KKU A;  2DC7 A;  3F5V A;  2DC9 A;  3KSE A;  5EF4 A;  2FYE A;  4P16 A;  4WA6 A;  4PI3 A;  4BSQ A;  1PBH A;  4HWY A;  3D6S A;  1IWD A;  1YAL A;  3IUT A;  5CVO B;  3W31 A;  2Z84 A;  2J7Q A;  3K9M A;  2JRI A;  3P5U A;  3BY4 A;  1EF7 A;  1AYU A;  3H8B A;  1PPD A;  4BOQ A;  3IV2 A;  5JH3 A;  1AEC A;  4N4Z A;  4YYU A;  3KW9 A;  1EWL A;  4XR7 A;  4BQV A;  2WBF X;  3ERV A;  1YK7 A;  1HUC B;  3OVX A;  3OF8 A;  2FRQ A;  1M6D A;  1U5I A;  2B1M A;  2R9O A;  3TRK A;  3C9E A;  2G8J A;  4N8W A;  2Y5B A;  1BQI A;  4DMY A;  1POP A;  3QSD A;  4YYS A;  3HD3 A;  1F29 A;  3B79 A;  2DJG B;  1EWO A;  4D8I A;  2FO5 A;  3KWB X;  1NQC A;  2AYN A;  3H6S A;  4OEM A;  2DCC A;  5EZS A;  1YZB A;  2P7U A;  2HHN A;  2FQ9 A;  1DEU A;  2DZY A;  4QRV A;  1QOL A;  2J7Q C;  2DCB A;  4K7C A;  1TL9 A;  1CJL A;  2YJ8 A;  3IMA A;  3I06 A;  5FPW A;  2JQF R;  4RNA A;  4MSX A;  2G7Y A;  2JQG R;  3PHW A;  4IUM A;  1U9Q X;  2BDL A;  3U8E A;  1TU6 A;  1KHP A;  2NQI A;  2AS8 A;  2OP3 A;  1GCB A;  2R9M A;  4I04 A;  4YYQ A;  1U9W A;  3KX1 A;  3BB7 A;  4FK5 A;  2F7D A;  4MZO A;  2G6D A;  2E01 A;  1DF0 A;  3BWK A;  4BOP A;  1NLJ A;  2NQA A;  1A6R A;  1ICF A;  3I3T A;  2AUX A;  1FH0 A;  3CBK A;  1S4V A;  2DC6 A;  2R9N A;  1AU2 A;  3KWZ A;  3BPF A;  2IPP B;  2PNS A;  1CSB B;  4OW0 A;  4DMX A;  1KFU L;  1MEG A;  3KFQ A;  4PAD A;  1PPP A;  2E00 A;  3DF0 A;  4BS6 A;  2IBI A;  3H8C A;  4IP3 A;  4PT5 A;  3M99 A;  3B21 A;  5CHV A;  4M0W A;  4HXD B;  1SNK A;  2R9F A;  1CTE A;  3MTN A;  3OVZ A;  3MJ5 A;  3PDF A;  3TMP A;  4XUI A;  1JQP A;  1TLO A;  1BY8 A;  3PHU A;  4X6J A;  3C0R A;  2AUZ A;  1F2C A;  4PP2 E;  4OVZ B;  5K16 A;  3PNR A;  1KFX L;  3LFY A;  1UKF A;  2BTW A;  2R9C A;  2E03 A;  2NQG A;  1GLO A;  1VSN A;  3N4C A;  3PW3 A;  1YT7 A;  4YYV A;  3MTV A;  3P5W A;  3GCB A;  3MHH A;  1NB5 A;  1QDQ A;  3CH3 X;  2NQD B;  2YJ9 A;  4MZS A;  4Q8G A;  2FTD A;  4A5U A;  1NB3 A;  7PCK A;  2FUD A;  1PCI A;  4P6E A;  1F2A A;  2XU4 A;  5CHT A;  1KXR A;  2XU5 A;  8PCH A;  4G54 A;  3O1G A;  3S3Q A;  3LXS A;  3N3K A;  1AU3 A;  4X6I A;  2Y6E A;  5E6J A;  4P6G A;  5J94 A;  4BPV A;  3BC3 A;  4CDC B;  2XU1 A;  4YV8 A;  5JA7 A;  4CZW A;  5JZE A;  1MDW A;  5EGW A;  2GHU A;  1XKG A;  1THE A;  1CVZ A;  2ATO A;  2VHF A;  2XU3 A;  4N79 A;  4BOZ A;  3QJ3 A;  3K24 A;  4RF1 A;  4FJC A;  3NHE A;  3N3G A;  1CPJ A;  1PIP A;  4D8E A;  2DCA A;  1AU4 A;  3H89 A;  2CIO A;  2E02 A;  4Q8H A;  4MI7 A;  1YVB A;  4QRG A;  2DCD A;  4CDF B;  4AXL A;  2FRA A;  1NPZ A;  2R6N A;  4I05 A;  2FT2 A;  4OVZ A;  1MEM A;  3CH2 X;  3PHX A;  1AYV A;  2PAD A;  1BP4 A;  2AIM A;  2ACT A;  4RY2 A;  1X9Y A;  4KLB A;  1ME4 A;  4CDD B;  3OF9 A;  4W4U A;  1ME3 A;  1NL6 A;  3IHP A;  5KO3 A;  3BBA A;  4ZUX U;  1U9V A;  3AI8 A;  3S3R A;  5EZQ A;  4I07 A;  1EWP A;  1MIR A;  2BDZ A;  3W30 A;  3MOR A;  5CVN B;  4YYR A;  4QBB A;  3V6E A;  6PAD A;  2YJB A;  3E1Z B;  2UZJ A;  3WXF A; 
#chains in the Genus database with same CATH homology
 3RVW A;  2P86 A;  2G8E A;  1ATK A;  2C0Y A;  4X6H A;  3HHI A;  2PRE A;  3CBJ A;  4QH6 A;  1ITO A;  4YYW A;  3BCN A;  4W5B A;  2F1G A;  1U9X A;  4QRX A;  1ZCM A;  4OEL A;  1AYW A;  4AXM A;  5F02 A;  1VJV A;  1QXP A;  1EWM A;  1CB5 A;  1Y08 A;  3WXE A;  1MS6 A;  3H7D A;  1ZIV A;  1AU0 A;  3OIS A;  2PBH A;  4W5C A;  3V6C A;  1AIM A;  1STF E;  1PPO A;  3F75 A;  2DZZ A;  5CVM A;  1PPN A;  3O0U A;  3K8U A;  4PP1 A;  4CDE B;  4FIP A;  3HHA A;  3IOQ A;  2GFO A;  3P5V A;  1BGO A;  1W5R A;  5A24 A;  1Q6K A;  2VFB A;  1GMY A;  2DJF B;  3HWN A;  1KHQ A;  1PE6 A;  2H7J A;  2OUL A;  2B1N A;  3PBH A;  1YK8 A;  2P0R A;  1GEC E;  2ARY A;  3TNX A;  2YJC A;  1MHW A;  2AU1 A;  3QT4 A;  2AVW A;  2O6X A;  4GUZ A;  1F2B A;  1SP4 B;  3RVX A;  1QMY A;  1K3B B;  1CV8 A;  2VHS A;  1CQD A;  9PAP A;  1PAD A;  3WXG A;  1Y4H A;  1CS8 A;  2YJ2 A;  2OZ2 A;  3USV A;  3P5X A;  3ZUA A;  4NV7 A;  1O0E A;  2DC8 A;  2HH5 A;  3IEJ A;  4BS5 A;  3MHS A;  3RVV A;  3BOW A;  5PAD A;  1PXV A;  3BPM A;  2AYO A;  2HXZ A;  4YVA A;  2HD5 A;  3LTW A;  2CB5 A;  3KKU A;  1W4T A;  2DC7 A;  3F5V A;  2DC9 A;  3KSE A;  4BGF A;  5EF4 A;  2FYE A;  4WA6 A;  4PI3 A;  4BSQ A;  1PBH A;  4HWY A;  3D6S A;  1IWD A;  1YAL A;  3IUT A;  5CVO B;  3K9M A;  3P5U A;  1EF7 A;  1AYU A;  3H8B A;  1PPD A;  3IV2 A;  5JH3 A;  1AEC A;  2BSZ A;  4N4Z A;  4YYU A;  3KW9 A;  1EWL A;  4XR7 A;  4BQV A;  2WBF X;  3ERV A;  1YK7 A;  2VFC A;  1HUC B;  3OVX A;  3OF8 A;  2FRQ A;  1M6D A;  1U5I A;  1E2T A;  2B1M A;  2R9O A;  3C9E A;  2G8J A;  4N8W A;  2Y5B A;  1BQI A;  4DMY A;  1POP A;  3QSD A;  4YYS A;  3HD3 A;  1F29 A;  3B79 A;  2DJG B;  1EWO A;  2FO5 A;  3KWB X;  1NQC A;  2AYN A;  3H6S A;  4OEM A;  2DCC A;  2P7U A;  2HHN A;  2FQ9 A;  1DEU A;  4QRV A;  2DZY A;  1QOL A;  2DCB A;  4K7C A;  1TL9 A;  1CJL A;  2YJ8 A;  3IMA A;  3I06 A;  5FPW A;  2JQF R;  4MSX A;  2G7Y A;  2JQG R;  1U9Q X;  2BDL A;  3U8E A;  1TU6 A;  1KHP A;  2NQI A;  2AS8 A;  2OP3 A;  1GCB A;  2R9M A;  4I04 A;  4YYQ A;  1U9W A;  3KX1 A;  4FK5 A;  2F7D A;  4MZO A;  2G6D A;  2E01 A;  1DF0 A;  3BWK A;  1NLJ A;  2NQA A;  1A6R A;  1ICF A;  3I3T A;  2AUX A;  1FH0 A;  3CBK A;  1S4V A;  3D9W A;  2DC6 A;  2R9N A;  1AU2 A;  3KWZ A;  3BPF A;  2IPP B;  2PNS A;  1CSB B;  4DMX A;  1KFU L;  1MEG A;  3KFQ A;  4PAD A;  1PPP A;  2E00 A;  3DF0 A;  4BS6 A;  2IBI A;  3H8C A;  3M99 A;  5CHV A;  1SNK A;  2R9F A;  1CTE A;  3MTN A;  3OVZ A;  3PDF A;  4XUI A;  1JQP A;  1TLO A;  1BY8 A;  4NV8 A;  4X6J A;  2AUZ A;  1F2C A;  4PP2 E;  5K16 A;  3PNR A;  1KFX L;  3LFY A;  2R9C A;  2E03 A;  2NQG A;  1GLO A;  1VSN A;  3N4C A;  3PW3 A;  1YT7 A;  4YYV A;  3P5W A;  3GCB A;  3MHH A;  1NB5 A;  1QDQ A;  3CH3 X;  2NQD B;  2YJ9 A;  4MZS A;  4Q8G A;  2FTD A;  1NB3 A;  7PCK A;  2FUD A;  1PCI A;  4P6E A;  1F2A A;  2XU4 A;  5CHT A;  1KXR A;  2XU5 A;  8PCH A;  4G54 A;  3O1G A;  3S3Q A;  3LXS A;  3N3K A;  1AU3 A;  4X6I A;  2Y6E A;  4P6G A;  5J94 A;  4BPV A;  3BC3 A;  4CDC B;  2XU1 A;  4YV8 A;  5JA7 A;  4CZW A;  1MDW A;  5EGW A;  2GHU A;  1XKG A;  1THE A;  1CVZ A;  2ATO A;  2VHF A;  2XU3 A;  1GX3 A;  4N79 A;  3QJ3 A;  3K24 A;  4FJC A;  3NHE A;  3N3G A;  1CPJ A;  1PIP A;  2DCA A;  1AU4 A;  3H89 A;  2CIO A;  2E02 A;  4Q8H A;  4C5P A;  1YVB A;  4QRG A;  2DCD A;  4CDF B;  4AXL A;  2FRA A;  1NPZ A;  2R6N A;  4I05 A;  2FT2 A;  1MEM A;  3CH2 X;  1AYV A;  2PAD A;  1BP4 A;  2AIM A;  2ACT A;  4RY2 A;  1X9Y A;  4KLB A;  1ME4 A;  4CDD B;  3OF9 A;  4W4U A;  1ME3 A;  1NL6 A;  3IHP A;  4B55 A;  4ZUX U;  1U9V A;  1W6F A;  3AI8 A;  3S3R A;  4I07 A;  1EWP A;  1MIR A;  2BDZ A;  3MOR A;  5CVN B;  4YYR A;  4QBB A;  3V6E A;  6PAD A;  2YJB A;  3E1Z B;  3WXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...