2IPPB

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
molecule tags Hydrolase
molecule keywords Cathepsin B
total genus 46
structure length 205
sequence length 205
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ippB00
4HWYA 2VHSA 1BQIA 1CQDA 4YYWA 1PXVA 3M99A 2ATOA 1GMYA 2IPPB 2G8JA 2AS8A 6PADA 2DCAA 1CTEA 2JQGR 2DCBA 2NQIA 2FYEA 4K7CA 2OZ2A 1KFUL 1NLJA 1AU2A 3U8EA 4N8WA 3RVXA 3HHIA 2P86A 3KFQA 4DMXA 4DMYA 4YYRA 2IBIA 2P7UA 2AUZA 1CS8A 3P5WA 4QBBA 4CDCB 5FPWA 2HXZA 2YJ9A 4BPVA 1GECE 3O0UA 4YYQA 1NPZA 2YJ8A 4ZUXU 1X9YA 1AU0A 2F1GA 5CVNB 2DZYA 4I04A 3HHAA 4CDEB 1MHWA 2B1NA 1F2AA 5JA7A 1YT7A 2AYNA 1KFXL 3I3TA 4MZOA 1F29A 2DZZA 1THEA 3HWNA 3K9MA 1U9XA 4AXMA 2AIMA 2DCCA 3BCNA 4PI3A 4P6GA 1Y08A 1EWOA 5K16A 3H6SA 2ACTA 2FQ9A 3QT4A 1VSNA 3OISA 2Y6EA 3F5VA 2FRAA 4YYVA 2R9OA 3DF0A 2YJCA 5A24A 5J94A 4FJCA 1YK8A 3KKUA 1YVBA 2DC7A 3V6EA 3P5VA 5JH3A 1KHPA 1GLOA 1NL6A 2YJ2A 4QH6A 3ZUAA 3WXFA 3MHHA 3ERVA 1HUCB 2DC8A 2OP3A 1PCIA 2CB5A 1K3BB 2R6NA 1JQPA 1AU3A 2G7YA 2G6DA 1NB5A 3PDFA 4CDDB 3PBHA 4YYSA 4N4ZA 3KW9A 3LFYA 1MS6A 1AIMA 4BSQA 4MSXA 2B1MA 7PCKA 1TLOA 3OF9A 1O0EA 1AYWA 3C9EA 1EF7A 4G54A 3S3RA 2AUXA 2XU1A 4FIPA 2HH5A 4QRXA 4XR7A 1AECA 1ZIVA 3TNXA 1PPDA 2PADA 2BDLA 2CIOA 1CV8A 3K24A 3V6CA 3AI8A 3OVZA 1PIPA 3RVWA 2NQDB 1PE6A 1VJVA 1ME3A 2PNSA 3HD3A 1GCBA 2FT2A 3P5UA 4KLBA 3KX1A 1U9QX 2DC9A 4W4UA 1QOLA 1U9VA 5EGWA 3USVA 5CHVA 1ATKA 3LXSA 3OF8A 2DJFB 2OULA 1CPJA 2NQGA 5CHTA 3E1ZB 1SNKA 4OELA 1A6RA 1PADA 1ME4A 3N4CA 1ZCMA 4I07A 1NQCA 1F2CA 3MHSA 3KSEA 2E02A 3QSDA 1DF0A 1MEGA 5CVOB 3GCBA 1F2BA 3B79A 4XUIA 2P0RA 3CH3X 4YV8A 1U9WA 2FRQA 5CVMA 1Y4HA 2BDZA 3BPMA 4Q8GA 2GHUA 1TL9A 4W5CA 2XU3A 4YVAA 2E03A 4PP2E 1DEUA 1CVZA 3D6SA 3MORA 3WXGA 9PAPA 4PADA 3CBJA 5PADA 4BS6A 1FH0A 1XKGA 3KWBX 2G8EA 3N3GA 1BGOA 3S3QA 4PP1A 2AYOA 2VHFA 1BP4A 1Q6KA 1EWMA 3OVXA 4AXLA 1ITOA 2ARYA 3P5XA 1KHQA 2HD5A 2R9FA 2XU5A 1TU6A 2FUDA 4RY2A 3RVVA 5F02A 3N3KA 1CB5A 2Y5BA 3NHEA 3O1GA 3IV2A 1PPPA 2C0YA 1EWLA 4X6HA 3PNRA 1PPNA 4N79A 4QRGA 2DJGB 1QXPA 1YK7A 4BS5A 1BY8A 4Q8HA 2FTDA 2DCDA 3H89A 2FO5A 4W5BA 1QMYA 2PBHA 1AYUA 2NQAA 1MIRA 4P6EA 2E00A 4MZSA 3H7DA 3BC3A 1EWPA 3IUTA 3QJ3A 3BOWA 2WBFX 2XU4A 2H7JA 1KXRA 3IEJA 1PPOA 8PCHA 2HHNA 3H8CA 3CH2X 1PBHA 2YJBA 3I06A 1M6DA 4CZWA 4WA6A 3H8BA 3PW3A 1ICFA 4YYUA 1MDWA 3IOQA 5EF4A 2R9MA 1AYVA 1U5IA 3BPFA 4BQVA 2R9NA 1NB3A 1S4VA 2F7DA 3CBKA 1YALA 3BWKA 3WXEA 3IHPA 1SP4B 3IMAA 1QDQA 3KWZA 2R9CA 4CDFB 4QRVA 2E01A 1POPA 2PREA 1MEMA 2AU1A 2JQFR 2DC6A 1CSBB 4OEMA 4I05A 1CJLA 4FK5A 4X6IA 1AU4A 3F75A 3K8UA 2O6XA 4X6JA 1IWDA 2GFOA 2AVWA 1STFE 3MTNA
chains in the Genus database with same CATH superfamily
4HWYA 3PT2A 2VHSA 1BQIA 1CQDA 4YYWA 4RF1A 1PXVA 3M99A 2ATOA 1GMYA 2IPPB 2G8JA 3W31A 2AS8A 6PADA 5KO3A 4A5UA 2DCAA 1CTEA 2JQGR 2DCBA 2NQIA 2FYEA 3PHWA 3PHXA 4K7CA 2OZ2A 1KFUL 1NLJA 1AU2A 3BBAA 3U8EA 4N8WA 3RVXA 3HHIA 2P86A 3KFQA 4DMXA 4DMYA 4YYRA 2IBIA 4MI7A 4BOZA 3B21A 2P7UA 2AUZA 1CS8A 3P5WA 4GUAA 4QBBA 3O65A 4CDCB 5FPWA 4XZXA 2HXZA 2YJ9A 4HXDB 4BPVA 3C0RA 1GECE 3O0UA 4M0WA 4YYQA 1NPZA 2YJ8A 4ZUXU 1X9YA 4WURA 1AU0A 2F1GA 5CVNB 2DZYA 1PVJA 4I04A 3HHAA 4CDEB 4R3DA 2BU3A 1MHWA 2B1NA 1F2AA 5JA7A 1YT7A 2AYNA 1KFXL 3I3TA 4MZOA 1F29A 2DZZA 1THEA 4RNAA 3HWNA 3K9MA 1U9XA 4AXMA 2AIMA 2DCCA 3BCNA 5E6JA 3E9SA 4PI3A 4P6GA 1Y08A 1EWOA 5K16A 3H6SA 2ACTA 2FQ9A 3QT4A 1VSNA 3OISA 2Y6EA 3F5VA 2FRAA 4YYVA 2R9OA 3DF0A 2YJCA 5EZQA 5A24A 5J94A 4FJCA 2J7QA 3MTVA 1YK8A 4PT5A 3KKUA 1YVBA 2DC7A 4REZA 3V6EA 3P5VA 5JH3A 1KHPA 1GLOA 1NL6A 2YJ2A 4QH6A 3ZUAA 3WXFA 3MHHA 3ERVA 1HUCB 2DC8A 2OP3A 1PCIA 2CB5A 1K3BB 2R6NA 1JQPA 4D8BA 3BY4A 1AU3A 2G7YA 2G6DA 3PHUA 1NB5A 3PDFA 4CDDB 3PBHA 4YYSA 4N4ZA 3KW9A 3LFYA 1MS6A 1AIMA 4BSQA 4MSXA 2B1MA 7PCKA 1TLOA 3OF9A 1O0EA 1AYWA 3C9EA 1EF7A 4G54A 3S3RA 2AUXA 2XU1A 4FIPA 2DOSA 2BTWA 2HH5A 4QRXA 4XR7A 1AECA 1ZIVA 3TNXA 1PPDA 2PADA 2BDLA 2CIOA 1CV8A 3K24A 4P16A 3V6CA 3AI8A 3OVZA 1PIPA 3RVWA 2NQDB 1PE6A 3PRPA 1VJVA 1ME3A 2PNSA 3HD3A 4BOSA 1GCBA 2FT2A 3P5UA 4KLBA 3TMPA 3KX1A 1U9QX 2DC9A 4W4UA 1QOLA 1U9VA 5EGWA 3USVA 5CHVA 1ATKA 3LXSA 3OF8A 2DJFB 2OULA 1CPJA 2NQGA 5CHTA 2BTWB 4BOUA 3E1ZB 1SNKA 4OELA 4RKXA 2FE8A 1A6RA 1PADA 1ME4A 3N4CA 1ZCMA 4I07A 1NQCA 1F2CA 3MHSA 3KSEA 2E02A 3QSDA 1DF0A 1MEGA 4IUMA 4ZTBA 5CVOB 3GCBA 1F2BA 2UZJA 3B79A 4OVZB 4XUIA 2P0RA 3CH3X 4YV8A 1U9WA 2FRQA 5CVMA 1Y4HA 2BDZA 3BPMA 4Q8GA 1UKFA 2GHUA 1TL9A 4W5CA 2XU3A 3MP2A 4YVAA 2E03A 4PP2E 1DEUA 1CVZA 3D6SA 4MM3B 1DKIA 3MORA 4BOPA 3WXGA 9PAPA 4PADA 3CBJA 3PRMA 4D8EA 5PADA 3TRKA 4BS6A 1FH0A 1XKGA 3KWBX 2G8EA 3N3GA 1BGOA 3S3QA 4PP1A 2AYOA 2VHFA 1BP4A 1Q6KA 1EWMA 3OVXA 4AXLA 1ITOA 3ZNHA 2ARYA 3P5XA 1KHQA 2HD5A 2R9FA 2XU5A 1TU6A 2FUDA 3IFUA 4RY2A 3RVVA 5F02A 3N3KA 1CB5A 3OQCA 2Y5BA 3NHEA 3O1GA 3IV2A 1PPPA 2C0YA 1EWLA 4X6HA 5JZEA 3PNRA 1PPNA 4N79A 2Z84A 4QRGA 2J7QC 2DJGB 4BOQA 1QXPA 1YK7A 4BS5A 1BY8A 4D8IA 4Q8HA 2FTDA 2DCDA 3H89A 2FO5A 4W5BA 1QMYA 2PBHA 1AYUA 2NQAA 5EZSA 1MIRA 4P6EA 2E00A 4MZSA 2AGAA 3H7DA 3BC3A 1EWPA 3IUTA 3QJ3A 4RF0A 3BOWA 2HWKA 2WBFX 2XU4A 2H7JA 1KXRA 3IEJA 1PPOA 8PCHA 2HHNA 3H8CA 3CH2X 1PBHA 2YJBA 3I06A 1M6DA 4CZWA 4WA6A 3H8BA 3PW3A 3W30A 1ICFA 2JTCA 4YYUA 1MDWA 3IOQA 5EF4A 4OW0A 2R9MA 1AYVA 1U5IA 3BPFA 4BQVA 2R9NA 1NB3A 3PSEA 1S4VA 2F7DA 3CBKA 2JRIA 1YALA 3BWKA 3WXEA 3IHPA 1SP4B 3IMAA 1QDQA 3KWZA 4OVZA 2R9CA 4CDFB 4QRVA 2E01A 1YZBA 1POPA 2PREA 1MEMA 2AU1A 2JQFR 2DC6A 1CSBB 3RNVA 3BB7A 4OEMA 4I05A 1CJLA 4FK5A 3K8UA 1AU4A 3F75A 4X6IA 2O6XA 4X6JA 1IWDA 2GFOA 3MJ5A 2AVWA 1STFE 3MTNA 4IP3A
chains in the Genus database with same CATH topology
4HWYA 2VHSA 1BQIA 1CQDA 4YYWA 1PXVA 3M99A 2ATOA 1GMYA 2IPPB 2G8JA 2AS8A 6PADA 1GX3A 2DCAA 1CTEA 2JQGR 2DCBA 2NQIA 2FYEA 4K7CA 2OZ2A 1KFUL 1NLJA 4GUZA 1AU2A 3U8EA 4N8WA 3RVXA 3HHIA 2P86A 3KFQA 4DMXA 4DMYA 4YYRA 2IBIA 2P7UA 2AUZA 1CS8A 3P5WA 4QBBA 4CDCB 5FPWA 2HXZA 2YJ9A 4BPVA 1GECE 3O0UA 4YYQA 1NPZA 2YJ8A 4ZUXU 1X9YA 1AU0A 2F1GA 5CVNB 2DZYA 4I04A 3HHAA 4CDEB 1MHWA 2B1NA 1F2AA 5JA7A 1YT7A 1W4TA 2AYNA 1KFXL 3I3TA 4MZOA 1F29A 2DZZA 1THEA 3HWNA 3K9MA 1U9XA 4AXMA 2AIMA 2DCCA 1W5RA 3BCNA 4PI3A 4P6GA 1Y08A 1EWOA 5K16A 3H6SA 2ACTA 2FQ9A 3LTWA 3QT4A 1VSNA 3OISA 2Y6EA 3F5VA 2FRAA 4YYVA 2R9OA 3DF0A 2YJCA 5A24A 5J94A 4FJCA 1YK8A 3KKUA 1YVBA 2DC7A 3V6EA 3P5VA 5JH3A 1KHPA 1GLOA 1NL6A 2YJ2A 4QH6A 3ZUAA 3WXFA 3MHHA 3ERVA 1HUCB 2DC8A 2OP3A 1PCIA 2CB5A 1K3BB 2R6NA 1JQPA 1AU3A 2G7YA 2G6DA 4C5PA 1NB5A 3PDFA 4CDDB 3PBHA 4YYSA 4N4ZA 3KW9A 3LFYA 1MS6A 1AIMA 4BSQA 4MSXA 2B1MA 7PCKA 1TLOA 3OF9A 1O0EA 1AYWA 3C9EA 1EF7A 4G54A 2VFCA 3S3RA 2AUXA 2XU1A 4FIPA 2HH5A 4QRXA 4XR7A 1AECA 1ZIVA 3TNXA 1PPDA 2PADA 2BDLA 2CIOA 1CV8A 3K24A 3V6CA 3AI8A 3OVZA 1PIPA 3RVWA 2NQDB 1PE6A 1VJVA 1ME3A 4BGFA 2PNSA 3HD3A 1GCBA 2FT2A 3P5UA 4KLBA 3KX1A 1U9QX 2DC9A 4W4UA 1QOLA 4B55A 1U9VA 5EGWA 3USVA 5CHVA 1ATKA 3LXSA 3OF8A 2DJFB 2OULA 1CPJA 2NQGA 5CHTA 3E1ZB 1SNKA 2BSZA 4OELA 1A6RA 1PADA 1ME4A 3N4CA 1ZCMA 4I07A 1NQCA 1F2CA 3MHSA 3KSEA 2E02A 3QSDA 1DF0A 1MEGA 5CVOB 3GCBA 1F2BA 3B79A 4XUIA 2P0RA 3CH3X 4YV8A 1U9WA 2FRQA 5CVMA 1Y4HA 2BDZA 3BPMA 4Q8GA 2GHUA 1TL9A 4W5CA 2XU3A 4YVAA 2E03A 4PP2E 1DEUA 1CVZA 3D6SA 3MORA 3WXGA 9PAPA 4PADA 3CBJA 5PADA 4BS6A 1FH0A 1XKGA 3KWBX 2G8EA 3N3GA 1BGOA 3S3QA 4PP1A 2AYOA 2VHFA 1BP4A 1Q6KA 1EWMA 3OVXA 4AXLA 1ITOA 2ARYA 4NV7A 3P5XA 1KHQA 2HD5A 2R9FA 2XU5A 1TU6A 2FUDA 4RY2A 3RVVA 5F02A 3N3KA 1CB5A 2Y5BA 3NHEA 3O1GA 3IV2A 1PPPA 2C0YA 1EWLA 4X6HA 3PNRA 1PPNA 4N79A 4QRGA 2DJGB 1QXPA 1YK7A 4BS5A 1BY8A 4Q8HA 2FTDA 4NV8A 2DCDA 3H89A 2FO5A 4W5BA 1QMYA 2PBHA 1AYUA 2NQAA 1MIRA 4P6EA 2E00A 2VFBA 4MZSA 1W6FA 3H7DA 3BC3A 1EWPA 3IUTA 3QJ3A 3BOWA 2WBFX 2XU4A 2H7JA 1KXRA 3IEJA 1PPOA 8PCHA 2HHNA 3H8CA 3CH2X 1PBHA 2YJBA 3I06A 1M6DA 4CZWA 4WA6A 3H8BA 3PW3A 1ICFA 4YYUA 1MDWA 3IOQA 5EF4A 2R9MA 1AYVA 1U5IA 3BPFA 4BQVA 2R9NA 1NB3A 1S4VA 2F7DA 3CBKA 1YALA 3BWKA 3WXEA 3IHPA 1SP4B 3IMAA 1QDQA 3KWZA 2R9CA 4CDFB 4QRVA 2E01A 1POPA 2PREA 1MEMA 2AU1A 2JQFR 2DC6A 1CSBB 4OEMA 4I05A 1CJLA 4FK5A 4X6IA 1AU4A 3F75A 3K8UA 2O6XA 4X6JA 3D9WA 1IWDA 2GFOA 2AVWA 1STFE 3MTNA 1E2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWY A;  2VHS A;  1BQI A;  1CQD A;  4YYW A;  1PXV A;  3M99 A;  2ATO A;  1GMY A;  2IPP B;  2G8J A;  2AS8 A;  6PAD A;  2DCA A;  1CTE A;  2JQG R;  2DCB A;  2NQI A;  2FYE A;  4K7C A;  2OZ2 A;  1KFU L;  1NLJ A;  1AU2 A;  3U8E A;  4N8W A;  3RVX A;  3HHI A;  2P86 A;  3KFQ A;  4DMX A;  4DMY A;  4YYR A;  2IBI A;  2P7U A;  2AUZ A;  1CS8 A;  3P5W A;  4QBB A;  4CDC B;  5FPW A;  2HXZ A;  2YJ9 A;  4BPV A;  1GEC E;  3O0U A;  4YYQ A;  1NPZ A;  2YJ8 A;  4ZUX U;  1X9Y A;  1AU0 A;  2F1G A;  5CVN B;  2DZY A;  4I04 A;  3HHA A;  4CDE B;  1MHW A;  2B1N A;  1F2A A;  5JA7 A;  1YT7 A;  2AYN A;  1KFX L;  3I3T A;  4MZO A;  1F29 A;  2DZZ A;  1THE A;  3HWN A;  3K9M A;  1U9X A;  4AXM A;  2AIM A;  2DCC A;  3BCN A;  4PI3 A;  4P6G A;  1Y08 A;  1EWO A;  5K16 A;  3H6S A;  2ACT A;  2FQ9 A;  3QT4 A;  1VSN A;  3OIS A;  2Y6E A;  3F5V A;  2FRA A;  4YYV A;  2R9O A;  3DF0 A;  2YJC A;  5A24 A;  5J94 A;  4FJC A;  1YK8 A;  3KKU A;  1YVB A;  2DC7 A;  3V6E A;  3P5V A;  5JH3 A;  1KHP A;  1GLO A;  1NL6 A;  2YJ2 A;  4QH6 A;  3ZUA A;  3WXF A;  3MHH A;  3ERV A;  1HUC B;  2DC8 A;  2OP3 A;  1PCI A;  2CB5 A;  1K3B B;  2R6N A;  1JQP A;  1AU3 A;  2G7Y A;  2G6D A;  1NB5 A;  3PDF A;  4CDD B;  3PBH A;  4YYS A;  4N4Z A;  3KW9 A;  3LFY A;  1MS6 A;  1AIM A;  4BSQ A;  4MSX A;  2B1M A;  7PCK A;  1TLO A;  3OF9 A;  1O0E A;  1AYW A;  3C9E A;  1EF7 A;  4G54 A;  3S3R A;  2AUX A;  2XU1 A;  4FIP A;  2HH5 A;  4QRX A;  4XR7 A;  1AEC A;  1ZIV A;  3TNX A;  1PPD A;  2PAD A;  2BDL A;  2CIO A;  1CV8 A;  3K24 A;  3V6C A;  3AI8 A;  3OVZ A;  1PIP A;  3RVW A;  2NQD B;  1PE6 A;  1VJV A;  1ME3 A;  2PNS A;  3HD3 A;  1GCB A;  2FT2 A;  3P5U A;  4KLB A;  3KX1 A;  1U9Q X;  2DC9 A;  4W4U A;  1QOL A;  1U9V A;  5EGW A;  3USV A;  5CHV A;  1ATK A;  3LXS A;  3OF8 A;  2DJF B;  2OUL A;  1CPJ A;  2NQG A;  5CHT A;  3E1Z B;  1SNK A;  4OEL A;  1A6R A;  1PAD A;  1ME4 A;  3N4C A;  1ZCM A;  4I07 A;  1NQC A;  1F2C A;  3MHS A;  3KSE A;  2E02 A;  3QSD A;  1DF0 A;  1MEG A;  5CVO B;  3GCB A;  1F2B A;  3B79 A;  4XUI A;  2P0R A;  3CH3 X;  4YV8 A;  1U9W A;  2FRQ A;  5CVM A;  1Y4H A;  2BDZ A;  3BPM A;  4Q8G A;  2GHU A;  1TL9 A;  4W5C A;  2XU3 A;  4YVA A;  2E03 A;  4PP2 E;  1DEU A;  1CVZ A;  3D6S A;  3MOR A;  3WXG A;  9PAP A;  4PAD A;  3CBJ A;  5PAD A;  4BS6 A;  1FH0 A;  1XKG A;  3KWB X;  2G8E A;  3N3G A;  1BGO A;  3S3Q A;  4PP1 A;  2AYO A;  2VHF A;  1BP4 A;  1Q6K A;  1EWM A;  3OVX A;  4AXL A;  1ITO A;  2ARY A;  3P5X A;  1KHQ A;  2HD5 A;  2R9F A;  2XU5 A;  1TU6 A;  2FUD A;  4RY2 A;  3RVV A;  5F02 A;  3N3K A;  1CB5 A;  2Y5B A;  3NHE A;  3O1G A;  3IV2 A;  1PPP A;  2C0Y A;  1EWL A;  4X6H A;  3PNR A;  1PPN A;  4N79 A;  4QRG A;  2DJG B;  1QXP A;  1YK7 A;  4BS5 A;  1BY8 A;  4Q8H A;  2FTD A;  2DCD A;  3H89 A;  2FO5 A;  4W5B A;  1QMY A;  2PBH A;  1AYU A;  2NQA A;  1MIR A;  4P6E A;  2E00 A;  4MZS A;  3H7D A;  3BC3 A;  1EWP A;  3IUT A;  3QJ3 A;  3BOW A;  2WBF X;  2XU4 A;  2H7J A;  1KXR A;  3IEJ A;  1PPO A;  8PCH A;  2HHN A;  3H8C A;  3CH2 X;  1PBH A;  2YJB A;  3I06 A;  1M6D A;  4CZW A;  4WA6 A;  3H8B A;  3PW3 A;  1ICF A;  4YYU A;  1MDW A;  3IOQ A;  5EF4 A;  2R9M A;  1AYV A;  1U5I A;  3BPF A;  4BQV A;  2R9N A;  1NB3 A;  1S4V A;  2F7D A;  3CBK A;  1YAL A;  3BWK A;  3WXE A;  3IHP A;  1SP4 B;  3IMA A;  1QDQ A;  3KWZ A;  2R9C A;  4CDF B;  4QRV A;  2E01 A;  1POP A;  2PRE A;  1MEM A;  2AU1 A;  2JQF R;  2DC6 A;  1CSB B;  4OEM A;  4I05 A;  1CJL A;  4FK5 A;  4X6I A;  1AU4 A;  3F75 A;  3K8U A;  2O6X A;  4X6J A;  1IWD A;  2GFO A;  2AVW A;  1STF E;  3MTN A; 
#chains in the Genus database with same CATH topology
 4HWY A;  3PT2 A;  2VHS A;  1BQI A;  1CQD A;  4YYW A;  4RF1 A;  1PXV A;  3M99 A;  2ATO A;  1GMY A;  2IPP B;  2G8J A;  3W31 A;  2AS8 A;  6PAD A;  5KO3 A;  4A5U A;  2DCA A;  1CTE A;  2JQG R;  2DCB A;  2NQI A;  2FYE A;  3PHW A;  3PHX A;  4K7C A;  2OZ2 A;  1KFU L;  1NLJ A;  1AU2 A;  3BBA A;  3U8E A;  4N8W A;  3RVX A;  3HHI A;  2P86 A;  3KFQ A;  4DMX A;  4DMY A;  4YYR A;  2IBI A;  4MI7 A;  4BOZ A;  3B21 A;  2P7U A;  2AUZ A;  1CS8 A;  3P5W A;  4GUA A;  4QBB A;  3O65 A;  4CDC B;  5FPW A;  4XZX A;  2HXZ A;  2YJ9 A;  4HXD B;  4BPV A;  3C0R A;  1GEC E;  3O0U A;  4M0W A;  4YYQ A;  1NPZ A;  2YJ8 A;  4ZUX U;  1X9Y A;  4WUR A;  1AU0 A;  2F1G A;  5CVN B;  2DZY A;  1PVJ A;  4I04 A;  3HHA A;  4CDE B;  4R3D A;  2BU3 A;  1MHW A;  2B1N A;  1F2A A;  5JA7 A;  1YT7 A;  2AYN A;  1KFX L;  3I3T A;  4MZO A;  1F29 A;  2DZZ A;  1THE A;  4RNA A;  3HWN A;  3K9M A;  1U9X A;  4AXM A;  2AIM A;  2DCC A;  3BCN A;  5E6J A;  3E9S A;  4PI3 A;  4P6G A;  1Y08 A;  1EWO A;  5K16 A;  3H6S A;  2ACT A;  2FQ9 A;  3QT4 A;  1VSN A;  3OIS A;  2Y6E A;  3F5V A;  2FRA A;  4YYV A;  2R9O A;  3DF0 A;  2YJC A;  5EZQ A;  5A24 A;  5J94 A;  4FJC A;  2J7Q A;  3MTV A;  1YK8 A;  4PT5 A;  3KKU A;  1YVB A;  2DC7 A;  4REZ A;  3V6E A;  3P5V A;  5JH3 A;  1KHP A;  1GLO A;  1NL6 A;  2YJ2 A;  4QH6 A;  3ZUA A;  3WXF A;  3MHH A;  3ERV A;  1HUC B;  2DC8 A;  2OP3 A;  1PCI A;  2CB5 A;  1K3B B;  2R6N A;  1JQP A;  4D8B A;  3BY4 A;  1AU3 A;  2G7Y A;  2G6D A;  3PHU A;  1NB5 A;  3PDF A;  4CDD B;  3PBH A;  4YYS A;  4N4Z A;  3KW9 A;  3LFY A;  1MS6 A;  1AIM A;  4BSQ A;  4MSX A;  2B1M A;  7PCK A;  1TLO A;  3OF9 A;  1O0E A;  1AYW A;  3C9E A;  1EF7 A;  4G54 A;  3S3R A;  2AUX A;  2XU1 A;  4FIP A;  2DOS A;  2BTW A;  2HH5 A;  4QRX A;  4XR7 A;  1AEC A;  1ZIV A;  3TNX A;  1PPD A;  2PAD A;  2BDL A;  2CIO A;  1CV8 A;  3K24 A;  4P16 A;  3V6C A;  3AI8 A;  3OVZ A;  1PIP A;  3RVW A;  2NQD B;  1PE6 A;  3PRP A;  1VJV A;  1ME3 A;  2PNS A;  3HD3 A;  4BOS A;  1GCB A;  2FT2 A;  3P5U A;  4KLB A;  3TMP A;  3KX1 A;  1U9Q X;  2DC9 A;  4W4U A;  1QOL A;  1U9V A;  5EGW A;  3USV A;  5CHV A;  1ATK A;  3LXS A;  3OF8 A;  2DJF B;  2OUL A;  1CPJ A;  2NQG A;  5CHT A;  2BTW B;  4BOU A;  3E1Z B;  1SNK A;  4OEL A;  4RKX A;  2FE8 A;  1A6R A;  1PAD A;  1ME4 A;  3N4C A;  1ZCM A;  4I07 A;  1NQC A;  1F2C A;  3MHS A;  3KSE A;  2E02 A;  3QSD A;  1DF0 A;  1MEG A;  4IUM A;  4ZTB A;  5CVO B;  3GCB A;  1F2B A;  2UZJ A;  3B79 A;  4OVZ B;  4XUI A;  2P0R A;  3CH3 X;  4YV8 A;  1U9W A;  2FRQ A;  5CVM A;  1Y4H A;  2BDZ A;  3BPM A;  4Q8G A;  1UKF A;  2GHU A;  1TL9 A;  4W5C A;  2XU3 A;  3MP2 A;  4YVA A;  2E03 A;  4PP2 E;  1DEU A;  1CVZ A;  3D6S A;  4MM3 B;  1DKI A;  3MOR A;  4BOP A;  3WXG A;  9PAP A;  4PAD A;  3CBJ A;  3PRM A;  4D8E A;  5PAD A;  3TRK A;  4BS6 A;  1FH0 A;  1XKG A;  3KWB X;  2G8E A;  3N3G A;  1BGO A;  3S3Q A;  4PP1 A;  2AYO A;  2VHF A;  1BP4 A;  1Q6K A;  1EWM A;  3OVX A;  4AXL A;  1ITO A;  3ZNH A;  2ARY A;  3P5X A;  1KHQ A;  2HD5 A;  2R9F A;  2XU5 A;  1TU6 A;  2FUD A;  3IFU A;  4RY2 A;  3RVV A;  5F02 A;  3N3K A;  1CB5 A;  3OQC A;  2Y5B A;  3NHE A;  3O1G A;  3IV2 A;  1PPP A;  2C0Y A;  1EWL A;  4X6H A;  5JZE A;  3PNR A;  1PPN A;  4N79 A;  2Z84 A;  4QRG A;  2J7Q C;  2DJG B;  4BOQ A;  1QXP A;  1YK7 A;  4BS5 A;  1BY8 A;  4D8I A;  4Q8H A;  2FTD A;  2DCD A;  3H89 A;  2FO5 A;  4W5B A;  1QMY A;  2PBH A;  1AYU A;  2NQA A;  5EZS A;  1MIR A;  4P6E A;  2E00 A;  4MZS A;  2AGA A;  3H7D A;  3BC3 A;  1EWP A;  3IUT A;  3QJ3 A;  4RF0 A;  3BOW A;  2HWK A;  2WBF X;  2XU4 A;  2H7J A;  1KXR A;  3IEJ A;  1PPO A;  8PCH A;  2HHN A;  3H8C A;  3CH2 X;  1PBH A;  2YJB A;  3I06 A;  1M6D A;  4CZW A;  4WA6 A;  3H8B A;  3PW3 A;  3W30 A;  1ICF A;  2JTC A;  4YYU A;  1MDW A;  3IOQ A;  5EF4 A;  4OW0 A;  2R9M A;  1AYV A;  1U5I A;  3BPF A;  4BQV A;  2R9N A;  1NB3 A;  3PSE A;  1S4V A;  2F7D A;  3CBK A;  2JRI A;  1YAL A;  3BWK A;  3WXE A;  3IHP A;  1SP4 B;  3IMA A;  1QDQ A;  3KWZ A;  4OVZ A;  2R9C A;  4CDF B;  4QRV A;  2E01 A;  1YZB A;  1POP A;  2PRE A;  1MEM A;  2AU1 A;  2JQF R;  2DC6 A;  1CSB B;  3RNV A;  3BB7 A;  4OEM A;  4I05 A;  1CJL A;  4FK5 A;  3K8U A;  1AU4 A;  3F75 A;  4X6I A;  2O6X A;  4X6J A;  1IWD A;  2GFO A;  3MJ5 A;  2AVW A;  1STF E;  3MTN A;  4IP3 A; 
#chains in the Genus database with same CATH homology
 4HWY A;  2VHS A;  1BQI A;  1CQD A;  4YYW A;  1PXV A;  3M99 A;  2ATO A;  1GMY A;  2IPP B;  2G8J A;  2AS8 A;  6PAD A;  1GX3 A;  2DCA A;  1CTE A;  2JQG R;  2DCB A;  2NQI A;  2FYE A;  4K7C A;  2OZ2 A;  1KFU L;  1NLJ A;  4GUZ A;  1AU2 A;  3U8E A;  4N8W A;  3RVX A;  3HHI A;  2P86 A;  3KFQ A;  4DMX A;  4DMY A;  4YYR A;  2IBI A;  2P7U A;  2AUZ A;  1CS8 A;  3P5W A;  4QBB A;  4CDC B;  5FPW A;  2HXZ A;  2YJ9 A;  4BPV A;  1GEC E;  3O0U A;  4YYQ A;  1NPZ A;  2YJ8 A;  4ZUX U;  1X9Y A;  1AU0 A;  2F1G A;  5CVN B;  2DZY A;  4I04 A;  3HHA A;  4CDE B;  1MHW A;  2B1N A;  1F2A A;  5JA7 A;  1YT7 A;  1W4T A;  2AYN A;  1KFX L;  3I3T A;  4MZO A;  1F29 A;  2DZZ A;  1THE A;  3HWN A;  3K9M A;  1U9X A;  4AXM A;  2AIM A;  2DCC A;  1W5R A;  3BCN A;  4PI3 A;  4P6G A;  1Y08 A;  1EWO A;  5K16 A;  3H6S A;  2ACT A;  2FQ9 A;  3LTW A;  3QT4 A;  1VSN A;  3OIS A;  2Y6E A;  3F5V A;  2FRA A;  4YYV A;  2R9O A;  3DF0 A;  2YJC A;  5A24 A;  5J94 A;  4FJC A;  1YK8 A;  3KKU A;  1YVB A;  2DC7 A;  3V6E A;  3P5V A;  5JH3 A;  1KHP A;  1GLO A;  1NL6 A;  2YJ2 A;  4QH6 A;  3ZUA A;  3WXF A;  3MHH A;  3ERV A;  1HUC B;  2DC8 A;  2OP3 A;  1PCI A;  2CB5 A;  1K3B B;  2R6N A;  1JQP A;  1AU3 A;  2G7Y A;  2G6D A;  4C5P A;  1NB5 A;  3PDF A;  4CDD B;  3PBH A;  4YYS A;  4N4Z A;  3KW9 A;  3LFY A;  1MS6 A;  1AIM A;  4BSQ A;  4MSX A;  2B1M A;  7PCK A;  1TLO A;  3OF9 A;  1O0E A;  1AYW A;  3C9E A;  1EF7 A;  4G54 A;  2VFC A;  3S3R A;  2AUX A;  2XU1 A;  4FIP A;  2HH5 A;  4QRX A;  4XR7 A;  1AEC A;  1ZIV A;  3TNX A;  1PPD A;  2PAD A;  2BDL A;  2CIO A;  1CV8 A;  3K24 A;  3V6C A;  3AI8 A;  3OVZ A;  1PIP A;  3RVW A;  2NQD B;  1PE6 A;  1VJV A;  1ME3 A;  4BGF A;  2PNS A;  3HD3 A;  1GCB A;  2FT2 A;  3P5U A;  4KLB A;  3KX1 A;  1U9Q X;  2DC9 A;  4W4U A;  1QOL A;  4B55 A;  1U9V A;  5EGW A;  3USV A;  5CHV A;  1ATK A;  3LXS A;  3OF8 A;  2DJF B;  2OUL A;  1CPJ A;  2NQG A;  5CHT A;  3E1Z B;  1SNK A;  2BSZ A;  4OEL A;  1A6R A;  1PAD A;  1ME4 A;  3N4C A;  1ZCM A;  4I07 A;  1NQC A;  1F2C A;  3MHS A;  3KSE A;  2E02 A;  3QSD A;  1DF0 A;  1MEG A;  5CVO B;  3GCB A;  1F2B A;  3B79 A;  4XUI A;  2P0R A;  3CH3 X;  4YV8 A;  1U9W A;  2FRQ A;  5CVM A;  1Y4H A;  2BDZ A;  3BPM A;  4Q8G A;  2GHU A;  1TL9 A;  4W5C A;  2XU3 A;  4YVA A;  2E03 A;  4PP2 E;  1DEU A;  1CVZ A;  3D6S A;  3MOR A;  3WXG A;  9PAP A;  4PAD A;  3CBJ A;  5PAD A;  4BS6 A;  1FH0 A;  1XKG A;  3KWB X;  2G8E A;  3N3G A;  1BGO A;  3S3Q A;  4PP1 A;  2AYO A;  2VHF A;  1BP4 A;  1Q6K A;  1EWM A;  3OVX A;  4AXL A;  1ITO A;  2ARY A;  4NV7 A;  3P5X A;  1KHQ A;  2HD5 A;  2R9F A;  2XU5 A;  1TU6 A;  2FUD A;  4RY2 A;  3RVV A;  5F02 A;  3N3K A;  1CB5 A;  2Y5B A;  3NHE A;  3O1G A;  3IV2 A;  1PPP A;  2C0Y A;  1EWL A;  4X6H A;  3PNR A;  1PPN A;  4N79 A;  4QRG A;  2DJG B;  1QXP A;  1YK7 A;  4BS5 A;  1BY8 A;  4Q8H A;  2FTD A;  4NV8 A;  2DCD A;  3H89 A;  2FO5 A;  4W5B A;  1QMY A;  2PBH A;  1AYU A;  2NQA A;  1MIR A;  4P6E A;  2E00 A;  2VFB A;  4MZS A;  1W6F A;  3H7D A;  3BC3 A;  1EWP A;  3IUT A;  3QJ3 A;  3BOW A;  2WBF X;  2XU4 A;  2H7J A;  1KXR A;  3IEJ A;  1PPO A;  8PCH A;  2HHN A;  3H8C A;  3CH2 X;  1PBH A;  2YJB A;  3I06 A;  1M6D A;  4CZW A;  4WA6 A;  3H8B A;  3PW3 A;  1ICF A;  4YYU A;  1MDW A;  3IOQ A;  5EF4 A;  2R9M A;  1AYV A;  1U5I A;  3BPF A;  4BQV A;  2R9N A;  1NB3 A;  1S4V A;  2F7D A;  3CBK A;  1YAL A;  3BWK A;  3WXE A;  3IHP A;  1SP4 B;  3IMA A;  1QDQ A;  3KWZ A;  2R9C A;  4CDF B;  4QRV A;  2E01 A;  1POP A;  2PRE A;  1MEM A;  2AU1 A;  2JQF R;  2DC6 A;  1CSB B;  4OEM A;  4I05 A;  1CJL A;  4FK5 A;  4X6I A;  1AU4 A;  3F75 A;  3K8U A;  2O6X A;  4X6J A;  3D9W A;  1IWD A;  2GFO A;  2AVW A;  1STF E;  3MTN A;  1E2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...