2IPPB

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
molecule keywords Cathepsin B
molecule tags Hydrolase
total genus 46
structure length 205
sequence length 205
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ippB00
1DF0A 3USVA 1BGOA 4BS6A 2DCBA 4MZSA 1Y4HA 2IPPB 1ITOA 3DF0A 4I04A 3NHEA 4N4ZA 1KHPA 4Q8GA 1EWMA 1POPA 2NQIA 9PAPA 1KXRA 2P7UA 3KWZA 3V6EA 1CPJA 4BSQA 2FO5A 3LFYA 1SP4B 1Y08A 5FPWA 2FT2A 3F75A 1EWOA 2B1NA 3K9MA 4MZOA 3HWNA 3H8BA 1AU2A 2DCCA 2FRQA 3TNXA 1ICFA 1PCIA 4X6JA 5CVMA 3OVXA 2G7YA 2VHFA 4OELA 4QRXA 4YV8A 1DEUA 1F2BA 1AYWA 4P6EA 4FK5A 1PPPA 5PADA 2JQGR 3OVZA 2E02A 2DJFB 1PE6A 3QT4A 3MORA 2XU1A 2G6DA 2AUZA 1KFXL 1EWPA 1PPDA 3WXFA 3IMAA 1AU3A 1VJVA 2FUDA 2PREA 1MEMA 4CDFB 1QXPA 3O1GA 3QSDA 1GLOA 2DZYA 4PADA 3S3RA 6PADA 3PBHA 3LXSA 1NQCA 3IV2A 2AYOA 3RVWA 1ME3A 2DCAA 4HWYA 4G54A 4CZWA 3F5VA 3MHSA 1U9XA 4X6HA 2YJBA 2R9FA 1EF7A 5EF4A 1YK7A 3CBJA 3N4CA 1ZIVA 1YVBA 2AS8A 1GMYA 2OP3A 1PXVA 3OISA 5CVNB 3IHPA 1BY8A 5JA7A 4BQVA 2HXZA 1QDQA 4I07A 4QH6A 1NB3A 2R9MA 2HH5A 3BOWA 2FQ9A 2YJ2A 4N79A 1THEA 1A6RA 1MS6A 5A24A 1YK8A 2JQFR 5CVOB 2YJ9A 2IBIA 3N3KA 2Y6EA 5CHTA 3D6SA 2ACTA 2YJCA 1F29A 1MIRA 2HD5A 3HD3A 3I06A 2G8EA 3KW9A 4AXLA 2DC8A 1PPNA 3M99A 1YT7A 3RVVA 4CDDB 3H89A 2YJ8A 4N8WA 2XU5A 2VHSA 2R9OA 1EWLA 3KX1A 3PDFA 3OF8A 1M6DA 4X6IA 1TL9A 1PIPA 2DC6A 1PADA 2NQAA 3P5WA 2CIOA 1VSNA 1AU4A 3N3GA 1AU0A 1BQIA 5F02A 1YALA 4FJCA 2GHUA 1MEGA 2FTDA 2DJGB 2F1GA 1U9VA 2R6NA 1NLJA 2Y5BA 1KFUL 3P5VA 1QOLA 2PBHA 3H8CA 3U8EA 1STFE 1SNKA 2ARYA 4DMYA 3P5UA 3IUTA 1K3BB 4QBBA 4YYRA 4KLBA 5CHVA 4YYVA 3ERVA 4YYQA 1AYUA 1F2CA 3V6CA 1FH0A 2PADA 4YVAA 1NB5A 5J94A 4XR7A 2E01A 2XU4A 2E03A 3S3QA 3ZUAA 2H7JA 4ZUXU 1CVZA 1U9QX 2P86A 4I05A 1NL6A 1TLOA 2FYEA 1QMYA 4MSXA 2AIMA 1GECE 4XUIA 1U5IA 1CS8A 3HHAA 4PP1A 3KWBX 4QRGA 2AVWA 4Q8HA 4P6GA 1CB5A 4AXMA 1BP4A 5JH3A 5EGWA 4BPVA 1MDWA 1CQDA 4YYWA 3RVXA 2XU3A 2R9NA 2PNSA 5K16A 1IWDA 2F7DA 1AYVA 1PBHA 1JQPA 3K24A 2BDZA 3E1ZB 1CV8A 4WA6A 3K8UA 2R9CA 3AI8A 3BPMA 3H6SA 2GFOA 2CB5A 2O6XA 3C9EA 3KSEA 4W4UA 3QJ3A 1AIMA 1MHWA 4QRVA 1GCBA 4CDEB 1ATKA 4BS5A 3MHHA 3WXGA 8PCHA 2WBFX 1CJLA 1NPZA 1AECA 3CBKA 2AUXA 1ME4A 1CSBB 3BC3A 4K7CA 3GCBA 3IOQA 2OULA 3O0UA 1ZCMA 2DC9A 4PI3A 4W5CA 2BDLA 1PPOA 3PNRA 3BCNA 3CH2X 4FIPA 4YYUA 2NQDB 3IEJA 4PP2E 2ATOA 3CH3X 1KHQA 1HUCB 2B1MA 2DCDA 3BPFA 1X9YA 2P0RA 3BWKA 4RY2A 2C0YA 2HHNA 3KKUA 1Q6KA 3OF9A 1O0EA 4CDCB 3I3TA 7PCKA 3PW3A 1F2AA 3KFQA 2OZ2A 2FRAA 3P5XA 3MTNA 2G8JA 3HHIA 2DC7A 4W5BA 4YYSA 1XKGA 3B79A 2E00A 1CTEA 3H7DA 4DMXA 1U9WA 3WXEA 2AU1A 2AYNA 1TU6A 1S4VA 2NQGA 2DZZA 4OEMA
chains in the Genus database with same CATH superfamily
1DF0A 3PRPA 3USVA 1BGOA 4BS6A 2DCBA 3RNVA 4MZSA 1Y4HA 1PVJA 2IPPB 5E6JA 1ITOA 4BOQA 3DF0A 4I04A 3NHEA 4N4ZA 1KHPA 4Q8GA 1EWMA 1POPA 2NQIA 9PAPA 1KXRA 2P7UA 3KWZA 3V6EA 1CPJA 4BSQA 2FO5A 3LFYA 1SP4B 1Y08A 5FPWA 2FT2A 3F75A 2AGAA 1EWOA 2B1NA 4XZXA 3K9MA 4MZOA 3HWNA 3H8BA 1AU2A 2DCCA 2FRQA 3TNXA 1ICFA 1PCIA 4X6JA 5CVMA 3ZNHA 3OVXA 4OW0A 2G7YA 2VHFA 4OVZA 4OELA 3PT2A 4QRXA 4YV8A 1DEUA 4PT5A 1F2BA 1AYWA 4P6EA 4FK5A 4D8BA 1PPPA 5PADA 2JQGR 3OVZA 2E02A 2DJFB 1PE6A 3QT4A 4RKXA 3MORA 2XU1A 2G6DA 4WURA 2AUZA 1KFXL 1EWPA 1PPDA 4GUAA 3WXFA 3IMAA 1AU3A 1VJVA 2FUDA 1UKFA 2PREA 2HWKA 1MEMA 4RF1A 3PRMA 3B21A 4CDFB 1QXPA 3O1GA 3QSDA 5KO3A 1GLOA 2DZYA 4PADA 3S3RA 6PADA 4MM3B 3PBHA 3LXSA 2DOSA 2JRIA 1NQCA 3IV2A 2AYOA 3RVWA 1ME3A 2DCAA 4HWYA 4G54A 4CZWA 3F5VA 3MHSA 1U9XA 4X6HA 2YJBA 2R9FA 1EF7A 4REZA 5EF4A 4HXDB 1YK7A 3CBJA 3N4CA 1ZIVA 1YVBA 4BOZA 2AS8A 1GMYA 2J7QC 2OP3A 1PXVA 3OISA 5CVNB 3IHPA 1BY8A 5JA7A 4BQVA 2HXZA 1QDQA 4I07A 4QH6A 1NB3A 2R9MA 2HH5A 3BOWA 2FQ9A 3MJ5A 2YJ2A 4N79A 1THEA 1A6RA 1MS6A 5A24A 1YK8A 2JQFR 5EZSA 5CVOB 2YJ9A 2IBIA 3N3KA 2Y6EA 5CHTA 3D6SA 2ACTA 2YJCA 1F29A 1MIRA 2HD5A 3HD3A 3I06A 2G8EA 3KW9A 4AXLA 2DC8A 1PPNA 3M99A 1YT7A 3RVVA 4CDDB 3H89A 2YJ8A 4N8WA 2XU5A 4OVZB 4ZTBA 2VHSA 2R9OA 1EWLA 3KX1A 3PDFA 3OF8A 4P16A 1M6DA 2Z84A 1TL9A 3PHXA 4X6IA 1PIPA 2DC6A 1PADA 2NQAA 3P5WA 2CIOA 3N3GA 1VSNA 1AU4A 1AU0A 1BQIA 5F02A 1YALA 4MI7A 2GHUA 3MP2A 4FJCA 1MEGA 2FTDA 2DJGB 2F1GA 1U9VA 2R6NA 2BTWA 3O65A 1NLJA 1KFUL 2Y5BA 3P5VA 1DKIA 1QOLA 2PBHA 3H8CA 3U8EA 2JTCA 1SNKA 2ARYA 1STFE 4DMYA 3P5UA 4RF0A 3IUTA 1K3BB 2FE8A 4QBBA 4YYRA 4KLBA 5CHVA 4YYVA 3ERVA 3MTVA 4YYQA 1AYUA 1F2CA 3V6CA 1FH0A 2PADA 4YVAA 1NB5A 5J94A 4XR7A 2E01A 2XU4A 1YZBA 2E03A 3S3QA 3ZUAA 2H7JA 4ZUXU 1CVZA 3W30A 1U9QX 2P86A 4I05A 3PHWA 1NL6A 4M0WA 1TLOA 2FYEA 1QMYA 4MSXA 2AIMA 1GECE 4XUIA 1U5IA 1CS8A 3HHAA 4PP1A 3KWBX 4QRGA 2AVWA 4Q8HA 4P6GA 3TMPA 4BOUA 1CB5A 3C0RA 3PHUA 1BP4A 4AXMA 5EGWA 5JH3A 4BPVA 1MDWA 1CQDA 5EZQA 4YYWA 4RNAA 3RVXA 2XU3A 2R9NA 2PNSA 5K16A 1IWDA 2F7DA 1AYVA 1PBHA 1JQPA 2UZJA 4D8IA 3K24A 2BDZA 3E1ZB 1CV8A 4WA6A 3BBAA 2J7QA 3K8UA 2R9CA 3AI8A 3W31A 3BPMA 3H6SA 2GFOA 4BOPA 2CB5A 2O6XA 3C9EA 3KSEA 4W4UA 3QJ3A 1AIMA 1MHWA 4QRVA 1GCBA 4CDEB 1ATKA 4BS5A 3MHHA 3WXGA 8PCHA 2WBFX 1CJLA 1NPZA 1AECA 3CBKA 3PSEA 2AUXA 1ME4A 1CSBB 2BTWB 3BC3A 3BY4A 4A5UA 3IFUA 4K7CA 3GCBA 3IOQA 2OULA 3TRKA 3O0UA 1ZCMA 2DC9A 4PI3A 4W5CA 2BDLA 1PPOA 3PNRA 4R3DA 3BCNA 3CH2X 4FIPA 4YYUA 2NQDB 3IEJA 4IP3A 4PP2E 2ATOA 3CH3X 1KHQA 3BB7A 1HUCB 2B1MA 2DCDA 3BPFA 1X9YA 3E9SA 4BOSA 2P0RA 3BWKA 4RY2A 2C0YA 2HHNA 3KKUA 1Q6KA 3OQCA 3OF9A 4IUMA 1O0EA 4CDCB 3I3TA 7PCKA 3PW3A 1F2AA 3KFQA 2OZ2A 2FRAA 2BU3A 3P5XA 3MTNA 2G8JA 3HHIA 2DC7A 4W5BA 4YYSA 1XKGA 3B79A 2E00A 1CTEA 3H7DA 4DMXA 1U9WA 3WXEA 5JZEA 2AU1A 2AYNA 4D8EA 1TU6A 1S4VA 2NQGA 2DZZA 4OEMA
chains in the Genus database with same CATH topology
1DF0A 2BSZA 3USVA 1BGOA 4BS6A 2DCBA 4MZSA 1Y4HA 2IPPB 4C5PA 1ITOA 3DF0A 4I04A 3NHEA 4N4ZA 1KHPA 4BGFA 4Q8GA 1EWMA 1POPA 2NQIA 9PAPA 1KXRA 2P7UA 3KWZA 3V6EA 1CPJA 4BSQA 2FO5A 3LFYA 1SP4B 1Y08A 5FPWA 2FT2A 3F75A 1EWOA 2B1NA 3K9MA 1GX3A 4MZOA 3HWNA 3H8BA 1AU2A 2DCCA 2FRQA 3TNXA 1ICFA 1PCIA 4X6JA 5CVMA 3OVXA 2G7YA 2VHFA 4OELA 4QRXA 4YV8A 1DEUA 1F2BA 1AYWA 4P6EA 4FK5A 1PPPA 5PADA 2JQGR 3OVZA 2E02A 2DJFB 1PE6A 3QT4A 3MORA 2XU1A 2G6DA 2AUZA 1KFXL 1EWPA 1PPDA 3WXFA 3IMAA 1AU3A 1VJVA 2FUDA 2PREA 1MEMA 4CDFB 1QXPA 3O1GA 3QSDA 1GLOA 2DZYA 4PADA 3S3RA 6PADA 3PBHA 3LXSA 1NQCA 3IV2A 2AYOA 3RVWA 1ME3A 2DCAA 4HWYA 4G54A 4CZWA 3F5VA 3MHSA 1U9XA 4X6HA 2YJBA 2R9FA 1EF7A 5EF4A 1YK7A 3CBJA 3N4CA 1ZIVA 1YVBA 2AS8A 1GMYA 2OP3A 1PXVA 3OISA 5CVNB 3IHPA 1BY8A 5JA7A 4BQVA 2HXZA 1QDQA 4I07A 4QH6A 1NB3A 2R9MA 4NV8A 2HH5A 3BOWA 2FQ9A 2YJ2A 4N79A 1THEA 1A6RA 1MS6A 5A24A 1YK8A 2JQFR 2VFCA 5CVOB 2YJ9A 2IBIA 3N3KA 2Y6EA 5CHTA 3D6SA 2ACTA 2YJCA 1F29A 1MIRA 2HD5A 3HD3A 3I06A 2G8EA 3KW9A 4AXLA 2DC8A 1PPNA 3M99A 1YT7A 3RVVA 4CDDB 3H89A 2YJ8A 4N8WA 2XU5A 2VHSA 2R9OA 1EWLA 3KX1A 3PDFA 3OF8A 1M6DA 4X6IA 1TL9A 1PIPA 2DC6A 1PADA 2NQAA 3P5WA 2CIOA 1VSNA 1AU4A 3N3GA 1AU0A 1BQIA 5F02A 1YALA 4FJCA 2GHUA 1MEGA 2VFBA 2FTDA 2DJGB 2F1GA 1U9VA 2R6NA 1NLJA 2Y5BA 1KFUL 3P5VA 1QOLA 2PBHA 3H8CA 3U8EA 1STFE 1SNKA 2ARYA 4DMYA 3P5UA 3IUTA 1K3BB 4B55A 4QBBA 4YYRA 4KLBA 5CHVA 4YYVA 3ERVA 4YYQA 1AYUA 1F2CA 3V6CA 1FH0A 2PADA 4YVAA 1NB5A 5J94A 4XR7A 2E01A 2XU4A 2E03A 3S3QA 3ZUAA 2H7JA 4ZUXU 1CVZA 1U9QX 2P86A 4I05A 1NL6A 1TLOA 2FYEA 1QMYA 4MSXA 2AIMA 1W5RA 1GECE 4XUIA 1U5IA 1CS8A 3HHAA 4PP1A 3KWBX 4QRGA 2AVWA 4Q8HA 4P6GA 1CB5A 4AXMA 1BP4A 5JH3A 5EGWA 4BPVA 1MDWA 1CQDA 4YYWA 4NV7A 3RVXA 2XU3A 2R9NA 2PNSA 5K16A 3D9WA 1IWDA 2F7DA 1AYVA 1PBHA 1JQPA 3K24A 2BDZA 3E1ZB 1CV8A 4WA6A 3K8UA 2R9CA 3AI8A 3BPMA 3H6SA 2GFOA 2CB5A 2O6XA 3C9EA 3KSEA 4W4UA 3QJ3A 1AIMA 1MHWA 4QRVA 1GCBA 4CDEB 1ATKA 4BS5A 3MHHA 3WXGA 8PCHA 2WBFX 1CJLA 1NPZA 1AECA 3CBKA 2AUXA 1ME4A 1CSBB 3BC3A 1W6FA 4K7CA 3GCBA 3IOQA 2OULA 3O0UA 1ZCMA 3LTWA 2DC9A 4PI3A 4W5CA 2BDLA 1PPOA 3PNRA 3BCNA 3CH2X 4FIPA 4YYUA 2NQDB 3IEJA 4GUZA 4PP2E 2ATOA 3CH3X 1KHQA 1HUCB 2B1MA 2DCDA 3BPFA 1X9YA 1E2TA 2P0RA 3BWKA 4RY2A 2C0YA 2HHNA 3KKUA 1Q6KA 3OF9A 1O0EA 4CDCB 3I3TA 7PCKA 3PW3A 1F2AA 3KFQA 2OZ2A 2FRAA 3P5XA 3MTNA 2G8JA 3HHIA 2DC7A 4W5BA 4YYSA 1XKGA 3B79A 2E00A 1CTEA 3H7DA 4DMXA 1U9WA 3WXEA 2AU1A 2AYNA 1TU6A 1W4TA 1S4VA 2NQGA 2DZZA 4OEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF0 A;  3USV A;  1BGO A;  4BS6 A;  2DCB A;  4MZS A;  1Y4H A;  2IPP B;  1ITO A;  3DF0 A;  4I04 A;  3NHE A;  4N4Z A;  1KHP A;  4Q8G A;  1EWM A;  1POP A;  2NQI A;  9PAP A;  1KXR A;  2P7U A;  3KWZ A;  3V6E A;  1CPJ A;  4BSQ A;  2FO5 A;  3LFY A;  1SP4 B;  1Y08 A;  5FPW A;  2FT2 A;  3F75 A;  1EWO A;  2B1N A;  3K9M A;  4MZO A;  3HWN A;  3H8B A;  1AU2 A;  2DCC A;  2FRQ A;  3TNX A;  1ICF A;  1PCI A;  4X6J A;  5CVM A;  3OVX A;  2G7Y A;  2VHF A;  4OEL A;  4QRX A;  4YV8 A;  1DEU A;  1F2B A;  1AYW A;  4P6E A;  4FK5 A;  1PPP A;  5PAD A;  2JQG R;  3OVZ A;  2E02 A;  2DJF B;  1PE6 A;  3QT4 A;  3MOR A;  2XU1 A;  2G6D A;  2AUZ A;  1KFX L;  1EWP A;  1PPD A;  3WXF A;  3IMA A;  1AU3 A;  1VJV A;  2FUD A;  2PRE A;  1MEM A;  4CDF B;  1QXP A;  3O1G A;  3QSD A;  1GLO A;  2DZY A;  4PAD A;  3S3R A;  6PAD A;  3PBH A;  3LXS A;  1NQC A;  3IV2 A;  2AYO A;  3RVW A;  1ME3 A;  2DCA A;  4HWY A;  4G54 A;  4CZW A;  3F5V A;  3MHS A;  1U9X A;  4X6H A;  2YJB A;  2R9F A;  1EF7 A;  5EF4 A;  1YK7 A;  3CBJ A;  3N4C A;  1ZIV A;  1YVB A;  2AS8 A;  1GMY A;  2OP3 A;  1PXV A;  3OIS A;  5CVN B;  3IHP A;  1BY8 A;  5JA7 A;  4BQV A;  2HXZ A;  1QDQ A;  4I07 A;  4QH6 A;  1NB3 A;  2R9M A;  2HH5 A;  3BOW A;  2FQ9 A;  2YJ2 A;  4N79 A;  1THE A;  1A6R A;  1MS6 A;  5A24 A;  1YK8 A;  2JQF R;  5CVO B;  2YJ9 A;  2IBI A;  3N3K A;  2Y6E A;  5CHT A;  3D6S A;  2ACT A;  2YJC A;  1F29 A;  1MIR A;  2HD5 A;  3HD3 A;  3I06 A;  2G8E A;  3KW9 A;  4AXL A;  2DC8 A;  1PPN A;  3M99 A;  1YT7 A;  3RVV A;  4CDD B;  3H89 A;  2YJ8 A;  4N8W A;  2XU5 A;  2VHS A;  2R9O A;  1EWL A;  3KX1 A;  3PDF A;  3OF8 A;  1M6D A;  4X6I A;  1TL9 A;  1PIP A;  2DC6 A;  1PAD A;  2NQA A;  3P5W A;  2CIO A;  1VSN A;  1AU4 A;  3N3G A;  1AU0 A;  1BQI A;  5F02 A;  1YAL A;  4FJC A;  2GHU A;  1MEG A;  2FTD A;  2DJG B;  2F1G A;  1U9V A;  2R6N A;  1NLJ A;  2Y5B A;  1KFU L;  3P5V A;  1QOL A;  2PBH A;  3H8C A;  3U8E A;  1STF E;  1SNK A;  2ARY A;  4DMY A;  3P5U A;  3IUT A;  1K3B B;  4QBB A;  4YYR A;  4KLB A;  5CHV A;  4YYV A;  3ERV A;  4YYQ A;  1AYU A;  1F2C A;  3V6C A;  1FH0 A;  2PAD A;  4YVA A;  1NB5 A;  5J94 A;  4XR7 A;  2E01 A;  2XU4 A;  2E03 A;  3S3Q A;  3ZUA A;  2H7J A;  4ZUX U;  1CVZ A;  1U9Q X;  2P86 A;  4I05 A;  1NL6 A;  1TLO A;  2FYE A;  1QMY A;  4MSX A;  2AIM A;  1GEC E;  4XUI A;  1U5I A;  1CS8 A;  3HHA A;  4PP1 A;  3KWB X;  4QRG A;  2AVW A;  4Q8H A;  4P6G A;  1CB5 A;  4AXM A;  1BP4 A;  5JH3 A;  5EGW A;  4BPV A;  1MDW A;  1CQD A;  4YYW A;  3RVX A;  2XU3 A;  2R9N A;  2PNS A;  5K16 A;  1IWD A;  2F7D A;  1AYV A;  1PBH A;  1JQP A;  3K24 A;  2BDZ A;  3E1Z B;  1CV8 A;  4WA6 A;  3K8U A;  2R9C A;  3AI8 A;  3BPM A;  3H6S A;  2GFO A;  2CB5 A;  2O6X A;  3C9E A;  3KSE A;  4W4U A;  3QJ3 A;  1AIM A;  1MHW A;  4QRV A;  1GCB A;  4CDE B;  1ATK A;  4BS5 A;  3MHH A;  3WXG A;  8PCH A;  2WBF X;  1CJL A;  1NPZ A;  1AEC A;  3CBK A;  2AUX A;  1ME4 A;  1CSB B;  3BC3 A;  4K7C A;  3GCB A;  3IOQ A;  2OUL A;  3O0U A;  1ZCM A;  2DC9 A;  4PI3 A;  4W5C A;  2BDL A;  1PPO A;  3PNR A;  3BCN A;  3CH2 X;  4FIP A;  4YYU A;  2NQD B;  3IEJ A;  4PP2 E;  2ATO A;  3CH3 X;  1KHQ A;  1HUC B;  2B1M A;  2DCD A;  3BPF A;  1X9Y A;  2P0R A;  3BWK A;  4RY2 A;  2C0Y A;  2HHN A;  3KKU A;  1Q6K A;  3OF9 A;  1O0E A;  4CDC B;  3I3T A;  7PCK A;  3PW3 A;  1F2A A;  3KFQ A;  2OZ2 A;  2FRA A;  3P5X A;  3MTN A;  2G8J A;  3HHI A;  2DC7 A;  4W5B A;  4YYS A;  1XKG A;  3B79 A;  2E00 A;  1CTE A;  3H7D A;  4DMX A;  1U9W A;  3WXE A;  2AU1 A;  2AYN A;  1TU6 A;  1S4V A;  2NQG A;  2DZZ A;  4OEM A; 
#chains in the Genus database with same CATH topology
 1DF0 A;  3PRP A;  3USV A;  1BGO A;  4BS6 A;  2DCB A;  3RNV A;  4MZS A;  1Y4H A;  1PVJ A;  2IPP B;  5E6J A;  1ITO A;  4BOQ A;  3DF0 A;  4I04 A;  3NHE A;  4N4Z A;  1KHP A;  4Q8G A;  1EWM A;  1POP A;  2NQI A;  9PAP A;  1KXR A;  2P7U A;  3KWZ A;  3V6E A;  1CPJ A;  4BSQ A;  2FO5 A;  3LFY A;  1SP4 B;  1Y08 A;  5FPW A;  2FT2 A;  3F75 A;  2AGA A;  1EWO A;  2B1N A;  4XZX A;  3K9M A;  4MZO A;  3HWN A;  3H8B A;  1AU2 A;  2DCC A;  2FRQ A;  3TNX A;  1ICF A;  1PCI A;  4X6J A;  5CVM A;  3ZNH A;  3OVX A;  4OW0 A;  2G7Y A;  2VHF A;  4OVZ A;  4OEL A;  3PT2 A;  4QRX A;  4YV8 A;  1DEU A;  4PT5 A;  1F2B A;  1AYW A;  4P6E A;  4FK5 A;  4D8B A;  1PPP A;  5PAD A;  2JQG R;  3OVZ A;  2E02 A;  2DJF B;  1PE6 A;  3QT4 A;  4RKX A;  3MOR A;  2XU1 A;  2G6D A;  4WUR A;  2AUZ A;  1KFX L;  1EWP A;  1PPD A;  4GUA A;  3WXF A;  3IMA A;  1AU3 A;  1VJV A;  2FUD A;  1UKF A;  2PRE A;  2HWK A;  1MEM A;  4RF1 A;  3PRM A;  3B21 A;  4CDF B;  1QXP A;  3O1G A;  3QSD A;  5KO3 A;  1GLO A;  2DZY A;  4PAD A;  3S3R A;  6PAD A;  4MM3 B;  3PBH A;  3LXS A;  2DOS A;  2JRI A;  1NQC A;  3IV2 A;  2AYO A;  3RVW A;  1ME3 A;  2DCA A;  4HWY A;  4G54 A;  4CZW A;  3F5V A;  3MHS A;  1U9X A;  4X6H A;  2YJB A;  2R9F A;  1EF7 A;  4REZ A;  5EF4 A;  4HXD B;  1YK7 A;  3CBJ A;  3N4C A;  1ZIV A;  1YVB A;  4BOZ A;  2AS8 A;  1GMY A;  2J7Q C;  2OP3 A;  1PXV A;  3OIS A;  5CVN B;  3IHP A;  1BY8 A;  5JA7 A;  4BQV A;  2HXZ A;  1QDQ A;  4I07 A;  4QH6 A;  1NB3 A;  2R9M A;  2HH5 A;  3BOW A;  2FQ9 A;  3MJ5 A;  2YJ2 A;  4N79 A;  1THE A;  1A6R A;  1MS6 A;  5A24 A;  1YK8 A;  2JQF R;  5EZS A;  5CVO B;  2YJ9 A;  2IBI A;  3N3K A;  2Y6E A;  5CHT A;  3D6S A;  2ACT A;  2YJC A;  1F29 A;  1MIR A;  2HD5 A;  3HD3 A;  3I06 A;  2G8E A;  3KW9 A;  4AXL A;  2DC8 A;  1PPN A;  3M99 A;  1YT7 A;  3RVV A;  4CDD B;  3H89 A;  2YJ8 A;  4N8W A;  2XU5 A;  4OVZ B;  4ZTB A;  2VHS A;  2R9O A;  1EWL A;  3KX1 A;  3PDF A;  3OF8 A;  4P16 A;  1M6D A;  2Z84 A;  1TL9 A;  3PHX A;  4X6I A;  1PIP A;  2DC6 A;  1PAD A;  2NQA A;  3P5W A;  2CIO A;  3N3G A;  1VSN A;  1AU4 A;  1AU0 A;  1BQI A;  5F02 A;  1YAL A;  4MI7 A;  2GHU A;  3MP2 A;  4FJC A;  1MEG A;  2FTD A;  2DJG B;  2F1G A;  1U9V A;  2R6N A;  2BTW A;  3O65 A;  1NLJ A;  1KFU L;  2Y5B A;  3P5V A;  1DKI A;  1QOL A;  2PBH A;  3H8C A;  3U8E A;  2JTC A;  1SNK A;  2ARY A;  1STF E;  4DMY A;  3P5U A;  4RF0 A;  3IUT A;  1K3B B;  2FE8 A;  4QBB A;  4YYR A;  4KLB A;  5CHV A;  4YYV A;  3ERV A;  3MTV A;  4YYQ A;  1AYU A;  1F2C A;  3V6C A;  1FH0 A;  2PAD A;  4YVA A;  1NB5 A;  5J94 A;  4XR7 A;  2E01 A;  2XU4 A;  1YZB A;  2E03 A;  3S3Q A;  3ZUA A;  2H7J A;  4ZUX U;  1CVZ A;  3W30 A;  1U9Q X;  2P86 A;  4I05 A;  3PHW A;  1NL6 A;  4M0W A;  1TLO A;  2FYE A;  1QMY A;  4MSX A;  2AIM A;  1GEC E;  4XUI A;  1U5I A;  1CS8 A;  3HHA A;  4PP1 A;  3KWB X;  4QRG A;  2AVW A;  4Q8H A;  4P6G A;  3TMP A;  4BOU A;  1CB5 A;  3C0R A;  3PHU A;  1BP4 A;  4AXM A;  5EGW A;  5JH3 A;  4BPV A;  1MDW A;  1CQD A;  5EZQ A;  4YYW A;  4RNA A;  3RVX A;  2XU3 A;  2R9N A;  2PNS A;  5K16 A;  1IWD A;  2F7D A;  1AYV A;  1PBH A;  1JQP A;  2UZJ A;  4D8I A;  3K24 A;  2BDZ A;  3E1Z B;  1CV8 A;  4WA6 A;  3BBA A;  2J7Q A;  3K8U A;  2R9C A;  3AI8 A;  3W31 A;  3BPM A;  3H6S A;  2GFO A;  4BOP A;  2CB5 A;  2O6X A;  3C9E A;  3KSE A;  4W4U A;  3QJ3 A;  1AIM A;  1MHW A;  4QRV A;  1GCB A;  4CDE B;  1ATK A;  4BS5 A;  3MHH A;  3WXG A;  8PCH A;  2WBF X;  1CJL A;  1NPZ A;  1AEC A;  3CBK A;  3PSE A;  2AUX A;  1ME4 A;  1CSB B;  2BTW B;  3BC3 A;  3BY4 A;  4A5U A;  3IFU A;  4K7C A;  3GCB A;  3IOQ A;  2OUL A;  3TRK A;  3O0U A;  1ZCM A;  2DC9 A;  4PI3 A;  4W5C A;  2BDL A;  1PPO A;  3PNR A;  4R3D A;  3BCN A;  3CH2 X;  4FIP A;  4YYU A;  2NQD B;  3IEJ A;  4IP3 A;  4PP2 E;  2ATO A;  3CH3 X;  1KHQ A;  3BB7 A;  1HUC B;  2B1M A;  2DCD A;  3BPF A;  1X9Y A;  3E9S A;  4BOS A;  2P0R A;  3BWK A;  4RY2 A;  2C0Y A;  2HHN A;  3KKU A;  1Q6K A;  3OQC A;  3OF9 A;  4IUM A;  1O0E A;  4CDC B;  3I3T A;  7PCK A;  3PW3 A;  1F2A A;  3KFQ A;  2OZ2 A;  2FRA A;  2BU3 A;  3P5X A;  3MTN A;  2G8J A;  3HHI A;  2DC7 A;  4W5B A;  4YYS A;  1XKG A;  3B79 A;  2E00 A;  1CTE A;  3H7D A;  4DMX A;  1U9W A;  3WXE A;  5JZE A;  2AU1 A;  2AYN A;  4D8E A;  1TU6 A;  1S4V A;  2NQG A;  2DZZ A;  4OEM A; 
#chains in the Genus database with same CATH homology
 1DF0 A;  2BSZ A;  3USV A;  1BGO A;  4BS6 A;  2DCB A;  4MZS A;  1Y4H A;  2IPP B;  4C5P A;  1ITO A;  3DF0 A;  4I04 A;  3NHE A;  4N4Z A;  1KHP A;  4BGF A;  4Q8G A;  1EWM A;  1POP A;  2NQI A;  9PAP A;  1KXR A;  2P7U A;  3KWZ A;  3V6E A;  1CPJ A;  4BSQ A;  2FO5 A;  3LFY A;  1SP4 B;  1Y08 A;  5FPW A;  2FT2 A;  3F75 A;  1EWO A;  2B1N A;  3K9M A;  1GX3 A;  4MZO A;  3HWN A;  3H8B A;  1AU2 A;  2DCC A;  2FRQ A;  3TNX A;  1ICF A;  1PCI A;  4X6J A;  5CVM A;  3OVX A;  2G7Y A;  2VHF A;  4OEL A;  4QRX A;  4YV8 A;  1DEU A;  1F2B A;  1AYW A;  4P6E A;  4FK5 A;  1PPP A;  5PAD A;  2JQG R;  3OVZ A;  2E02 A;  2DJF B;  1PE6 A;  3QT4 A;  3MOR A;  2XU1 A;  2G6D A;  2AUZ A;  1KFX L;  1EWP A;  1PPD A;  3WXF A;  3IMA A;  1AU3 A;  1VJV A;  2FUD A;  2PRE A;  1MEM A;  4CDF B;  1QXP A;  3O1G A;  3QSD A;  1GLO A;  2DZY A;  4PAD A;  3S3R A;  6PAD A;  3PBH A;  3LXS A;  1NQC A;  3IV2 A;  2AYO A;  3RVW A;  1ME3 A;  2DCA A;  4HWY A;  4G54 A;  4CZW A;  3F5V A;  3MHS A;  1U9X A;  4X6H A;  2YJB A;  2R9F A;  1EF7 A;  5EF4 A;  1YK7 A;  3CBJ A;  3N4C A;  1ZIV A;  1YVB A;  2AS8 A;  1GMY A;  2OP3 A;  1PXV A;  3OIS A;  5CVN B;  3IHP A;  1BY8 A;  5JA7 A;  4BQV A;  2HXZ A;  1QDQ A;  4I07 A;  4QH6 A;  1NB3 A;  2R9M A;  4NV8 A;  2HH5 A;  3BOW A;  2FQ9 A;  2YJ2 A;  4N79 A;  1THE A;  1A6R A;  1MS6 A;  5A24 A;  1YK8 A;  2JQF R;  2VFC A;  5CVO B;  2YJ9 A;  2IBI A;  3N3K A;  2Y6E A;  5CHT A;  3D6S A;  2ACT A;  2YJC A;  1F29 A;  1MIR A;  2HD5 A;  3HD3 A;  3I06 A;  2G8E A;  3KW9 A;  4AXL A;  2DC8 A;  1PPN A;  3M99 A;  1YT7 A;  3RVV A;  4CDD B;  3H89 A;  2YJ8 A;  4N8W A;  2XU5 A;  2VHS A;  2R9O A;  1EWL A;  3KX1 A;  3PDF A;  3OF8 A;  1M6D A;  4X6I A;  1TL9 A;  1PIP A;  2DC6 A;  1PAD A;  2NQA A;  3P5W A;  2CIO A;  1VSN A;  1AU4 A;  3N3G A;  1AU0 A;  1BQI A;  5F02 A;  1YAL A;  4FJC A;  2GHU A;  1MEG A;  2VFB A;  2FTD A;  2DJG B;  2F1G A;  1U9V A;  2R6N A;  1NLJ A;  2Y5B A;  1KFU L;  3P5V A;  1QOL A;  2PBH A;  3H8C A;  3U8E A;  1STF E;  1SNK A;  2ARY A;  4DMY A;  3P5U A;  3IUT A;  1K3B B;  4B55 A;  4QBB A;  4YYR A;  4KLB A;  5CHV A;  4YYV A;  3ERV A;  4YYQ A;  1AYU A;  1F2C A;  3V6C A;  1FH0 A;  2PAD A;  4YVA A;  1NB5 A;  5J94 A;  4XR7 A;  2E01 A;  2XU4 A;  2E03 A;  3S3Q A;  3ZUA A;  2H7J A;  4ZUX U;  1CVZ A;  1U9Q X;  2P86 A;  4I05 A;  1NL6 A;  1TLO A;  2FYE A;  1QMY A;  4MSX A;  2AIM A;  1W5R A;  1GEC E;  4XUI A;  1U5I A;  1CS8 A;  3HHA A;  4PP1 A;  3KWB X;  4QRG A;  2AVW A;  4Q8H A;  4P6G A;  1CB5 A;  4AXM A;  1BP4 A;  5JH3 A;  5EGW A;  4BPV A;  1MDW A;  1CQD A;  4YYW A;  4NV7 A;  3RVX A;  2XU3 A;  2R9N A;  2PNS A;  5K16 A;  3D9W A;  1IWD A;  2F7D A;  1AYV A;  1PBH A;  1JQP A;  3K24 A;  2BDZ A;  3E1Z B;  1CV8 A;  4WA6 A;  3K8U A;  2R9C A;  3AI8 A;  3BPM A;  3H6S A;  2GFO A;  2CB5 A;  2O6X A;  3C9E A;  3KSE A;  4W4U A;  3QJ3 A;  1AIM A;  1MHW A;  4QRV A;  1GCB A;  4CDE B;  1ATK A;  4BS5 A;  3MHH A;  3WXG A;  8PCH A;  2WBF X;  1CJL A;  1NPZ A;  1AEC A;  3CBK A;  2AUX A;  1ME4 A;  1CSB B;  3BC3 A;  1W6F A;  4K7C A;  3GCB A;  3IOQ A;  2OUL A;  3O0U A;  1ZCM A;  3LTW A;  2DC9 A;  4PI3 A;  4W5C A;  2BDL A;  1PPO A;  3PNR A;  3BCN A;  3CH2 X;  4FIP A;  4YYU A;  2NQD B;  3IEJ A;  4GUZ A;  4PP2 E;  2ATO A;  3CH3 X;  1KHQ A;  1HUC B;  2B1M A;  2DCD A;  3BPF A;  1X9Y A;  1E2T A;  2P0R A;  3BWK A;  4RY2 A;  2C0Y A;  2HHN A;  3KKU A;  1Q6K A;  3OF9 A;  1O0E A;  4CDC B;  3I3T A;  7PCK A;  3PW3 A;  1F2A A;  3KFQ A;  2OZ2 A;  2FRA A;  3P5X A;  3MTN A;  2G8J A;  3HHI A;  2DC7 A;  4W5B A;  4YYS A;  1XKG A;  3B79 A;  2E00 A;  1CTE A;  3H7D A;  4DMX A;  1U9W A;  3WXE A;  2AU1 A;  2AYN A;  1TU6 A;  1W4T A;  1S4V A;  2NQG A;  2DZZ A;  4OEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...