2IPPB

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
VSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
molecule tags Hydrolase
molecule keywords Cathepsin B
total genus 46
structure length 205
sequence length 205
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2ippB00
1DEUA 2R6NA 3ERVA 2R9MA 2AVWA 1KFUL 4YYVA 4N8WA 1BGOA 2DC6A 3I06A 1MIRA 3RVXA 1TU6A 3LXSA 2DCAA 2VHSA 3H8CA 1K3BB 1ZCMA 1ITOA 4PI3A 2FT2A 3KWBX 3K8UA 2FRQA 2XU1A 1AYWA 1MS6A 4Q8GA 2AU1A 3TNXA 4CDFB 4CDEB 1EF7A 2FUDA 1Q6KA 4YYQA 4ZUXU 2FRAA 3CH3X 1GECE 3PW3A 4WA6A 1JQPA 3H6SA 2HHNA 1YT7A 2DC8A 3HHIA 2E00A 2YJ9A 1NPZA 2AUXA 2YJCA 3V6EA 3WXFA 2HXZA 4YYSA 3S3QA 1KFXL 2C0YA 2R9OA 1F2AA 3C9EA 4FIPA 2E03A 3CH2X 2P86A 2XU5A 1CPJA 2CB5A 1U9VA 4QBBA 1PADA 1ICFA 2XU3A 4MZOA 3KKUA 2IBIA 4CDCB 2HD5A 2FO5A 1ME4A 4I05A 2Y5BA 5FPWA 1AYVA 1PPNA 2PADA 1QDQA 2DC9A 4YVAA 4P6GA 2IPPB 5JA7A 1PBHA 1STFE 3E1ZB 4W5BA 1AYUA 5PADA 4DMYA 3KFQA 1AECA 1GMYA 1AU4A 2O6XA 3BC3A 2DZZA 4AXLA 2WBFX 4PP2E 4W4UA 3WXEA 1YK8A 3P5XA 4QRGA 4BS6A 1MEMA 3H8BA 1EWOA 3BCNA 4DMXA 1VSNA 1KXRA 1YVBA 1ME3A 1Y08A 5EGWA 1ZIVA 2B1MA 4HWYA 3RVVA 2HH5A 4YYUA 1M6DA 1PCIA 3LFYA 2AS8A 2YJBA 1U5IA 5CHTA 3HWNA 5CVOB 1BQIA 1F29A 3KW9A 1EWLA 2B1NA 4K7CA 4G54A 4BSQA 1PPPA 4CDDB 3IUTA 1MDWA 1IWDA 4PADA 5J94A 1U9QX 2JQGR 2AUZA 3B79A 2E02A 2ACTA 3F75A 3MTNA 3O0UA 1AIMA 2NQIA 3H7DA 4CZWA 2CIOA 2PREA 3IMAA 4FK5A 1CSBB 3P5WA 4X6HA 2FYEA 2E01A 4N4ZA 3GCBA 3BPMA 3OVZA 3KSEA 1MEGA 3AI8A 4XR7A 2AYNA 7PCKA 6PADA 1U9XA 4Q8HA 2P0RA 3HD3A 2R9NA 1CJLA 1HUCB 1MHWA 2R9CA 2JQFR 3K9MA 4MSXA 1KHQA 4YYWA 1NQCA 3PDFA 2AIMA 5A24A 3N3GA 1FH0A 1A6RA 5CVMA 1VJVA 3IEJA 4QH6A 2PBHA 2YJ8A 3V6CA 3WXGA 3MHHA 2DC7A 1SP4B 3OF9A 3F5VA 4YYRA 4KLBA 1Y4HA 1NLJA 2NQAA 3KWZA 1NB5A 3PBHA 2DZYA 3N3KA 3P5UA 2ARYA 2G6DA 1AU0A 1PPOA 1F2BA 4OEMA 4QRXA 3N4CA 1EWPA 2BDLA 1NL6A 3HHAA 3PNRA 5K16A 1YALA 3OF8A 4XUIA 3MORA 2FTDA 3D6SA 4X6JA 4BQVA 3BWKA 3S3RA 2AYOA 3RVWA 1PPDA 3USVA 2BDZA 2Y6EA 1SNKA 3U8EA 2F1GA 4I07A 1CQDA 3OISA 5CVNB 4P6EA 1XKGA 4I04A 4N79A 2GFOA 1PE6A 3QT4A 1DF0A 2P7UA 2F7DA 3NHEA 2G8JA 4MZSA 2DCBA 4BS5A 3H89A 1U9WA 1ATKA 1PXVA 1S4VA 4RY2A 3BOWA 3ZUAA 2YJ2A 1AU3A 4X6IA 2PNSA 1CB5A 2H7JA 1THEA 2G8EA 3IOQA 3O1GA 1EWMA 9PAPA 3K24A 3DF0A 3BPFA 5JH3A 1CTEA 4YV8A 2FQ9A 2OULA 1GCBA 1AU2A 2G7YA 2DJGB 5CHVA 1CVZA 1PIPA 8PCHA 3IHPA 4FJCA 2ATOA 3KX1A 2R9FA 5F02A 1TL9A 1QMYA 4QRVA 2VHFA 1NB3A 2OP3A 3OVXA 1QOLA 1BP4A 5EF4A 3IV2A 3I3TA 2GHUA 3MHSA 1F2CA 3P5VA 4OELA 3QSDA 1X9YA 1CV8A 1QXPA 3QJ3A 1GLOA 2DCCA 1CS8A 2XU4A 4BPVA 1TLOA 1BY8A 1POPA 4AXMA 3CBJA 2DCDA 2DJFB 1YK7A 3CBKA 4W5CA 2OZ2A 1O0EA 2NQGA 3M99A 2NQDB 1KHPA 4PP1A
chains in the Genus database with same CATH superfamily
1DEUA 2R6NA 3ERVA 2R9MA 2AVWA 1KFUL 4YYVA 4N8WA 1BGOA 2DC6A 3I06A 3RNVA 1MIRA 3RVXA 1TU6A 3LXSA 2DCAA 2VHSA 3H8CA 1K3BB 3PRPA 1ZCMA 1ITOA 4PI3A 2FT2A 4OW0A 3KWBX 3K8UA 2FRQA 2XU1A 1AYWA 1MS6A 3PHXA 4Q8GA 2AU1A 3TNXA 4CDFB 4CDEB 1EF7A 2FUDA 1Q6KA 4YYQA 4ZUXU 3W30A 2FRAA 3CH3X 1GECE 3PW3A 2DOSA 4WA6A 1JQPA 3H6SA 2HHNA 1YT7A 5KO3A 2DC8A 3HHIA 2E00A 2YJ9A 1NPZA 2AUXA 2YJCA 3V6EA 3WXFA 2HXZA 4YYSA 1KFXL 2C0YA 2R9OA 3S3QA 1F2AA 3C9EA 4FIPA 2E03A 3CH2X 2P86A 2Z84A 1YZBA 2XU5A 1CPJA 2CB5A 1U9VA 4QBBA 1PADA 1ICFA 2XU3A 4MZOA 3KKUA 2IBIA 4CDCB 5EZQA 2HD5A 2FO5A 1ME4A 4I05A 2Y5BA 5FPWA 1AYVA 1PPNA 2PADA 2UZJA 1QDQA 2DC9A 4YVAA 4P6GA 2IPPB 5JA7A 1PBHA 1STFE 3E1ZB 4W5BA 1AYUA 5PADA 4DMYA 3KFQA 1AECA 1DKIA 1GMYA 1AU4A 2O6XA 3BC3A 2DZZA 4AXLA 2WBFX 4PP2E 4W4UA 3WXEA 4BOZA 1YK8A 3P5XA 4QRGA 2HWKA 4BS6A 1MEMA 3H8BA 1EWOA 3BCNA 4DMXA 1VSNA 3O65A 4BOQA 1KXRA 1YVBA 1ME3A 1Y08A 5EGWA 1ZIVA 2B1MA 4HWYA 3C0RA 3RVVA 2HH5A 4YYUA 4MI7A 1M6DA 1PCIA 3LFYA 2AS8A 2JRIA 2YJBA 5JZEA 3PHUA 1U5IA 5CHTA 3HWNA 5CVOB 1BQIA 3B21A 4P16A 1F29A 3KW9A 4BOSA 1EWLA 2B1NA 4K7CA 4G54A 4BSQA 1PPPA 4CDDB 3IUTA 1MDWA 1IWDA 4PADA 5J94A 1U9QX 2JQGR 2AUZA 3B79A 2E02A 3MP2A 2AGAA 2ACTA 3F75A 3MTNA 3O0UA 1AIMA 2NQIA 3H7DA 4CZWA 2CIOA 2PREA 3IMAA 4FK5A 1CSBB 3P5WA 4X6HA 3MTVA 4A5UA 2FYEA 2E01A 4N4ZA 3GCBA 3BPMA 3OVZA 3W31A 3KSEA 1MEGA 3AI8A 4XR7A 2AYNA 4RNAA 4HXDB 7PCKA 6PADA 1U9XA 4Q8HA 2P0RA 3HD3A 4M0WA 2R9NA 1CJLA 1HUCB 1MHWA 4GUAA 2R9CA 2JQFR 3K9MA 4MSXA 5E6JA 1KHQA 4YYWA 1NQCA 3PDFA 2FE8A 2AIMA 5A24A 4OVZB 4RF1A 3N3GA 1FH0A 5EZSA 1A6RA 5CVMA 3ZNHA 1VJVA 3IEJA 4QH6A 2PBHA 2YJ8A 3V6CA 3WXGA 3MHHA 2DC7A 3TMPA 1SP4B 3OF9A 4BOPA 3F5VA 4YYRA 4KLBA 1Y4HA 3PSEA 1NLJA 2NQAA 3KWZA 1NB5A 3PBHA 2DZYA 3N3KA 3P5UA 2ARYA 4WURA 2G6DA 3BB7A 1AU0A 1PPOA 1F2BA 2JTCA 4BOUA 4OEMA 1UKFA 4QRXA 3N4CA 1EWPA 2BDLA 1NL6A 3HHAA 3PNRA 4RKXA 5K16A 1YALA 3OF8A 4XUIA 3MORA 2FTDA 3D6SA 4X6JA 4BQVA 4ZTBA 3BWKA 3S3RA 4D8EA 4XZXA 2AYOA 3RVWA 1PPDA 3USVA 2BDZA 3OQCA 2Y6EA 4REZA 1SNKA 2F1GA 3U8EA 4I07A 1CQDA 3OISA 5CVNB 4P6EA 1XKGA 3TRKA 4I04A 4N79A 2GFOA 1PE6A 3QT4A 1DF0A 2P7UA 2F7DA 3NHEA 2G8JA 4RF0A 4MZSA 2DCBA 4BS5A 3H89A 3PT2A 1U9WA 1ATKA 1PXVA 1S4VA 4RY2A 4D8IA 3BOWA 3ZUAA 2YJ2A 3E9SA 1AU3A 4PT5A 4X6IA 2PNSA 1CB5A 2H7JA 1THEA 2G8EA 3IOQA 3O1GA 1EWMA 9PAPA 3K24A 2J7QA 3DF0A 3BPFA 5JH3A 1CTEA 4YV8A 2FQ9A 2OULA 1GCBA 1AU2A 2BTWA 3BBAA 2G7YA 2DJGB 5CHVA 1CVZA 1PIPA 8PCHA 3IHPA 4FJCA 2ATOA 3KX1A 2R9FA 2BU3A 3PHWA 5F02A 1TL9A 1QMYA 4MM3B 4QRVA 2VHFA 3MJ5A 1PVJA 1NB3A 2OP3A 2J7QC 3OVXA 4IUMA 2BTWB 1QOLA 4OVZA 1BP4A 5EF4A 3IV2A 4IP3A 3I3TA 2GHUA 3MHSA 1F2CA 3P5VA 4OELA 3QSDA 1X9YA 1CV8A 3IFUA 1QXPA 3QJ3A 1GLOA 2DCCA 1CS8A 2XU4A 4BPVA 1TLOA 1BY8A 1POPA 4AXMA 3CBJA 2DCDA 2DJFB 1YK7A 3CBKA 4W5CA 3BY4A 2OZ2A 1O0EA 4D8BA 2NQGA 3M99A 2NQDB 1KHPA 4R3DA 4PP1A 3PRMA
chains in the Genus database with same CATH topology
1DEUA 2R6NA 3ERVA 2R9MA 2AVWA 1KFUL 4YYVA 4N8WA 1BGOA 2DC6A 3I06A 1MIRA 3RVXA 1TU6A 3LXSA 2DCAA 2VHSA 3H8CA 1K3BB 1ZCMA 1ITOA 4PI3A 2FT2A 3KWBX 3K8UA 2FRQA 2XU1A 1AYWA 1MS6A 4Q8GA 2AU1A 3TNXA 4CDFB 4CDEB 1EF7A 2FUDA 1Q6KA 4YYQA 4ZUXU 2FRAA 3CH3X 1GECE 3PW3A 4WA6A 1JQPA 3H6SA 2HHNA 1YT7A 2DC8A 3HHIA 2E00A 2YJ9A 1NPZA 2AUXA 2YJCA 3V6EA 3WXFA 2HXZA 4YYSA 1KFXL 2C0YA 2R9OA 3S3QA 1F2AA 3C9EA 4FIPA 2E03A 3CH2X 2P86A 2XU5A 1CPJA 2CB5A 1U9VA 4QBBA 1PADA 1ICFA 2XU3A 4MZOA 4NV8A 3KKUA 2IBIA 4CDCB 2HD5A 2FO5A 1ME4A 4I05A 2Y5BA 5FPWA 1AYVA 1PPNA 2PADA 1QDQA 2DC9A 4YVAA 1W5RA 4P6GA 2IPPB 5JA7A 1PBHA 1STFE 3E1ZB 4W5BA 1AYUA 5PADA 4DMYA 3KFQA 1AECA 1GMYA 1AU4A 2O6XA 3BC3A 2DZZA 4AXLA 2WBFX 4PP2E 4W4UA 3WXEA 1YK8A 3P5XA 4QRGA 4BS6A 1MEMA 3H8BA 1EWOA 3BCNA 4DMXA 1VSNA 1KXRA 1YVBA 1ME3A 1Y08A 5EGWA 1ZIVA 2B1MA 4HWYA 3RVVA 2HH5A 4YYUA 1M6DA 1W4TA 1PCIA 3LFYA 2AS8A 2YJBA 1W6FA 1U5IA 5CHTA 3HWNA 5CVOB 1BQIA 1F29A 3KW9A 1EWLA 2B1NA 4K7CA 4G54A 4BSQA 1PPPA 4CDDB 3IUTA 1MDWA 1IWDA 4PADA 5J94A 1U9QX 2JQGR 2AUZA 3B79A 2E02A 2ACTA 3F75A 3MTNA 3O0UA 1AIMA 2NQIA 3H7DA 4CZWA 2VFBA 2CIOA 2PREA 2VFCA 3IMAA 4FK5A 1CSBB 3P5WA 4X6HA 2FYEA 2E01A 4N4ZA 3GCBA 3BPMA 3OVZA 3KSEA 1MEGA 3AI8A 4XR7A 2AYNA 7PCKA 6PADA 1U9XA 4Q8HA 2P0RA 3HD3A 2R9NA 1CJLA 1HUCB 1MHWA 2R9CA 2JQFR 3K9MA 4MSXA 1KHQA 4YYWA 1NQCA 3PDFA 2AIMA 5A24A 3N3GA 1FH0A 1A6RA 5CVMA 1VJVA 3IEJA 4QH6A 2PBHA 2BSZA 2YJ8A 3V6CA 3WXGA 3MHHA 2DC7A 1SP4B 3OF9A 3F5VA 4YYRA 4KLBA 1Y4HA 1NLJA 2NQAA 3KWZA 1NB5A 3D9WA 3PBHA 2DZYA 3N3KA 3P5UA 2ARYA 2G6DA 1AU0A 1PPOA 1F2BA 4OEMA 4QRXA 3N4CA 1EWPA 2BDLA 1NL6A 3HHAA 3PNRA 5K16A 1YALA 3OF8A 4XUIA 3MORA 2FTDA 3D6SA 4X6JA 4BQVA 3BWKA 3S3RA 3LTWA 2AYOA 3RVWA 1PPDA 3USVA 2BDZA 2Y6EA 1SNKA 4B55A 2F1GA 3U8EA 4I07A 1CQDA 3OISA 5CVNB 4P6EA 1XKGA 4I04A 4N79A 2GFOA 1PE6A 3QT4A 1DF0A 2P7UA 2F7DA 3NHEA 2G8JA 4MZSA 2DCBA 4BS5A 3H89A 1U9WA 1ATKA 1PXVA 1S4VA 4RY2A 3BOWA 3ZUAA 2YJ2A 1E2TA 1AU3A 4X6IA 2PNSA 1CB5A 2H7JA 1THEA 2G8EA 3IOQA 3O1GA 1EWMA 9PAPA 3K24A 3DF0A 3BPFA 5JH3A 1CTEA 4BGFA 4YV8A 2FQ9A 2OULA 1GCBA 1AU2A 2G7YA 2DJGB 5CHVA 1CVZA 1PIPA 8PCHA 4GUZA 3IHPA 4FJCA 4C5PA 2ATOA 3KX1A 2R9FA 5F02A 1TL9A 1QMYA 4QRVA 2VHFA 4NV7A 1NB3A 2OP3A 3OVXA 1QOLA 1BP4A 5EF4A 3IV2A 3I3TA 2GHUA 3MHSA 1F2CA 3P5VA 4OELA 3QSDA 1X9YA 1CV8A 1QXPA 3QJ3A 1GLOA 2DCCA 1CS8A 2XU4A 4BPVA 1TLOA 1GX3A 1BY8A 1POPA 4AXMA 3CBJA 2DCDA 2DJFB 1YK7A 3CBKA 4W5CA 2OZ2A 1O0EA 2NQGA 3M99A 2NQDB 1KHPA 4PP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEU A;  2R6N A;  3ERV A;  2R9M A;  2AVW A;  1KFU L;  4YYV A;  4N8W A;  1BGO A;  2DC6 A;  3I06 A;  1MIR A;  3RVX A;  1TU6 A;  3LXS A;  2DCA A;  2VHS A;  3H8C A;  1K3B B;  1ZCM A;  1ITO A;  4PI3 A;  2FT2 A;  3KWB X;  3K8U A;  2FRQ A;  2XU1 A;  1AYW A;  1MS6 A;  4Q8G A;  2AU1 A;  3TNX A;  4CDF B;  4CDE B;  1EF7 A;  2FUD A;  1Q6K A;  4YYQ A;  4ZUX U;  2FRA A;  3CH3 X;  1GEC E;  3PW3 A;  4WA6 A;  1JQP A;  3H6S A;  2HHN A;  1YT7 A;  2DC8 A;  3HHI A;  2E00 A;  2YJ9 A;  1NPZ A;  2AUX A;  2YJC A;  3V6E A;  3WXF A;  2HXZ A;  4YYS A;  3S3Q A;  1KFX L;  2C0Y A;  2R9O A;  1F2A A;  3C9E A;  4FIP A;  2E03 A;  3CH2 X;  2P86 A;  2XU5 A;  1CPJ A;  2CB5 A;  1U9V A;  4QBB A;  1PAD A;  1ICF A;  2XU3 A;  4MZO A;  3KKU A;  2IBI A;  4CDC B;  2HD5 A;  2FO5 A;  1ME4 A;  4I05 A;  2Y5B A;  5FPW A;  1AYV A;  1PPN A;  2PAD A;  1QDQ A;  2DC9 A;  4YVA A;  4P6G A;  2IPP B;  5JA7 A;  1PBH A;  1STF E;  3E1Z B;  4W5B A;  1AYU A;  5PAD A;  4DMY A;  3KFQ A;  1AEC A;  1GMY A;  1AU4 A;  2O6X A;  3BC3 A;  2DZZ A;  4AXL A;  2WBF X;  4PP2 E;  4W4U A;  3WXE A;  1YK8 A;  3P5X A;  4QRG A;  4BS6 A;  1MEM A;  3H8B A;  1EWO A;  3BCN A;  4DMX A;  1VSN A;  1KXR A;  1YVB A;  1ME3 A;  1Y08 A;  5EGW A;  1ZIV A;  2B1M A;  4HWY A;  3RVV A;  2HH5 A;  4YYU A;  1M6D A;  1PCI A;  3LFY A;  2AS8 A;  2YJB A;  1U5I A;  5CHT A;  3HWN A;  5CVO B;  1BQI A;  1F29 A;  3KW9 A;  1EWL A;  2B1N A;  4K7C A;  4G54 A;  4BSQ A;  1PPP A;  4CDD B;  3IUT A;  1MDW A;  1IWD A;  4PAD A;  5J94 A;  1U9Q X;  2JQG R;  2AUZ A;  3B79 A;  2E02 A;  2ACT A;  3F75 A;  3MTN A;  3O0U A;  1AIM A;  2NQI A;  3H7D A;  4CZW A;  2CIO A;  2PRE A;  3IMA A;  4FK5 A;  1CSB B;  3P5W A;  4X6H A;  2FYE A;  2E01 A;  4N4Z A;  3GCB A;  3BPM A;  3OVZ A;  3KSE A;  1MEG A;  3AI8 A;  4XR7 A;  2AYN A;  7PCK A;  6PAD A;  1U9X A;  4Q8H A;  2P0R A;  3HD3 A;  2R9N A;  1CJL A;  1HUC B;  1MHW A;  2R9C A;  2JQF R;  3K9M A;  4MSX A;  1KHQ A;  4YYW A;  1NQC A;  3PDF A;  2AIM A;  5A24 A;  3N3G A;  1FH0 A;  1A6R A;  5CVM A;  1VJV A;  3IEJ A;  4QH6 A;  2PBH A;  2YJ8 A;  3V6C A;  3WXG A;  3MHH A;  2DC7 A;  1SP4 B;  3OF9 A;  3F5V A;  4YYR A;  4KLB A;  1Y4H A;  1NLJ A;  2NQA A;  3KWZ A;  1NB5 A;  3PBH A;  2DZY A;  3N3K A;  3P5U A;  2ARY A;  2G6D A;  1AU0 A;  1PPO A;  1F2B A;  4OEM A;  4QRX A;  3N4C A;  1EWP A;  2BDL A;  1NL6 A;  3HHA A;  3PNR A;  5K16 A;  1YAL A;  3OF8 A;  4XUI A;  3MOR A;  2FTD A;  3D6S A;  4X6J A;  4BQV A;  3BWK A;  3S3R A;  2AYO A;  3RVW A;  1PPD A;  3USV A;  2BDZ A;  2Y6E A;  1SNK A;  3U8E A;  2F1G A;  4I07 A;  1CQD A;  3OIS A;  5CVN B;  4P6E A;  1XKG A;  4I04 A;  4N79 A;  2GFO A;  1PE6 A;  3QT4 A;  1DF0 A;  2P7U A;  2F7D A;  3NHE A;  2G8J A;  4MZS A;  2DCB A;  4BS5 A;  3H89 A;  1U9W A;  1ATK A;  1PXV A;  1S4V A;  4RY2 A;  3BOW A;  3ZUA A;  2YJ2 A;  1AU3 A;  4X6I A;  2PNS A;  1CB5 A;  2H7J A;  1THE A;  2G8E A;  3IOQ A;  3O1G A;  1EWM A;  9PAP A;  3K24 A;  3DF0 A;  3BPF A;  5JH3 A;  1CTE A;  4YV8 A;  2FQ9 A;  2OUL A;  1GCB A;  1AU2 A;  2G7Y A;  2DJG B;  5CHV A;  1CVZ A;  1PIP A;  8PCH A;  3IHP A;  4FJC A;  2ATO A;  3KX1 A;  2R9F A;  5F02 A;  1TL9 A;  1QMY A;  4QRV A;  2VHF A;  1NB3 A;  2OP3 A;  3OVX A;  1QOL A;  1BP4 A;  5EF4 A;  3IV2 A;  3I3T A;  2GHU A;  3MHS A;  1F2C A;  3P5V A;  4OEL A;  3QSD A;  1X9Y A;  1CV8 A;  1QXP A;  3QJ3 A;  1GLO A;  2DCC A;  1CS8 A;  2XU4 A;  4BPV A;  1TLO A;  1BY8 A;  1POP A;  4AXM A;  3CBJ A;  2DCD A;  2DJF B;  1YK7 A;  3CBK A;  4W5C A;  2OZ2 A;  1O0E A;  2NQG A;  3M99 A;  2NQD B;  1KHP A;  4PP1 A; 
#chains in the Genus database with same CATH topology
 1DEU A;  2R6N A;  3ERV A;  2R9M A;  2AVW A;  1KFU L;  4YYV A;  4N8W A;  1BGO A;  2DC6 A;  3I06 A;  3RNV A;  1MIR A;  3RVX A;  1TU6 A;  3LXS A;  2DCA A;  2VHS A;  3H8C A;  1K3B B;  3PRP A;  1ZCM A;  1ITO A;  4PI3 A;  2FT2 A;  4OW0 A;  3KWB X;  3K8U A;  2FRQ A;  2XU1 A;  1AYW A;  1MS6 A;  3PHX A;  4Q8G A;  2AU1 A;  3TNX A;  4CDF B;  4CDE B;  1EF7 A;  2FUD A;  1Q6K A;  4YYQ A;  4ZUX U;  3W30 A;  2FRA A;  3CH3 X;  1GEC E;  3PW3 A;  2DOS A;  4WA6 A;  1JQP A;  3H6S A;  2HHN A;  1YT7 A;  5KO3 A;  2DC8 A;  3HHI A;  2E00 A;  2YJ9 A;  1NPZ A;  2AUX A;  2YJC A;  3V6E A;  3WXF A;  2HXZ A;  4YYS A;  1KFX L;  2C0Y A;  2R9O A;  3S3Q A;  1F2A A;  3C9E A;  4FIP A;  2E03 A;  3CH2 X;  2P86 A;  2Z84 A;  1YZB A;  2XU5 A;  1CPJ A;  2CB5 A;  1U9V A;  4QBB A;  1PAD A;  1ICF A;  2XU3 A;  4MZO A;  3KKU A;  2IBI A;  4CDC B;  5EZQ A;  2HD5 A;  2FO5 A;  1ME4 A;  4I05 A;  2Y5B A;  5FPW A;  1AYV A;  1PPN A;  2PAD A;  2UZJ A;  1QDQ A;  2DC9 A;  4YVA A;  4P6G A;  2IPP B;  5JA7 A;  1PBH A;  1STF E;  3E1Z B;  4W5B A;  1AYU A;  5PAD A;  4DMY A;  3KFQ A;  1AEC A;  1DKI A;  1GMY A;  1AU4 A;  2O6X A;  3BC3 A;  2DZZ A;  4AXL A;  2WBF X;  4PP2 E;  4W4U A;  3WXE A;  4BOZ A;  1YK8 A;  3P5X A;  4QRG A;  2HWK A;  4BS6 A;  1MEM A;  3H8B A;  1EWO A;  3BCN A;  4DMX A;  1VSN A;  3O65 A;  4BOQ A;  1KXR A;  1YVB A;  1ME3 A;  1Y08 A;  5EGW A;  1ZIV A;  2B1M A;  4HWY A;  3C0R A;  3RVV A;  2HH5 A;  4YYU A;  4MI7 A;  1M6D A;  1PCI A;  3LFY A;  2AS8 A;  2JRI A;  2YJB A;  5JZE A;  3PHU A;  1U5I A;  5CHT A;  3HWN A;  5CVO B;  1BQI A;  3B21 A;  4P16 A;  1F29 A;  3KW9 A;  4BOS A;  1EWL A;  2B1N A;  4K7C A;  4G54 A;  4BSQ A;  1PPP A;  4CDD B;  3IUT A;  1MDW A;  1IWD A;  4PAD A;  5J94 A;  1U9Q X;  2JQG R;  2AUZ A;  3B79 A;  2E02 A;  3MP2 A;  2AGA A;  2ACT A;  3F75 A;  3MTN A;  3O0U A;  1AIM A;  2NQI A;  3H7D A;  4CZW A;  2CIO A;  2PRE A;  3IMA A;  4FK5 A;  1CSB B;  3P5W A;  4X6H A;  3MTV A;  4A5U A;  2FYE A;  2E01 A;  4N4Z A;  3GCB A;  3BPM A;  3OVZ A;  3W31 A;  3KSE A;  1MEG A;  3AI8 A;  4XR7 A;  2AYN A;  4RNA A;  4HXD B;  7PCK A;  6PAD A;  1U9X A;  4Q8H A;  2P0R A;  3HD3 A;  4M0W A;  2R9N A;  1CJL A;  1HUC B;  1MHW A;  4GUA A;  2R9C A;  2JQF R;  3K9M A;  4MSX A;  5E6J A;  1KHQ A;  4YYW A;  1NQC A;  3PDF A;  2FE8 A;  2AIM A;  5A24 A;  4OVZ B;  4RF1 A;  3N3G A;  1FH0 A;  5EZS A;  1A6R A;  5CVM A;  3ZNH A;  1VJV A;  3IEJ A;  4QH6 A;  2PBH A;  2YJ8 A;  3V6C A;  3WXG A;  3MHH A;  2DC7 A;  3TMP A;  1SP4 B;  3OF9 A;  4BOP A;  3F5V A;  4YYR A;  4KLB A;  1Y4H A;  3PSE A;  1NLJ A;  2NQA A;  3KWZ A;  1NB5 A;  3PBH A;  2DZY A;  3N3K A;  3P5U A;  2ARY A;  4WUR A;  2G6D A;  3BB7 A;  1AU0 A;  1PPO A;  1F2B A;  2JTC A;  4BOU A;  4OEM A;  1UKF A;  4QRX A;  3N4C A;  1EWP A;  2BDL A;  1NL6 A;  3HHA A;  3PNR A;  4RKX A;  5K16 A;  1YAL A;  3OF8 A;  4XUI A;  3MOR A;  2FTD A;  3D6S A;  4X6J A;  4BQV A;  4ZTB A;  3BWK A;  3S3R A;  4D8E A;  4XZX A;  2AYO A;  3RVW A;  1PPD A;  3USV A;  2BDZ A;  3OQC A;  2Y6E A;  4REZ A;  1SNK A;  2F1G A;  3U8E A;  4I07 A;  1CQD A;  3OIS A;  5CVN B;  4P6E A;  1XKG A;  3TRK A;  4I04 A;  4N79 A;  2GFO A;  1PE6 A;  3QT4 A;  1DF0 A;  2P7U A;  2F7D A;  3NHE A;  2G8J A;  4RF0 A;  4MZS A;  2DCB A;  4BS5 A;  3H89 A;  3PT2 A;  1U9W A;  1ATK A;  1PXV A;  1S4V A;  4RY2 A;  4D8I A;  3BOW A;  3ZUA A;  2YJ2 A;  3E9S A;  1AU3 A;  4PT5 A;  4X6I A;  2PNS A;  1CB5 A;  2H7J A;  1THE A;  2G8E A;  3IOQ A;  3O1G A;  1EWM A;  9PAP A;  3K24 A;  2J7Q A;  3DF0 A;  3BPF A;  5JH3 A;  1CTE A;  4YV8 A;  2FQ9 A;  2OUL A;  1GCB A;  1AU2 A;  2BTW A;  3BBA A;  2G7Y A;  2DJG B;  5CHV A;  1CVZ A;  1PIP A;  8PCH A;  3IHP A;  4FJC A;  2ATO A;  3KX1 A;  2R9F A;  2BU3 A;  3PHW A;  5F02 A;  1TL9 A;  1QMY A;  4MM3 B;  4QRV A;  2VHF A;  3MJ5 A;  1PVJ A;  1NB3 A;  2OP3 A;  2J7Q C;  3OVX A;  4IUM A;  2BTW B;  1QOL A;  4OVZ A;  1BP4 A;  5EF4 A;  3IV2 A;  4IP3 A;  3I3T A;  2GHU A;  3MHS A;  1F2C A;  3P5V A;  4OEL A;  3QSD A;  1X9Y A;  1CV8 A;  3IFU A;  1QXP A;  3QJ3 A;  1GLO A;  2DCC A;  1CS8 A;  2XU4 A;  4BPV A;  1TLO A;  1BY8 A;  1POP A;  4AXM A;  3CBJ A;  2DCD A;  2DJF B;  1YK7 A;  3CBK A;  4W5C A;  3BY4 A;  2OZ2 A;  1O0E A;  4D8B A;  2NQG A;  3M99 A;  2NQD B;  1KHP A;  4R3D A;  4PP1 A;  3PRM A; 
#chains in the Genus database with same CATH homology
 1DEU A;  2R6N A;  3ERV A;  2R9M A;  2AVW A;  1KFU L;  4YYV A;  4N8W A;  1BGO A;  2DC6 A;  3I06 A;  1MIR A;  3RVX A;  1TU6 A;  3LXS A;  2DCA A;  2VHS A;  3H8C A;  1K3B B;  1ZCM A;  1ITO A;  4PI3 A;  2FT2 A;  3KWB X;  3K8U A;  2FRQ A;  2XU1 A;  1AYW A;  1MS6 A;  4Q8G A;  2AU1 A;  3TNX A;  4CDF B;  4CDE B;  1EF7 A;  2FUD A;  1Q6K A;  4YYQ A;  4ZUX U;  2FRA A;  3CH3 X;  1GEC E;  3PW3 A;  4WA6 A;  1JQP A;  3H6S A;  2HHN A;  1YT7 A;  2DC8 A;  3HHI A;  2E00 A;  2YJ9 A;  1NPZ A;  2AUX A;  2YJC A;  3V6E A;  3WXF A;  2HXZ A;  4YYS A;  1KFX L;  2C0Y A;  2R9O A;  3S3Q A;  1F2A A;  3C9E A;  4FIP A;  2E03 A;  3CH2 X;  2P86 A;  2XU5 A;  1CPJ A;  2CB5 A;  1U9V A;  4QBB A;  1PAD A;  1ICF A;  2XU3 A;  4MZO A;  4NV8 A;  3KKU A;  2IBI A;  4CDC B;  2HD5 A;  2FO5 A;  1ME4 A;  4I05 A;  2Y5B A;  5FPW A;  1AYV A;  1PPN A;  2PAD A;  1QDQ A;  2DC9 A;  4YVA A;  1W5R A;  4P6G A;  2IPP B;  5JA7 A;  1PBH A;  1STF E;  3E1Z B;  4W5B A;  1AYU A;  5PAD A;  4DMY A;  3KFQ A;  1AEC A;  1GMY A;  1AU4 A;  2O6X A;  3BC3 A;  2DZZ A;  4AXL A;  2WBF X;  4PP2 E;  4W4U A;  3WXE A;  1YK8 A;  3P5X A;  4QRG A;  4BS6 A;  1MEM A;  3H8B A;  1EWO A;  3BCN A;  4DMX A;  1VSN A;  1KXR A;  1YVB A;  1ME3 A;  1Y08 A;  5EGW A;  1ZIV A;  2B1M A;  4HWY A;  3RVV A;  2HH5 A;  4YYU A;  1M6D A;  1W4T A;  1PCI A;  3LFY A;  2AS8 A;  2YJB A;  1W6F A;  1U5I A;  5CHT A;  3HWN A;  5CVO B;  1BQI A;  1F29 A;  3KW9 A;  1EWL A;  2B1N A;  4K7C A;  4G54 A;  4BSQ A;  1PPP A;  4CDD B;  3IUT A;  1MDW A;  1IWD A;  4PAD A;  5J94 A;  1U9Q X;  2JQG R;  2AUZ A;  3B79 A;  2E02 A;  2ACT A;  3F75 A;  3MTN A;  3O0U A;  1AIM A;  2NQI A;  3H7D A;  4CZW A;  2VFB A;  2CIO A;  2PRE A;  2VFC A;  3IMA A;  4FK5 A;  1CSB B;  3P5W A;  4X6H A;  2FYE A;  2E01 A;  4N4Z A;  3GCB A;  3BPM A;  3OVZ A;  3KSE A;  1MEG A;  3AI8 A;  4XR7 A;  2AYN A;  7PCK A;  6PAD A;  1U9X A;  4Q8H A;  2P0R A;  3HD3 A;  2R9N A;  1CJL A;  1HUC B;  1MHW A;  2R9C A;  2JQF R;  3K9M A;  4MSX A;  1KHQ A;  4YYW A;  1NQC A;  3PDF A;  2AIM A;  5A24 A;  3N3G A;  1FH0 A;  1A6R A;  5CVM A;  1VJV A;  3IEJ A;  4QH6 A;  2PBH A;  2BSZ A;  2YJ8 A;  3V6C A;  3WXG A;  3MHH A;  2DC7 A;  1SP4 B;  3OF9 A;  3F5V A;  4YYR A;  4KLB A;  1Y4H A;  1NLJ A;  2NQA A;  3KWZ A;  1NB5 A;  3D9W A;  3PBH A;  2DZY A;  3N3K A;  3P5U A;  2ARY A;  2G6D A;  1AU0 A;  1PPO A;  1F2B A;  4OEM A;  4QRX A;  3N4C A;  1EWP A;  2BDL A;  1NL6 A;  3HHA A;  3PNR A;  5K16 A;  1YAL A;  3OF8 A;  4XUI A;  3MOR A;  2FTD A;  3D6S A;  4X6J A;  4BQV A;  3BWK A;  3S3R A;  3LTW A;  2AYO A;  3RVW A;  1PPD A;  3USV A;  2BDZ A;  2Y6E A;  1SNK A;  4B55 A;  2F1G A;  3U8E A;  4I07 A;  1CQD A;  3OIS A;  5CVN B;  4P6E A;  1XKG A;  4I04 A;  4N79 A;  2GFO A;  1PE6 A;  3QT4 A;  1DF0 A;  2P7U A;  2F7D A;  3NHE A;  2G8J A;  4MZS A;  2DCB A;  4BS5 A;  3H89 A;  1U9W A;  1ATK A;  1PXV A;  1S4V A;  4RY2 A;  3BOW A;  3ZUA A;  2YJ2 A;  1E2T A;  1AU3 A;  4X6I A;  2PNS A;  1CB5 A;  2H7J A;  1THE A;  2G8E A;  3IOQ A;  3O1G A;  1EWM A;  9PAP A;  3K24 A;  3DF0 A;  3BPF A;  5JH3 A;  1CTE A;  4BGF A;  4YV8 A;  2FQ9 A;  2OUL A;  1GCB A;  1AU2 A;  2G7Y A;  2DJG B;  5CHV A;  1CVZ A;  1PIP A;  8PCH A;  4GUZ A;  3IHP A;  4FJC A;  4C5P A;  2ATO A;  3KX1 A;  2R9F A;  5F02 A;  1TL9 A;  1QMY A;  4QRV A;  2VHF A;  4NV7 A;  1NB3 A;  2OP3 A;  3OVX A;  1QOL A;  1BP4 A;  5EF4 A;  3IV2 A;  3I3T A;  2GHU A;  3MHS A;  1F2C A;  3P5V A;  4OEL A;  3QSD A;  1X9Y A;  1CV8 A;  1QXP A;  3QJ3 A;  1GLO A;  2DCC A;  1CS8 A;  2XU4 A;  4BPV A;  1TLO A;  1GX3 A;  1BY8 A;  1POP A;  4AXM A;  3CBJ A;  2DCD A;  2DJF B;  1YK7 A;  3CBK A;  4W5C A;  2OZ2 A;  1O0E A;  2NQG A;  3M99 A;  2NQD B;  1KHP A;  4PP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...