4MZSA

Mouse cathepsin s with covalent ligand (3s,4s)-1-[(2-chlorophenyl)sulfonyl]-n-[(2e)-2-iminoethyl]-4-(morpholin-4-ylcarbonyl)pyrrolidine-3-carboxamide
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
218
Chain Sequence
LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
publication title Identification of potent and selective cathepsin S inhibitors containing different central cyclic scaffolds.
pubmed doi rcsb
source organism Mus musculus
total genus 66
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4mzsA00
1SNKA 4X6IA 2AYNA 2F1GA 3DF0A 2AYOA 1GMYA 4YYSA 2FRQA 2FQ9A 1HUCB 2AUXA 2ARYA 2XU1A 1CSBB 2NQIA 4YYUA 3MORA 4MSXA 1MDWA 3OISA 4W5CA 2OULA 2H7JA 3ZUAA 1YK7A 1Y08A 3RVVA 5JH3A 2P0RA 2YJ8A 2OZ2A 2R9OA 2YJCA 4K7CA 3D6SA 2HXZA 1PADA 2HHNA 1AECA 3PDFA 3KKUA 4PADA 4PP1A 4CDCB 2O6XA 9PAPA 1NLJA 4X6HA 4P6EA 3NHEA 1GECE 2GFOA 1EWLA 3TNXA 2E01A 3BOWA 4I07A 4CDEB 3BPMA 1IWDA 4FJCA 4BPVA 1ZIVA 1PPOA 3S3QA 2JQFR 2DCCA 2CB5A 3OVZA 2XU4A 4AXLA 1EF7A 1GLOA 1MS6A 1FH0A 3LFYA 3H6SA 4OEMA 3CBKA 1AIMA 3BWKA 3LXSA 3PW3A 2R9CA 1AU3A 3BC3A 3QJ3A 1X9YA 4Q8HA 1CTEA 1PIPA 1BGOA 2BDLA 3BCNA 4N8WA 3MHHA 2XU3A 3HHIA 3N3GA 3P5VA 4XUIA 1NPZA 3OF9A 3B79A 2R9NA 2G8JA 4BS5A 5EGWA 1MIRA 3V6EA 1F2CA 4I04A 1MEMA 1S4VA 4RY2A 1DEUA 5CVOB 1ME3A 3N4CA 3IHPA 4CDDB 2AIMA 3H7DA 7PCKA 2DC6A 3CH2X 1QXPA 2E03A 5CVNB 2NQDB 1AU0A 3KWBX 4BSQA 2P7UA 3O1GA 4FK5A 3WXGA 1ZCMA 1VSNA 3GCBA 3RVXA 1PPDA 1DF0A 2NQAA 3C9EA 4N79A 3OF8A 3PNRA 4YYRA 3KSEA 3HWNA 1AYUA 1TL9A 2AVWA 2ATOA 1YT7A 1BQIA 2BDZA 1CPJA 1CQDA 1AU4A 4Q8GA 2AU1A 2DZZA 1CS8A 2AUZA 4W5BA 1STFE 4YYQA 1U9WA 3F5VA 4QBBA 4ZUXU 2YJBA 2DZYA 5F02A 3KX1A 4YVAA 2YJ9A 1VJVA 3BPFA 1AYVA 3U8EA 2IPPB 2R9MA 3QT4A 1YALA 4OELA 1NB3A 4N4ZA 3CBJA 5A24A 1PPNA 1QOLA 3P5UA 3H8CA 1CVZA 1F29A 2F7DA 4PI3A 1EWPA 2OP3A 3IUTA 4X6JA 5PADA 1U9XA 4WA6A 1K3BB 1XKGA 3QSDA 3E1ZB 1O0EA 1Y4HA 3HHAA 5FPWA 1KHPA 1PE6A 2FYEA 2GHUA 1U5IA 2Y5BA 4G54A 2DCDA 1BY8A 5CHTA 2G7YA 2PREA 2YJ2A 3K9MA 1PPPA 4YYWA 2Y6EA 2DJGB 4FIPA 1KFUL 3O0UA 4XR7A 2PBHA 2ACTA 2R9FA 2P86A 3PBHA 3V6CA 2IBIA 3KWZA 5J94A 4YV8A 5EF4A 1M6DA 3AI8A 2FT2A 2NQGA 4QH6A 3KFQA 4PP2E 2DCBA 4QRGA 4CDFB 3KW9A 1KFXL 2VHSA 4I05A 3S3RA 2DC7A 8PCHA 1NL6A 1ATKA 2FRAA 2PADA 1YK8A 2AS8A 1KHQA 2XU5A 1ME4A 1QMYA 4MZSA 3ERVA 1SP4B 5CVMA 4KLBA 1U9QX 1POPA 3RVWA 3IMAA 4W4UA 3CH3X 2DJFB 4CZWA 1CB5A 1QDQA 4P6GA 4BS6A 1EWMA 4HWYA 1U9VA 3OVXA 2DC9A 1Q6KA 3IV2A 3WXFA 4YYVA 1ITOA 5CHVA 4MZOA 3F75A 3M99A 1KXRA 1YVBA 4QRVA 2R6NA 1F2BA 3N3KA 1MEGA 3I3TA 3K24A 2WBFX 1ICFA 1TLOA 1AU2A 1PXVA 2HH5A 1NQCA 6PADA 2B1MA 2DCAA 2FUDA 1NB5A 2VHFA 2G8EA 1GCBA 1JQPA 3USVA 2PNSA 2E02A 1BP4A 3WXEA 5JA7A 2JQGR 1AYWA 3K8UA 4DMXA 3H8BA 2CIOA 1PBHA 2C0YA 2FTDA 4DMYA 2DC8A 2HD5A 2FO5A 1PCIA 3P5WA 1F2AA 2E00A 3HD3A 1CJLA 3MHSA 3P5XA 5K16A 2G6DA 1CV8A 1TU6A 3IOQA 1EWOA 1A6RA 1MHWA 3IEJA 3I06A 4QRXA 3MTNA 2B1NA 3H89A 1THEA 4BQVA 4AXMA
chains in the Genus database with same CATH superfamily
1SNKA 3OQCA 4X6IA 2AYNA 2F1GA 3DF0A 2AYOA 3MP2A 1GMYA 4YYSA 2FRQA 2FQ9A 1HUCB 2AUXA 2ARYA 2XU1A 1CSBB 2NQIA 4YYUA 3MORA 4MSXA 1MDWA 3OISA 4W5CA 2OULA 2H7JA 3ZUAA 1YK7A 1YZBA 1Y08A 3RVVA 5JH3A 2P0RA 2YJ8A 2OZ2A 4M0WA 2R9OA 2YJCA 4K7CA 3D6SA 2HXZA 1PADA 2HHNA 4RF1A 1AECA 3PDFA 3KKUA 4PADA 4PP1A 4CDCB 2O6XA 9PAPA 3RNVA 1PVJA 1NLJA 4X6HA 4P6EA 3NHEA 1GECE 2GFOA 1EWLA 3TNXA 2E01A 3BOWA 4I07A 5E6JA 4BOZA 4CDEB 3BPMA 3TRKA 1IWDA 4FJCA 4BPVA 1ZIVA 1PPOA 3S3QA 2JQFR 2DCCA 2CB5A 3OVZA 2XU4A 4AXLA 1EF7A 1GLOA 1MS6A 4REZA 1FH0A 3LFYA 4OW0A 3H6SA 4OEMA 3CBKA 1AIMA 3BWKA 3LXSA 3PW3A 2R9CA 1AU3A 3BC3A 3QJ3A 1X9YA 4Q8HA 1CTEA 1PIPA 1BGOA 3PHXA 2BDLA 3BCNA 4N8WA 3MHHA 3TMPA 2XU3A 3HHIA 4BOUA 3N3GA 3P5VA 4XUIA 4OVZB 1NPZA 3OF9A 3B79A 2R9NA 2G8JA 4BS5A 2UZJA 5EGWA 3PRMA 1MIRA 4IUMA 3V6EA 1F2CA 4I04A 1MEMA 5EZQA 1S4VA 4RY2A 1DEUA 2Z84A 5CVOB 1ME3A 3N4CA 3IHPA 4P16A 2AIMA 3H7DA 4CDDB 7PCKA 2DC6A 3CH2X 1QXPA 2E03A 5CVNB 2NQDB 1AU0A 3KWBX 4BSQA 2P7UA 3O1GA 4FK5A 4HXDB 4MM3B 3WXGA 1ZCMA 1VSNA 3GCBA 3RVXA 1PPDA 1DF0A 2NQAA 3C9EA 3C0RA 4N79A 3OF8A 3PNRA 4YYRA 3KSEA 3HWNA 1AYUA 1TL9A 2AVWA 3W30A 2ATOA 3IFUA 4GUAA 1YT7A 1BQIA 2BDZA 1CPJA 1CQDA 1AU4A 4Q8GA 2AU1A 2DZZA 1CS8A 2AUZA 4W5BA 1STFE 4YYQA 1UKFA 1U9WA 3F5VA 4QBBA 4ZUXU 3MJ5A 2YJBA 2DZYA 5F02A 3KX1A 4YVAA 2YJ9A 4WURA 1VJVA 3BPFA 1AYVA 3U8EA 2IPPB 2R9MA 3QT4A 1YALA 4OELA 1NB3A 4N4ZA 3CBJA 2BTWA 4XZXA 5A24A 3O65A 1PPNA 1QOLA 4RF0A 3P5UA 3H8CA 1CVZA 1F29A 2F7DA 4PI3A 4BOPA 1EWPA 2OP3A 3PHUA 3PRPA 3IUTA 4X6JA 5PADA 1U9XA 4WA6A 1K3BB 1XKGA 3QSDA 3E1ZB 1O0EA 1Y4HA 1DKIA 3MTVA 4IP3A 2JTCA 3HHAA 5KO3A 5FPWA 3E9SA 1KHPA 2HWKA 1PE6A 2JRIA 2FYEA 2GHUA 1U5IA 2Y5BA 4G54A 2DCDA 1BY8A 3PHWA 5CHTA 3BBAA 2G7YA 2PREA 2YJ2A 3K9MA 3PSEA 1PPPA 4YYWA 2Y6EA 2DJGB 4FIPA 1KFUL 2DOSA 3O0UA 4XR7A 2PBHA 2ACTA 2R9FA 2P86A 3PBHA 3V6CA 2IBIA 3KWZA 5J94A 4YV8A 5EF4A 1M6DA 3AI8A 2FT2A 4PT5A 4BOQA 2NQGA 4QH6A 5EZSA 3KFQA 4PP2E 2DCBA 4QRGA 4CDFB 3KW9A 2FE8A 4BOSA 1KFXL 2VHSA 4I05A 3S3RA 2J7QC 4RKXA 2DC7A 8PCHA 1NL6A 1ATKA 2FRAA 2PADA 1YK8A 2AS8A 1KHQA 2XU5A 1ME4A 1QMYA 5JZEA 3ERVA 4MZSA 3B21A 1SP4B 5CVMA 4KLBA 1U9QX 1POPA 3RVWA 3IMAA 4W4UA 3CH3X 2BU3A 2DJFB 4CZWA 1CB5A 1QDQA 4P6GA 4BS6A 1EWMA 4HWYA 1U9VA 3OVXA 2DC9A 1Q6KA 3BY4A 3IV2A 3WXFA 4YYVA 1ITOA 3W31A 5CHVA 4MZOA 3F75A 3M99A 1KXRA 1YVBA 4QRVA 2R6NA 1F2BA 3N3KA 1MEGA 3I3TA 3K24A 2AGAA 2WBFX 1ICFA 1TLOA 2BTWB 1AU2A 1PXVA 2HH5A 1NQCA 6PADA 2B1MA 2DCAA 2FUDA 1NB5A 2VHFA 2G8EA 1GCBA 1JQPA 3USVA 2PNSA 2E02A 1BP4A 3WXEA 4RNAA 5JA7A 2JQGR 1AYWA 4OVZA 3K8UA 4MI7A 4D8IA 4DMXA 3H8BA 2CIOA 1PBHA 2C0YA 2FTDA 4DMYA 2DC8A 2HD5A 2FO5A 1PCIA 3P5WA 1F2AA 2E00A 3HD3A 4D8EA 1CJLA 3MHSA 3P5XA 5K16A 3PT2A 2G6DA 4R3DA 3BB7A 1CV8A 1TU6A 3IOQA 1EWOA 1A6RA 4D8BA 2J7QA 1MHWA 3IEJA 3I06A 4QRXA 3MTNA 2B1NA 3H89A 1THEA 4BQVA 4AXMA 4ZTBA 3ZNHA 4A5UA
chains in the Genus database with same CATH topology
1SNKA 4X6IA 2AYNA 2F1GA 3DF0A 2AYOA 1GMYA 4YYSA 2FRQA 2FQ9A 1HUCB 2AUXA 2ARYA 2XU1A 1CSBB 2NQIA 4YYUA 3MORA 4MSXA 1MDWA 3OISA 4W5CA 2OULA 2H7JA 3ZUAA 1YK7A 1Y08A 3RVVA 5JH3A 2P0RA 2YJ8A 2OZ2A 2R9OA 2YJCA 4K7CA 3D6SA 2HXZA 1PADA 2HHNA 1AECA 1E2TA 3KKUA 3PDFA 4PADA 4PP1A 4CDCB 2O6XA 9PAPA 1NLJA 4X6HA 4P6EA 3NHEA 1GECE 2GFOA 1EWLA 3TNXA 2E01A 3BOWA 4I07A 2BSZA 4CDEB 3BPMA 1IWDA 4FJCA 4BPVA 1ZIVA 1PPOA 3S3QA 2JQFR 2DCCA 2CB5A 3OVZA 2XU4A 4AXLA 1EF7A 1GLOA 1MS6A 1FH0A 3LFYA 3H6SA 4OEMA 3CBKA 1AIMA 3BWKA 3LXSA 3PW3A 2R9CA 1AU3A 3BC3A 3QJ3A 1X9YA 4Q8HA 1CTEA 1PIPA 1BGOA 2BDLA 3BCNA 4N8WA 3D9WA 3MHHA 2XU3A 3HHIA 3N3GA 3P5VA 1W6FA 4XUIA 1NPZA 4B55A 3OF9A 3B79A 2R9NA 2G8JA 4BS5A 5EGWA 1MIRA 4NV7A 3V6EA 1F2CA 4I04A 1MEMA 4BGFA 1S4VA 4RY2A 1DEUA 5CVOB 1ME3A 3N4CA 3IHPA 4CDDB 2AIMA 3H7DA 1W5RA 7PCKA 2DC6A 3CH2X 1QXPA 2E03A 5CVNB 2NQDB 1AU0A 3KWBX 4BSQA 2P7UA 3O1GA 4FK5A 3WXGA 1ZCMA 1VSNA 3GCBA 3RVXA 1PPDA 1DF0A 2NQAA 3C9EA 4N79A 3OF8A 3PNRA 4YYRA 3KSEA 3HWNA 1AYUA 1TL9A 2AVWA 2ATOA 1YT7A 1W4TA 1BQIA 2BDZA 1CPJA 1CQDA 1AU4A 4Q8GA 2AU1A 2DZZA 1CS8A 2AUZA 4W5BA 1STFE 4YYQA 1U9WA 3F5VA 4QBBA 4ZUXU 2YJBA 2DZYA 5F02A 3KX1A 4YVAA 2YJ9A 1VJVA 3BPFA 1AYVA 3U8EA 2IPPB 2R9MA 3QT4A 1YALA 4OELA 1NB3A 4N4ZA 3CBJA 5A24A 1PPNA 1QOLA 3P5UA 3H8CA 1CVZA 1F29A 2F7DA 4PI3A 1EWPA 2OP3A 3IUTA 4X6JA 5PADA 1U9XA 4WA6A 1K3BB 1XKGA 3QSDA 3E1ZB 1O0EA 1Y4HA 3HHAA 5FPWA 1KHPA 1PE6A 2FYEA 2GHUA 1U5IA 2Y5BA 4G54A 2DCDA 2VFCA 1BY8A 5CHTA 2G7YA 2PREA 2YJ2A 3K9MA 1PPPA 4YYWA 2Y6EA 2DJGB 4FIPA 1KFUL 3O0UA 4XR7A 2PBHA 2ACTA 2R9FA 2P86A 3PBHA 3V6CA 2IBIA 3KWZA 5J94A 4YV8A 5EF4A 1M6DA 3AI8A 2FT2A 4C5PA 2NQGA 4QH6A 3KFQA 4PP2E 2DCBA 4QRGA 4CDFB 3KW9A 1KFXL 2VHSA 4I05A 3S3RA 2DC7A 8PCHA 1NL6A 1ATKA 2FRAA 2PADA 1YK8A 2AS8A 1KHQA 2XU5A 1ME4A 1QMYA 4MZSA 3ERVA 1GX3A 3LTWA 1SP4B 5CVMA 4KLBA 4NV8A 1U9QX 1POPA 3RVWA 3IMAA 4W4UA 3CH3X 2DJFB 4CZWA 1CB5A 1QDQA 4P6GA 4BS6A 1EWMA 4HWYA 1U9VA 3OVXA 2DC9A 1Q6KA 3IV2A 3WXFA 4YYVA 1ITOA 5CHVA 4MZOA 3F75A 3M99A 1KXRA 1YVBA 4QRVA 2R6NA 1F2BA 3N3KA 1MEGA 3I3TA 3K24A 2WBFX 1ICFA 1TLOA 1AU2A 1PXVA 2HH5A 1NQCA 6PADA 2B1MA 2DCAA 2FUDA 1NB5A 2VHFA 2G8EA 1GCBA 1JQPA 3USVA 2PNSA 4GUZA 2E02A 1BP4A 2VFBA 3WXEA 5JA7A 2JQGR 1AYWA 3K8UA 4DMXA 3H8BA 2CIOA 1PBHA 2C0YA 2FTDA 4DMYA 2DC8A 2HD5A 2FO5A 1PCIA 3P5WA 1F2AA 2E00A 3HD3A 1CJLA 3MHSA 3P5XA 5K16A 2G6DA 1CV8A 1TU6A 3IOQA 1EWOA 1A6RA 1MHWA 3IEJA 3I06A 4QRXA 3MTNA 2B1NA 3H89A 1THEA 4BQVA 4AXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNK A;  4X6I A;  2AYN A;  2F1G A;  3DF0 A;  2AYO A;  1GMY A;  4YYS A;  2FRQ A;  2FQ9 A;  1HUC B;  2AUX A;  2ARY A;  2XU1 A;  1CSB B;  2NQI A;  4YYU A;  3MOR A;  4MSX A;  1MDW A;  3OIS A;  4W5C A;  2OUL A;  2H7J A;  3ZUA A;  1YK7 A;  1Y08 A;  3RVV A;  5JH3 A;  2P0R A;  2YJ8 A;  2OZ2 A;  2R9O A;  2YJC A;  4K7C A;  3D6S A;  2HXZ A;  1PAD A;  2HHN A;  1AEC A;  3PDF A;  3KKU A;  4PAD A;  4PP1 A;  4CDC B;  2O6X A;  9PAP A;  1NLJ A;  4X6H A;  4P6E A;  3NHE A;  1GEC E;  2GFO A;  1EWL A;  3TNX A;  2E01 A;  3BOW A;  4I07 A;  4CDE B;  3BPM A;  1IWD A;  4FJC A;  4BPV A;  1ZIV A;  1PPO A;  3S3Q A;  2JQF R;  2DCC A;  2CB5 A;  3OVZ A;  2XU4 A;  4AXL A;  1EF7 A;  1GLO A;  1MS6 A;  1FH0 A;  3LFY A;  3H6S A;  4OEM A;  3CBK A;  1AIM A;  3BWK A;  3LXS A;  3PW3 A;  2R9C A;  1AU3 A;  3BC3 A;  3QJ3 A;  1X9Y A;  4Q8H A;  1CTE A;  1PIP A;  1BGO A;  2BDL A;  3BCN A;  4N8W A;  3MHH A;  2XU3 A;  3HHI A;  3N3G A;  3P5V A;  4XUI A;  1NPZ A;  3OF9 A;  3B79 A;  2R9N A;  2G8J A;  4BS5 A;  5EGW A;  1MIR A;  3V6E A;  1F2C A;  4I04 A;  1MEM A;  1S4V A;  4RY2 A;  1DEU A;  5CVO B;  1ME3 A;  3N4C A;  3IHP A;  4CDD B;  2AIM A;  3H7D A;  7PCK A;  2DC6 A;  3CH2 X;  1QXP A;  2E03 A;  5CVN B;  2NQD B;  1AU0 A;  3KWB X;  4BSQ A;  2P7U A;  3O1G A;  4FK5 A;  3WXG A;  1ZCM A;  1VSN A;  3GCB A;  3RVX A;  1PPD A;  1DF0 A;  2NQA A;  3C9E A;  4N79 A;  3OF8 A;  3PNR A;  4YYR A;  3KSE A;  3HWN A;  1AYU A;  1TL9 A;  2AVW A;  2ATO A;  1YT7 A;  1BQI A;  2BDZ A;  1CPJ A;  1CQD A;  1AU4 A;  4Q8G A;  2AU1 A;  2DZZ A;  1CS8 A;  2AUZ A;  4W5B A;  1STF E;  4YYQ A;  1U9W A;  3F5V A;  4QBB A;  4ZUX U;  2YJB A;  2DZY A;  5F02 A;  3KX1 A;  4YVA A;  2YJ9 A;  1VJV A;  3BPF A;  1AYV A;  3U8E A;  2IPP B;  2R9M A;  3QT4 A;  1YAL A;  4OEL A;  1NB3 A;  4N4Z A;  3CBJ A;  5A24 A;  1PPN A;  1QOL A;  3P5U A;  3H8C A;  1CVZ A;  1F29 A;  2F7D A;  4PI3 A;  1EWP A;  2OP3 A;  3IUT A;  4X6J A;  5PAD A;  1U9X A;  4WA6 A;  1K3B B;  1XKG A;  3QSD A;  3E1Z B;  1O0E A;  1Y4H A;  3HHA A;  5FPW A;  1KHP A;  1PE6 A;  2FYE A;  2GHU A;  1U5I A;  2Y5B A;  4G54 A;  2DCD A;  1BY8 A;  5CHT A;  2G7Y A;  2PRE A;  2YJ2 A;  3K9M A;  1PPP A;  4YYW A;  2Y6E A;  2DJG B;  4FIP A;  1KFU L;  3O0U A;  4XR7 A;  2PBH A;  2ACT A;  2R9F A;  2P86 A;  3PBH A;  3V6C A;  2IBI A;  3KWZ A;  5J94 A;  4YV8 A;  5EF4 A;  1M6D A;  3AI8 A;  2FT2 A;  2NQG A;  4QH6 A;  3KFQ A;  4PP2 E;  2DCB A;  4QRG A;  4CDF B;  3KW9 A;  1KFX L;  2VHS A;  4I05 A;  3S3R A;  2DC7 A;  8PCH A;  1NL6 A;  1ATK A;  2FRA A;  2PAD A;  1YK8 A;  2AS8 A;  1KHQ A;  2XU5 A;  1ME4 A;  1QMY A;  4MZS A;  3ERV A;  1SP4 B;  5CVM A;  4KLB A;  1U9Q X;  1POP A;  3RVW A;  3IMA A;  4W4U A;  3CH3 X;  2DJF B;  4CZW A;  1CB5 A;  1QDQ A;  4P6G A;  4BS6 A;  1EWM A;  4HWY A;  1U9V A;  3OVX A;  2DC9 A;  1Q6K A;  3IV2 A;  3WXF A;  4YYV A;  1ITO A;  5CHV A;  4MZO A;  3F75 A;  3M99 A;  1KXR A;  1YVB A;  4QRV A;  2R6N A;  1F2B A;  3N3K A;  1MEG A;  3I3T A;  3K24 A;  2WBF X;  1ICF A;  1TLO A;  1AU2 A;  1PXV A;  2HH5 A;  1NQC A;  6PAD A;  2B1M A;  2DCA A;  2FUD A;  1NB5 A;  2VHF A;  2G8E A;  1GCB A;  1JQP A;  3USV A;  2PNS A;  2E02 A;  1BP4 A;  3WXE A;  5JA7 A;  2JQG R;  1AYW A;  3K8U A;  4DMX A;  3H8B A;  2CIO A;  1PBH A;  2C0Y A;  2FTD A;  4DMY A;  2DC8 A;  2HD5 A;  2FO5 A;  1PCI A;  3P5W A;  1F2A A;  2E00 A;  3HD3 A;  1CJL A;  3MHS A;  3P5X A;  5K16 A;  2G6D A;  1CV8 A;  1TU6 A;  3IOQ A;  1EWO A;  1A6R A;  1MHW A;  3IEJ A;  3I06 A;  4QRX A;  3MTN A;  2B1N A;  3H89 A;  1THE A;  4BQV A;  4AXM A; 
#chains in the Genus database with same CATH topology
 1SNK A;  3OQC A;  4X6I A;  2AYN A;  2F1G A;  3DF0 A;  2AYO A;  3MP2 A;  1GMY A;  4YYS A;  2FRQ A;  2FQ9 A;  1HUC B;  2AUX A;  2ARY A;  2XU1 A;  1CSB B;  2NQI A;  4YYU A;  3MOR A;  4MSX A;  1MDW A;  3OIS A;  4W5C A;  2OUL A;  2H7J A;  3ZUA A;  1YK7 A;  1YZB A;  1Y08 A;  3RVV A;  5JH3 A;  2P0R A;  2YJ8 A;  2OZ2 A;  4M0W A;  2R9O A;  2YJC A;  4K7C A;  3D6S A;  2HXZ A;  1PAD A;  2HHN A;  4RF1 A;  1AEC A;  3PDF A;  3KKU A;  4PAD A;  4PP1 A;  4CDC B;  2O6X A;  9PAP A;  3RNV A;  1PVJ A;  1NLJ A;  4X6H A;  4P6E A;  3NHE A;  1GEC E;  2GFO A;  1EWL A;  3TNX A;  2E01 A;  3BOW A;  4I07 A;  5E6J A;  4BOZ A;  4CDE B;  3BPM A;  3TRK A;  1IWD A;  4FJC A;  4BPV A;  1ZIV A;  1PPO A;  3S3Q A;  2JQF R;  2DCC A;  2CB5 A;  3OVZ A;  2XU4 A;  4AXL A;  1EF7 A;  1GLO A;  1MS6 A;  4REZ A;  1FH0 A;  3LFY A;  4OW0 A;  3H6S A;  4OEM A;  3CBK A;  1AIM A;  3BWK A;  3LXS A;  3PW3 A;  2R9C A;  1AU3 A;  3BC3 A;  3QJ3 A;  1X9Y A;  4Q8H A;  1CTE A;  1PIP A;  1BGO A;  3PHX A;  2BDL A;  3BCN A;  4N8W A;  3MHH A;  3TMP A;  2XU3 A;  3HHI A;  4BOU A;  3N3G A;  3P5V A;  4XUI A;  4OVZ B;  1NPZ A;  3OF9 A;  3B79 A;  2R9N A;  2G8J A;  4BS5 A;  2UZJ A;  5EGW A;  3PRM A;  1MIR A;  4IUM A;  3V6E A;  1F2C A;  4I04 A;  1MEM A;  5EZQ A;  1S4V A;  4RY2 A;  1DEU A;  2Z84 A;  5CVO B;  1ME3 A;  3N4C A;  3IHP A;  4P16 A;  2AIM A;  3H7D A;  4CDD B;  7PCK A;  2DC6 A;  3CH2 X;  1QXP A;  2E03 A;  5CVN B;  2NQD B;  1AU0 A;  3KWB X;  4BSQ A;  2P7U A;  3O1G A;  4FK5 A;  4HXD B;  4MM3 B;  3WXG A;  1ZCM A;  1VSN A;  3GCB A;  3RVX A;  1PPD A;  1DF0 A;  2NQA A;  3C9E A;  3C0R A;  4N79 A;  3OF8 A;  3PNR A;  4YYR A;  3KSE A;  3HWN A;  1AYU A;  1TL9 A;  2AVW A;  3W30 A;  2ATO A;  3IFU A;  4GUA A;  1YT7 A;  1BQI A;  2BDZ A;  1CPJ A;  1CQD A;  1AU4 A;  4Q8G A;  2AU1 A;  2DZZ A;  1CS8 A;  2AUZ A;  4W5B A;  1STF E;  4YYQ A;  1UKF A;  1U9W A;  3F5V A;  4QBB A;  4ZUX U;  3MJ5 A;  2YJB A;  2DZY A;  5F02 A;  3KX1 A;  4YVA A;  2YJ9 A;  4WUR A;  1VJV A;  3BPF A;  1AYV A;  3U8E A;  2IPP B;  2R9M A;  3QT4 A;  1YAL A;  4OEL A;  1NB3 A;  4N4Z A;  3CBJ A;  2BTW A;  4XZX A;  5A24 A;  3O65 A;  1PPN A;  1QOL A;  4RF0 A;  3P5U A;  3H8C A;  1CVZ A;  1F29 A;  2F7D A;  4PI3 A;  4BOP A;  1EWP A;  2OP3 A;  3PHU A;  3PRP A;  3IUT A;  4X6J A;  5PAD A;  1U9X A;  4WA6 A;  1K3B B;  1XKG A;  3QSD A;  3E1Z B;  1O0E A;  1Y4H A;  1DKI A;  3MTV A;  4IP3 A;  2JTC A;  3HHA A;  5KO3 A;  5FPW A;  3E9S A;  1KHP A;  2HWK A;  1PE6 A;  2JRI A;  2FYE A;  2GHU A;  1U5I A;  2Y5B A;  4G54 A;  2DCD A;  1BY8 A;  3PHW A;  5CHT A;  3BBA A;  2G7Y A;  2PRE A;  2YJ2 A;  3K9M A;  3PSE A;  1PPP A;  4YYW A;  2Y6E A;  2DJG B;  4FIP A;  1KFU L;  2DOS A;  3O0U A;  4XR7 A;  2PBH A;  2ACT A;  2R9F A;  2P86 A;  3PBH A;  3V6C A;  2IBI A;  3KWZ A;  5J94 A;  4YV8 A;  5EF4 A;  1M6D A;  3AI8 A;  2FT2 A;  4PT5 A;  4BOQ A;  2NQG A;  4QH6 A;  5EZS A;  3KFQ A;  4PP2 E;  2DCB A;  4QRG A;  4CDF B;  3KW9 A;  2FE8 A;  4BOS A;  1KFX L;  2VHS A;  4I05 A;  3S3R A;  2J7Q C;  4RKX A;  2DC7 A;  8PCH A;  1NL6 A;  1ATK A;  2FRA A;  2PAD A;  1YK8 A;  2AS8 A;  1KHQ A;  2XU5 A;  1ME4 A;  1QMY A;  5JZE A;  3ERV A;  4MZS A;  3B21 A;  1SP4 B;  5CVM A;  4KLB A;  1U9Q X;  1POP A;  3RVW A;  3IMA A;  4W4U A;  3CH3 X;  2BU3 A;  2DJF B;  4CZW A;  1CB5 A;  1QDQ A;  4P6G A;  4BS6 A;  1EWM A;  4HWY A;  1U9V A;  3OVX A;  2DC9 A;  1Q6K A;  3BY4 A;  3IV2 A;  3WXF A;  4YYV A;  1ITO A;  3W31 A;  5CHV A;  4MZO A;  3F75 A;  3M99 A;  1KXR A;  1YVB A;  4QRV A;  2R6N A;  1F2B A;  3N3K A;  1MEG A;  3I3T A;  3K24 A;  2AGA A;  2WBF X;  1ICF A;  1TLO A;  2BTW B;  1AU2 A;  1PXV A;  2HH5 A;  1NQC A;  6PAD A;  2B1M A;  2DCA A;  2FUD A;  1NB5 A;  2VHF A;  2G8E A;  1GCB A;  1JQP A;  3USV A;  2PNS A;  2E02 A;  1BP4 A;  3WXE A;  4RNA A;  5JA7 A;  2JQG R;  1AYW A;  4OVZ A;  3K8U A;  4MI7 A;  4D8I A;  4DMX A;  3H8B A;  2CIO A;  1PBH A;  2C0Y A;  2FTD A;  4DMY A;  2DC8 A;  2HD5 A;  2FO5 A;  1PCI A;  3P5W A;  1F2A A;  2E00 A;  3HD3 A;  4D8E A;  1CJL A;  3MHS A;  3P5X A;  5K16 A;  3PT2 A;  2G6D A;  4R3D A;  3BB7 A;  1CV8 A;  1TU6 A;  3IOQ A;  1EWO A;  1A6R A;  4D8B A;  2J7Q A;  1MHW A;  3IEJ A;  3I06 A;  4QRX A;  3MTN A;  2B1N A;  3H89 A;  1THE A;  4BQV A;  4AXM A;  4ZTB A;  3ZNH A;  4A5U A; 
#chains in the Genus database with same CATH homology
 1SNK A;  4X6I A;  2AYN A;  2F1G A;  3DF0 A;  2AYO A;  1GMY A;  4YYS A;  2FRQ A;  2FQ9 A;  1HUC B;  2AUX A;  2ARY A;  2XU1 A;  1CSB B;  2NQI A;  4YYU A;  3MOR A;  4MSX A;  1MDW A;  3OIS A;  4W5C A;  2OUL A;  2H7J A;  3ZUA A;  1YK7 A;  1Y08 A;  3RVV A;  5JH3 A;  2P0R A;  2YJ8 A;  2OZ2 A;  2R9O A;  2YJC A;  4K7C A;  3D6S A;  2HXZ A;  1PAD A;  2HHN A;  1AEC A;  1E2T A;  3KKU A;  3PDF A;  4PAD A;  4PP1 A;  4CDC B;  2O6X A;  9PAP A;  1NLJ A;  4X6H A;  4P6E A;  3NHE A;  1GEC E;  2GFO A;  1EWL A;  3TNX A;  2E01 A;  3BOW A;  4I07 A;  2BSZ A;  4CDE B;  3BPM A;  1IWD A;  4FJC A;  4BPV A;  1ZIV A;  1PPO A;  3S3Q A;  2JQF R;  2DCC A;  2CB5 A;  3OVZ A;  2XU4 A;  4AXL A;  1EF7 A;  1GLO A;  1MS6 A;  1FH0 A;  3LFY A;  3H6S A;  4OEM A;  3CBK A;  1AIM A;  3BWK A;  3LXS A;  3PW3 A;  2R9C A;  1AU3 A;  3BC3 A;  3QJ3 A;  1X9Y A;  4Q8H A;  1CTE A;  1PIP A;  1BGO A;  2BDL A;  3BCN A;  4N8W A;  3D9W A;  3MHH A;  2XU3 A;  3HHI A;  3N3G A;  3P5V A;  1W6F A;  4XUI A;  1NPZ A;  4B55 A;  3OF9 A;  3B79 A;  2R9N A;  2G8J A;  4BS5 A;  5EGW A;  1MIR A;  4NV7 A;  3V6E A;  1F2C A;  4I04 A;  1MEM A;  4BGF A;  1S4V A;  4RY2 A;  1DEU A;  5CVO B;  1ME3 A;  3N4C A;  3IHP A;  4CDD B;  2AIM A;  3H7D A;  1W5R A;  7PCK A;  2DC6 A;  3CH2 X;  1QXP A;  2E03 A;  5CVN B;  2NQD B;  1AU0 A;  3KWB X;  4BSQ A;  2P7U A;  3O1G A;  4FK5 A;  3WXG A;  1ZCM A;  1VSN A;  3GCB A;  3RVX A;  1PPD A;  1DF0 A;  2NQA A;  3C9E A;  4N79 A;  3OF8 A;  3PNR A;  4YYR A;  3KSE A;  3HWN A;  1AYU A;  1TL9 A;  2AVW A;  2ATO A;  1YT7 A;  1W4T A;  1BQI A;  2BDZ A;  1CPJ A;  1CQD A;  1AU4 A;  4Q8G A;  2AU1 A;  2DZZ A;  1CS8 A;  2AUZ A;  4W5B A;  1STF E;  4YYQ A;  1U9W A;  3F5V A;  4QBB A;  4ZUX U;  2YJB A;  2DZY A;  5F02 A;  3KX1 A;  4YVA A;  2YJ9 A;  1VJV A;  3BPF A;  1AYV A;  3U8E A;  2IPP B;  2R9M A;  3QT4 A;  1YAL A;  4OEL A;  1NB3 A;  4N4Z A;  3CBJ A;  5A24 A;  1PPN A;  1QOL A;  3P5U A;  3H8C A;  1CVZ A;  1F29 A;  2F7D A;  4PI3 A;  1EWP A;  2OP3 A;  3IUT A;  4X6J A;  5PAD A;  1U9X A;  4WA6 A;  1K3B B;  1XKG A;  3QSD A;  3E1Z B;  1O0E A;  1Y4H A;  3HHA A;  5FPW A;  1KHP A;  1PE6 A;  2FYE A;  2GHU A;  1U5I A;  2Y5B A;  4G54 A;  2DCD A;  2VFC A;  1BY8 A;  5CHT A;  2G7Y A;  2PRE A;  2YJ2 A;  3K9M A;  1PPP A;  4YYW A;  2Y6E A;  2DJG B;  4FIP A;  1KFU L;  3O0U A;  4XR7 A;  2PBH A;  2ACT A;  2R9F A;  2P86 A;  3PBH A;  3V6C A;  2IBI A;  3KWZ A;  5J94 A;  4YV8 A;  5EF4 A;  1M6D A;  3AI8 A;  2FT2 A;  4C5P A;  2NQG A;  4QH6 A;  3KFQ A;  4PP2 E;  2DCB A;  4QRG A;  4CDF B;  3KW9 A;  1KFX L;  2VHS A;  4I05 A;  3S3R A;  2DC7 A;  8PCH A;  1NL6 A;  1ATK A;  2FRA A;  2PAD A;  1YK8 A;  2AS8 A;  1KHQ A;  2XU5 A;  1ME4 A;  1QMY A;  4MZS A;  3ERV A;  1GX3 A;  3LTW A;  1SP4 B;  5CVM A;  4KLB A;  4NV8 A;  1U9Q X;  1POP A;  3RVW A;  3IMA A;  4W4U A;  3CH3 X;  2DJF B;  4CZW A;  1CB5 A;  1QDQ A;  4P6G A;  4BS6 A;  1EWM A;  4HWY A;  1U9V A;  3OVX A;  2DC9 A;  1Q6K A;  3IV2 A;  3WXF A;  4YYV A;  1ITO A;  5CHV A;  4MZO A;  3F75 A;  3M99 A;  1KXR A;  1YVB A;  4QRV A;  2R6N A;  1F2B A;  3N3K A;  1MEG A;  3I3T A;  3K24 A;  2WBF X;  1ICF A;  1TLO A;  1AU2 A;  1PXV A;  2HH5 A;  1NQC A;  6PAD A;  2B1M A;  2DCA A;  2FUD A;  1NB5 A;  2VHF A;  2G8E A;  1GCB A;  1JQP A;  3USV A;  2PNS A;  4GUZ A;  2E02 A;  1BP4 A;  2VFB A;  3WXE A;  5JA7 A;  2JQG R;  1AYW A;  3K8U A;  4DMX A;  3H8B A;  2CIO A;  1PBH A;  2C0Y A;  2FTD A;  4DMY A;  2DC8 A;  2HD5 A;  2FO5 A;  1PCI A;  3P5W A;  1F2A A;  2E00 A;  3HD3 A;  1CJL A;  3MHS A;  3P5X A;  5K16 A;  2G6D A;  1CV8 A;  1TU6 A;  3IOQ A;  1EWO A;  1A6R A;  1MHW A;  3IEJ A;  3I06 A;  4QRX A;  3MTN A;  2B1N A;  3H89 A;  1THE A;  4BQV A;  4AXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...