1Q6KA

Cathepsin k complexed with t-butyl(1s)-1-cyclohexyl-2-oxoethylcarbamate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Exploration of the P1 SAR of aldehyde cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1q6kA00
3BC3A 1U9QX 4BSQA 2P0RA 4HWYA 1THEA 2CIOA 2G8JA 1CB5A 1MEGA 1BP4A 3O0UA 4YV8A 3U8EA 2AUXA 3IOQA 4CDFB 3QT4A 4BQVA 3P5XA 3NHEA 1PE6A 1JQPA 2PBHA 2G8EA 2DZYA 2B1NA 2NQAA 2DC7A 2HHNA 3LFYA 1VJVA 2E02A 3IEJA 2DCDA 1PPNA 4Q8GA 4CZWA 2XU4A 1PCIA 3P5WA 3S3RA 4YYWA 5EGWA 1PPOA 3HHAA 3H8CA 1QDQA 1YK7A 3K24A 4XR7A 1TU6A 3N4CA 2HD5A 2PNSA 3D6SA 2NQDB 3OVZA 3O1GA 1CJLA 1GMYA 4P6EA 1BGOA 2DCBA 3BOWA 2YJ2A 5JA7A 1DF0A 2GHUA 3PW3A 4QRGA 5PADA 2OULA 1KFUL 3H6SA 1CTEA 4PP2E 2OZ2A 1CQDA 2R9FA 5J94A 1XKGA 3PBHA 4WA6A 1MEMA 3MHHA 9PAPA 4YYQA 3TNXA 3H8BA 1AU4A 4MZOA 3PDFA 3S3QA 4W5CA 3OF8A 3CBKA 2ARYA 2R9MA 2JQGR 3OISA 3KX1A 4YYRA 3IHPA 5A24A 3P5UA 3MORA 1U9VA 2FYEA 4YYVA 2NQGA 1NLJA 1VSNA 4BS5A 3RVXA 1QMYA 1AIMA 2FO5A 1MS6A 3IV2A 1CV8A 1AYUA 4X6IA 2R9OA 4OELA 1HUCB 1YK8A 2DC9A 2IPPB 1ME3A 4N8WA 2GFOA 3V6CA 5CVMA 6PADA 2OP3A 4QBBA 3RVWA 2CB5A 2E03A 2HH5A 2YJ9A 2G6DA 1F2BA 5CVNB 4DMXA 1QXPA 4W5BA 3N3GA 4YVAA 2R9CA 4X6HA 2R6NA 1Y08A 4P6GA 1NB5A 2FQ9A 5K16A 4AXMA 2PADA 5CHTA 1GCBA 4CDCB 3N3KA 1TL9A 1NPZA 2YJ8A 3KWBX 1DEUA 1ZCMA 2AUZA 7PCKA 1M6DA 3AI8A 1NL6A 2E01A 4QRVA 2AYNA 2AU1A 1ME4A 4I04A 3BCNA 1ITOA 1NB3A 2DC6A 1CVZA 1FH0A 5JH3A 1Q6KA 1F2AA 1YVBA 2G7YA 2WBFX 1EWOA 4YYUA 1SP4B 2AVWA 2VHSA 3HWNA 2FT2A 3IUTA 4RY2A 4CDDB 4MSXA 3IMAA 4QH6A 3V6EA 3F5VA 1U9XA 1A6RA 1BY8A 3PNRA 2DCCA 3DF0A 3KW9A 1GECE 2AS8A 2ATOA 2FTDA 4ZUXU 4I05A 2DJGB 2VHFA 1PPDA 2R9NA 1AYVA 3F75A 1QOLA 3K9MA 4Q8HA 1NQCA 4QRXA 2DCAA 4K7CA 3RVVA 2C0YA 3WXEA 2IBIA 4I07A 2H7JA 1KFXL 1EWLA 1PIPA 4N4ZA 5FPWA 2Y5BA 3ERVA 1F29A 1AU3A 1EWMA 3OF9A 3HD3A 2DC8A 3I3TA 1X9YA 3QSDA 2DJFB 3BPMA 5CVOB 4W4UA 1ATKA 4FJCA 3LXSA 3MTNA 1CPJA 1IWDA 1O0EA 2FRAA 2FUDA 3HHIA 3CH3X 2HXZA 1MDWA 1MIRA 1SNKA 2Y6EA 1KHQA 1PXVA 1EWPA 4PP1A 3KSEA 3USVA 3GCBA 2NQIA 4XUIA 2P7UA 1U5IA 2BDLA 3ZUAA 2YJBA 3QJ3A 2DZZA 3K8UA 3B79A 4CDEB 4YYSA 1STFE 4OEMA 4N79A 1ICFA 3E1ZB 4AXLA 4BS6A 2XU5A 2FRQA 1U9WA 2P86A 4MZSA 1K3BB 2AIMA 4KLBA 3I06A 1TLOA 3KKUA 1F2CA 1CSBB 2E00A 1GLOA 3BPFA 1PADA 5F02A 3H89A 1YALA 1AECA 1AU0A 2O6XA 1BQIA 1YT7A 2XU3A 2AYOA 1EF7A 3CBJA 1AU2A 1MHWA 3MHSA 4FIPA 1S4VA 3WXGA 4DMYA 1PBHA 1Y4HA 8PCHA 2JQFR 3C9EA 1CS8A 2XU1A 2YJCA 2B1MA 4BPVA 4G54A 3BWKA 2F7DA 5CHVA 3M99A 4FK5A 3P5VA 2F1GA 2BDZA 4X6JA 2PREA 3OVXA 1KXRA 3KWZA 3H7DA 3CH2X 3KFQA 1POPA 4PADA 1AYWA 4PI3A 3WXFA 2ACTA 1PPPA 1KHPA 1ZIVA 5EF4A
chains in the Genus database with same CATH superfamily
3BC3A 1U9QX 4BSQA 4RKXA 2P0RA 4HWYA 1THEA 2CIOA 2G8JA 1CB5A 1MEGA 1BP4A 3O0UA 3PSEA 4YV8A 3U8EA 2AUXA 3IOQA 5JZEA 4M0WA 4CDFB 3QT4A 4BQVA 3P5XA 3NHEA 1PE6A 4RF0A 1JQPA 2PBHA 2G8EA 3ZNHA 2DZYA 2B1NA 2NQAA 2DC7A 2HHNA 3LFYA 1VJVA 3TMPA 2J7QC 2E02A 3IEJA 2DCDA 1PPNA 4Q8GA 4CZWA 2XU4A 1PCIA 3P5WA 3S3RA 4YYWA 5EGWA 1PPOA 3HHAA 3H8CA 1QDQA 1YK7A 3K24A 3MJ5A 4XR7A 1TU6A 3N4CA 3O65A 4A5UA 2HD5A 2PNSA 4HXDB 3D6SA 2NQDB 3OVZA 3O1GA 3MP2A 1CJLA 1GMYA 4P6EA 1BGOA 2DCBA 3BOWA 2YJ2A 2DOSA 3PHXA 5JA7A 1DF0A 2GHUA 3PW3A 4QRGA 5PADA 2OULA 1KFUL 3H6SA 4D8IA 1CTEA 4PP2E 2OZ2A 4MM3B 3OQCA 1CQDA 2R9FA 5J94A 1XKGA 4BOQA 3PBHA 4BOUA 3BY4A 4WA6A 1MEMA 3MHHA 3BB7A 9PAPA 4YYQA 1YZBA 3TNXA 3H8BA 1AU4A 4MZOA 3PDFA 3S3QA 3C0RA 4W5CA 3OF8A 3CBKA 2ARYA 2R9MA 2JQGR 3OISA 3KX1A 4YYRA 4XZXA 3IHPA 5A24A 4IUMA 3P5UA 3MORA 1U9VA 4OVZB 2FYEA 4YYVA 2NQGA 1NLJA 5EZQA 1VSNA 2JTCA 4BS5A 3RVXA 2Z84A 1QMYA 1AIMA 2HWKA 2FO5A 1MS6A 3IV2A 5KO3A 1CV8A 1AYUA 4X6IA 2R9OA 4OELA 1HUCB 1YK8A 4OVZA 2BTWB 2DC9A 2IPPB 1ME3A 4N8WA 2GFOA 3PRMA 3V6CA 4WURA 5CVMA 6PADA 2AGAA 2OP3A 4QBBA 3RVWA 2CB5A 2E03A 2HH5A 2YJ9A 4PT5A 2G6DA 2BTWA 1F2BA 5CVNB 4D8EA 4DMXA 1QXPA 4W5BA 3N3GA 4YVAA 2R9CA 4X6HA 2R6NA 1Y08A 4P6GA 4R3DA 4RF1A 1NB5A 2FQ9A 5K16A 3B21A 4AXMA 2PADA 5CHTA 1GCBA 4REZA 4CDCB 3N3KA 1TL9A 1NPZA 2YJ8A 3KWBX 1DEUA 1ZCMA 2AUZA 7PCKA 1M6DA 3AI8A 1NL6A 2E01A 4QRVA 2AYNA 2AU1A 1ME4A 4I04A 3BCNA 4IP3A 1ITOA 1NB3A 2DC6A 1CVZA 1FH0A 5JH3A 1Q6KA 1F2AA 4RNAA 1YVBA 2G7YA 2WBFX 1EWOA 4YYUA 1SP4B 2AVWA 2VHSA 3HWNA 2FT2A 3IUTA 4RY2A 3PT2A 4MSXA 4CDDB 4BOSA 3E9SA 3IMAA 4QH6A 3V6EA 3F5VA 1U9XA 1A6RA 1BY8A 3PNRA 2DCCA 3DF0A 3KW9A 5E6JA 1GECE 4ZTBA 2AS8A 2ATOA 3BBAA 2FTDA 2UZJA 4ZUXU 4I05A 2DJGB 2VHFA 1PPDA 2R9NA 1AYVA 3F75A 1QOLA 3K9MA 4Q8HA 1NQCA 4QRXA 2DCAA 4K7CA 3RVVA 2C0YA 3WXEA 2IBIA 4I07A 1UKFA 2H7JA 1KFXL 1EWLA 3IFUA 1PIPA 4N4ZA 5FPWA 5EZSA 2Y5BA 2BU3A 3ERVA 1F29A 1AU3A 1EWMA 3OF9A 3HD3A 2DC8A 3I3TA 1X9YA 3PRPA 3QSDA 2DJFB 3BPMA 5CVOB 4W4UA 1ATKA 4FJCA 3LXSA 3MTNA 3W31A 1CPJA 1IWDA 3RNVA 1O0EA 3MTVA 2FRAA 2FUDA 3HHIA 3CH3X 2HXZA 1PVJA 1MDWA 1MIRA 1SNKA 2Y6EA 1KHQA 1PXVA 1EWPA 4PP1A 3KSEA 4OW0A 3USVA 3GCBA 2NQIA 4XUIA 2FE8A 2P7UA 1U5IA 2BDLA 3ZUAA 2YJBA 3QJ3A 2JRIA 2DZZA 3K8UA 3B79A 4CDEB 4YYSA 1STFE 4OEMA 4N79A 1DKIA 1ICFA 3E1ZB 4AXLA 4BS6A 2XU5A 2FRQA 1U9WA 2P86A 4MZSA 1K3BB 2AIMA 2J7QA 4KLBA 3I06A 3PHUA 1TLOA 3KKUA 1F2CA 4BOZA 1CSBB 2E00A 1GLOA 3BPFA 1PADA 5F02A 4MI7A 3H89A 1YALA 1AECA 4D8BA 1AU0A 2O6XA 1BQIA 1YT7A 2XU3A 2AYOA 1EF7A 3CBJA 1AU2A 1MHWA 4P16A 3MHSA 4FIPA 1S4VA 3WXGA 4BOPA 1PBHA 4DMYA 1Y4HA 8PCHA 2JQFR 3C9EA 1CS8A 2XU1A 2YJCA 4GUAA 2B1MA 4BPVA 4G54A 3BWKA 2F7DA 5CHVA 3M99A 4FK5A 3P5VA 2F1GA 2BDZA 4X6JA 2PREA 3PHWA 3OVXA 1KXRA 3TRKA 3KWZA 3H7DA 3CH2X 3KFQA 1POPA 4PADA 3W30A 1AYWA 4PI3A 3WXFA 2ACTA 1PPPA 1KHPA 1ZIVA 5EF4A
chains in the Genus database with same CATH topology
3BC3A 1U9QX 4BSQA 2P0RA 4HWYA 1THEA 2CIOA 2G8JA 1CB5A 1MEGA 1BP4A 3O0UA 4YV8A 3U8EA 2AUXA 3IOQA 4CDFB 3QT4A 4BQVA 3P5XA 3NHEA 1PE6A 1JQPA 2BSZA 2PBHA 2G8EA 2DZYA 2B1NA 4GUZA 2NQAA 2DC7A 2HHNA 3LFYA 1VJVA 2E02A 3IEJA 2DCDA 1PPNA 4Q8GA 4CZWA 2XU4A 1PCIA 3P5WA 2VFCA 3S3RA 4YYWA 5EGWA 1PPOA 3HHAA 3H8CA 1QDQA 1YK7A 3K24A 4XR7A 1TU6A 3N4CA 2HD5A 2PNSA 3D6SA 2NQDB 3OVZA 3O1GA 1CJLA 1GMYA 4P6EA 1BGOA 2DCBA 3BOWA 2YJ2A 5JA7A 4NV7A 1DF0A 2GHUA 3PW3A 4BGFA 4QRGA 5PADA 2OULA 1KFUL 3H6SA 1CTEA 3LTWA 4PP2E 2OZ2A 1W5RA 1CQDA 2R9FA 5J94A 1XKGA 3PBHA 4WA6A 1MEMA 3MHHA 4NV8A 4YYQA 9PAPA 3TNXA 3H8BA 1AU4A 4MZOA 3PDFA 3S3QA 4W5CA 3OF8A 3CBKA 2ARYA 2R9MA 2JQGR 3OISA 3KX1A 4YYRA 3IHPA 5A24A 3P5UA 3MORA 1U9VA 2FYEA 4YYVA 2NQGA 1NLJA 1VSNA 4BS5A 3RVXA 1QMYA 1AIMA 2FO5A 1MS6A 3IV2A 1CV8A 1AYUA 4X6IA 2R9OA 4OELA 1HUCB 1YK8A 2DC9A 2IPPB 1ME3A 4N8WA 2GFOA 3V6CA 5CVMA 6PADA 2OP3A 4QBBA 3RVWA 2CB5A 2E03A 2HH5A 2YJ9A 2G6DA 1F2BA 5CVNB 1E2TA 4DMXA 1QXPA 4W5BA 3N3GA 4YVAA 2R9CA 4X6HA 2R6NA 1Y08A 4P6GA 1NB5A 2FQ9A 5K16A 4AXMA 2PADA 5CHTA 1GCBA 4CDCB 3N3KA 1TL9A 1NPZA 2YJ8A 3KWBX 1DEUA 1ZCMA 2AUZA 7PCKA 1M6DA 3AI8A 1NL6A 2E01A 4QRVA 2AYNA 2AU1A 1ME4A 4I04A 3BCNA 1ITOA 1NB3A 2DC6A 1CVZA 1FH0A 5JH3A 1Q6KA 1F2AA 1YVBA 2G7YA 2WBFX 1EWOA 4YYUA 1SP4B 2AVWA 2VHSA 3D9WA 3HWNA 2FT2A 3IUTA 4RY2A 4CDDB 4MSXA 3IMAA 4QH6A 3V6EA 3F5VA 1U9XA 1A6RA 1BY8A 3PNRA 2DCCA 3DF0A 3KW9A 1GECE 2AS8A 2ATOA 2FTDA 4ZUXU 4I05A 2DJGB 2VHFA 1PPDA 2R9NA 1AYVA 3F75A 1QOLA 3K9MA 4Q8HA 1NQCA 4QRXA 2DCAA 4K7CA 3RVVA 2C0YA 3WXEA 2IBIA 4I07A 2H7JA 1KFXL 1EWLA 1PIPA 4N4ZA 5FPWA 4C5PA 2Y5BA 3ERVA 1F29A 1AU3A 1EWMA 3OF9A 3HD3A 2DC8A 3I3TA 1X9YA 3QSDA 2DJFB 3BPMA 5CVOB 4W4UA 1ATKA 4FJCA 3LXSA 3MTNA 1CPJA 1IWDA 1O0EA 2FRAA 2FUDA 3HHIA 3CH3X 2HXZA 1MDWA 1MIRA 1SNKA 2Y6EA 1KHQA 1PXVA 1EWPA 4PP1A 3KSEA 3USVA 3GCBA 2NQIA 4XUIA 2P7UA 1U5IA 2BDLA 3ZUAA 1W6FA 2YJBA 1W4TA 3QJ3A 1GX3A 2DZZA 3K8UA 3B79A 4CDEB 4YYSA 1STFE 4B55A 4OEMA 4N79A 1ICFA 3E1ZB 4AXLA 4BS6A 2XU5A 2FRQA 1U9WA 2P86A 4MZSA 1K3BB 2AIMA 4KLBA 3I06A 1TLOA 3KKUA 1F2CA 1CSBB 2E00A 1GLOA 3BPFA 1PADA 5F02A 3H89A 1YALA 1AECA 1AU0A 2O6XA 1BQIA 1YT7A 2XU3A 2AYOA 1EF7A 3CBJA 1AU2A 1MHWA 3MHSA 4FIPA 1S4VA 3WXGA 4DMYA 1PBHA 1Y4HA 8PCHA 2JQFR 3C9EA 1CS8A 2XU1A 2YJCA 2B1MA 4BPVA 4G54A 3BWKA 2F7DA 5CHVA 3M99A 4FK5A 3P5VA 2F1GA 2BDZA 4X6JA 2PREA 3OVXA 1KXRA 3KWZA 3H7DA 3CH2X 3KFQA 1POPA 4PADA 2VFBA 1AYWA 4PI3A 3WXFA 2ACTA 1PPPA 1KHPA 1ZIVA 5EF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BC3 A;  1U9Q X;  4BSQ A;  2P0R A;  4HWY A;  1THE A;  2CIO A;  2G8J A;  1CB5 A;  1MEG A;  1BP4 A;  3O0U A;  4YV8 A;  3U8E A;  2AUX A;  3IOQ A;  4CDF B;  3QT4 A;  4BQV A;  3P5X A;  3NHE A;  1PE6 A;  1JQP A;  2PBH A;  2G8E A;  2DZY A;  2B1N A;  2NQA A;  2DC7 A;  2HHN A;  3LFY A;  1VJV A;  2E02 A;  3IEJ A;  2DCD A;  1PPN A;  4Q8G A;  4CZW A;  2XU4 A;  1PCI A;  3P5W A;  3S3R A;  4YYW A;  5EGW A;  1PPO A;  3HHA A;  3H8C A;  1QDQ A;  1YK7 A;  3K24 A;  4XR7 A;  1TU6 A;  3N4C A;  2HD5 A;  2PNS A;  3D6S A;  2NQD B;  3OVZ A;  3O1G A;  1CJL A;  1GMY A;  4P6E A;  1BGO A;  2DCB A;  3BOW A;  2YJ2 A;  5JA7 A;  1DF0 A;  2GHU A;  3PW3 A;  4QRG A;  5PAD A;  2OUL A;  1KFU L;  3H6S A;  1CTE A;  4PP2 E;  2OZ2 A;  1CQD A;  2R9F A;  5J94 A;  1XKG A;  3PBH A;  4WA6 A;  1MEM A;  3MHH A;  9PAP A;  4YYQ A;  3TNX A;  3H8B A;  1AU4 A;  4MZO A;  3PDF A;  3S3Q A;  4W5C A;  3OF8 A;  3CBK A;  2ARY A;  2R9M A;  2JQG R;  3OIS A;  3KX1 A;  4YYR A;  3IHP A;  5A24 A;  3P5U A;  3MOR A;  1U9V A;  2FYE A;  4YYV A;  2NQG A;  1NLJ A;  1VSN A;  4BS5 A;  3RVX A;  1QMY A;  1AIM A;  2FO5 A;  1MS6 A;  3IV2 A;  1CV8 A;  1AYU A;  4X6I A;  2R9O A;  4OEL A;  1HUC B;  1YK8 A;  2DC9 A;  2IPP B;  1ME3 A;  4N8W A;  2GFO A;  3V6C A;  5CVM A;  6PAD A;  2OP3 A;  4QBB A;  3RVW A;  2CB5 A;  2E03 A;  2HH5 A;  2YJ9 A;  2G6D A;  1F2B A;  5CVN B;  4DMX A;  1QXP A;  4W5B A;  3N3G A;  4YVA A;  2R9C A;  4X6H A;  2R6N A;  1Y08 A;  4P6G A;  1NB5 A;  2FQ9 A;  5K16 A;  4AXM A;  2PAD A;  5CHT A;  1GCB A;  4CDC B;  3N3K A;  1TL9 A;  1NPZ A;  2YJ8 A;  3KWB X;  1DEU A;  1ZCM A;  2AUZ A;  7PCK A;  1M6D A;  3AI8 A;  1NL6 A;  2E01 A;  4QRV A;  2AYN A;  2AU1 A;  1ME4 A;  4I04 A;  3BCN A;  1ITO A;  1NB3 A;  2DC6 A;  1CVZ A;  1FH0 A;  5JH3 A;  1Q6K A;  1F2A A;  1YVB A;  2G7Y A;  2WBF X;  1EWO A;  4YYU A;  1SP4 B;  2AVW A;  2VHS A;  3HWN A;  2FT2 A;  3IUT A;  4RY2 A;  4CDD B;  4MSX A;  3IMA A;  4QH6 A;  3V6E A;  3F5V A;  1U9X A;  1A6R A;  1BY8 A;  3PNR A;  2DCC A;  3DF0 A;  3KW9 A;  1GEC E;  2AS8 A;  2ATO A;  2FTD A;  4ZUX U;  4I05 A;  2DJG B;  2VHF A;  1PPD A;  2R9N A;  1AYV A;  3F75 A;  1QOL A;  3K9M A;  4Q8H A;  1NQC A;  4QRX A;  2DCA A;  4K7C A;  3RVV A;  2C0Y A;  3WXE A;  2IBI A;  4I07 A;  2H7J A;  1KFX L;  1EWL A;  1PIP A;  4N4Z A;  5FPW A;  2Y5B A;  3ERV A;  1F29 A;  1AU3 A;  1EWM A;  3OF9 A;  3HD3 A;  2DC8 A;  3I3T A;  1X9Y A;  3QSD A;  2DJF B;  3BPM A;  5CVO B;  4W4U A;  1ATK A;  4FJC A;  3LXS A;  3MTN A;  1CPJ A;  1IWD A;  1O0E A;  2FRA A;  2FUD A;  3HHI A;  3CH3 X;  2HXZ A;  1MDW A;  1MIR A;  1SNK A;  2Y6E A;  1KHQ A;  1PXV A;  1EWP A;  4PP1 A;  3KSE A;  3USV A;  3GCB A;  2NQI A;  4XUI A;  2P7U A;  1U5I A;  2BDL A;  3ZUA A;  2YJB A;  3QJ3 A;  2DZZ A;  3K8U A;  3B79 A;  4CDE B;  4YYS A;  1STF E;  4OEM A;  4N79 A;  1ICF A;  3E1Z B;  4AXL A;  4BS6 A;  2XU5 A;  2FRQ A;  1U9W A;  2P86 A;  4MZS A;  1K3B B;  2AIM A;  4KLB A;  3I06 A;  1TLO A;  3KKU A;  1F2C A;  1CSB B;  2E00 A;  1GLO A;  3BPF A;  1PAD A;  5F02 A;  3H89 A;  1YAL A;  1AEC A;  1AU0 A;  2O6X A;  1BQI A;  1YT7 A;  2XU3 A;  2AYO A;  1EF7 A;  3CBJ A;  1AU2 A;  1MHW A;  3MHS A;  4FIP A;  1S4V A;  3WXG A;  4DMY A;  1PBH A;  1Y4H A;  8PCH A;  2JQF R;  3C9E A;  1CS8 A;  2XU1 A;  2YJC A;  2B1M A;  4BPV A;  4G54 A;  3BWK A;  2F7D A;  5CHV A;  3M99 A;  4FK5 A;  3P5V A;  2F1G A;  2BDZ A;  4X6J A;  2PRE A;  3OVX A;  1KXR A;  3KWZ A;  3H7D A;  3CH2 X;  3KFQ A;  1POP A;  4PAD A;  1AYW A;  4PI3 A;  3WXF A;  2ACT A;  1PPP A;  1KHP A;  1ZIV A;  5EF4 A; 
#chains in the Genus database with same CATH topology
 3BC3 A;  1U9Q X;  4BSQ A;  4RKX A;  2P0R A;  4HWY A;  1THE A;  2CIO A;  2G8J A;  1CB5 A;  1MEG A;  1BP4 A;  3O0U A;  3PSE A;  4YV8 A;  3U8E A;  2AUX A;  3IOQ A;  5JZE A;  4M0W A;  4CDF B;  3QT4 A;  4BQV A;  3P5X A;  3NHE A;  1PE6 A;  4RF0 A;  1JQP A;  2PBH A;  2G8E A;  3ZNH A;  2DZY A;  2B1N A;  2NQA A;  2DC7 A;  2HHN A;  3LFY A;  1VJV A;  3TMP A;  2J7Q C;  2E02 A;  3IEJ A;  2DCD A;  1PPN A;  4Q8G A;  4CZW A;  2XU4 A;  1PCI A;  3P5W A;  3S3R A;  4YYW A;  5EGW A;  1PPO A;  3HHA A;  3H8C A;  1QDQ A;  1YK7 A;  3K24 A;  3MJ5 A;  4XR7 A;  1TU6 A;  3N4C A;  3O65 A;  4A5U A;  2HD5 A;  2PNS A;  4HXD B;  3D6S A;  2NQD B;  3OVZ A;  3O1G A;  3MP2 A;  1CJL A;  1GMY A;  4P6E A;  1BGO A;  2DCB A;  3BOW A;  2YJ2 A;  2DOS A;  3PHX A;  5JA7 A;  1DF0 A;  2GHU A;  3PW3 A;  4QRG A;  5PAD A;  2OUL A;  1KFU L;  3H6S A;  4D8I A;  1CTE A;  4PP2 E;  2OZ2 A;  4MM3 B;  3OQC A;  1CQD A;  2R9F A;  5J94 A;  1XKG A;  4BOQ A;  3PBH A;  4BOU A;  3BY4 A;  4WA6 A;  1MEM A;  3MHH A;  3BB7 A;  9PAP A;  4YYQ A;  1YZB A;  3TNX A;  3H8B A;  1AU4 A;  4MZO A;  3PDF A;  3S3Q A;  3C0R A;  4W5C A;  3OF8 A;  3CBK A;  2ARY A;  2R9M A;  2JQG R;  3OIS A;  3KX1 A;  4YYR A;  4XZX A;  3IHP A;  5A24 A;  4IUM A;  3P5U A;  3MOR A;  1U9V A;  4OVZ B;  2FYE A;  4YYV A;  2NQG A;  1NLJ A;  5EZQ A;  1VSN A;  2JTC A;  4BS5 A;  3RVX A;  2Z84 A;  1QMY A;  1AIM A;  2HWK A;  2FO5 A;  1MS6 A;  3IV2 A;  5KO3 A;  1CV8 A;  1AYU A;  4X6I A;  2R9O A;  4OEL A;  1HUC B;  1YK8 A;  4OVZ A;  2BTW B;  2DC9 A;  2IPP B;  1ME3 A;  4N8W A;  2GFO A;  3PRM A;  3V6C A;  4WUR A;  5CVM A;  6PAD A;  2AGA A;  2OP3 A;  4QBB A;  3RVW A;  2CB5 A;  2E03 A;  2HH5 A;  2YJ9 A;  4PT5 A;  2G6D A;  2BTW A;  1F2B A;  5CVN B;  4D8E A;  4DMX A;  1QXP A;  4W5B A;  3N3G A;  4YVA A;  2R9C A;  4X6H A;  2R6N A;  1Y08 A;  4P6G A;  4R3D A;  4RF1 A;  1NB5 A;  2FQ9 A;  5K16 A;  3B21 A;  4AXM A;  2PAD A;  5CHT A;  1GCB A;  4REZ A;  4CDC B;  3N3K A;  1TL9 A;  1NPZ A;  2YJ8 A;  3KWB X;  1DEU A;  1ZCM A;  2AUZ A;  7PCK A;  1M6D A;  3AI8 A;  1NL6 A;  2E01 A;  4QRV A;  2AYN A;  2AU1 A;  1ME4 A;  4I04 A;  3BCN A;  4IP3 A;  1ITO A;  1NB3 A;  2DC6 A;  1CVZ A;  1FH0 A;  5JH3 A;  1Q6K A;  1F2A A;  4RNA A;  1YVB A;  2G7Y A;  2WBF X;  1EWO A;  4YYU A;  1SP4 B;  2AVW A;  2VHS A;  3HWN A;  2FT2 A;  3IUT A;  4RY2 A;  3PT2 A;  4MSX A;  4CDD B;  4BOS A;  3E9S A;  3IMA A;  4QH6 A;  3V6E A;  3F5V A;  1U9X A;  1A6R A;  1BY8 A;  3PNR A;  2DCC A;  3DF0 A;  3KW9 A;  5E6J A;  1GEC E;  4ZTB A;  2AS8 A;  2ATO A;  3BBA A;  2FTD A;  2UZJ A;  4ZUX U;  4I05 A;  2DJG B;  2VHF A;  1PPD A;  2R9N A;  1AYV A;  3F75 A;  1QOL A;  3K9M A;  4Q8H A;  1NQC A;  4QRX A;  2DCA A;  4K7C A;  3RVV A;  2C0Y A;  3WXE A;  2IBI A;  4I07 A;  1UKF A;  2H7J A;  1KFX L;  1EWL A;  3IFU A;  1PIP A;  4N4Z A;  5FPW A;  5EZS A;  2Y5B A;  2BU3 A;  3ERV A;  1F29 A;  1AU3 A;  1EWM A;  3OF9 A;  3HD3 A;  2DC8 A;  3I3T A;  1X9Y A;  3PRP A;  3QSD A;  2DJF B;  3BPM A;  5CVO B;  4W4U A;  1ATK A;  4FJC A;  3LXS A;  3MTN A;  3W31 A;  1CPJ A;  1IWD A;  3RNV A;  1O0E A;  3MTV A;  2FRA A;  2FUD A;  3HHI A;  3CH3 X;  2HXZ A;  1PVJ A;  1MDW A;  1MIR A;  1SNK A;  2Y6E A;  1KHQ A;  1PXV A;  1EWP A;  4PP1 A;  3KSE A;  4OW0 A;  3USV A;  3GCB A;  2NQI A;  4XUI A;  2FE8 A;  2P7U A;  1U5I A;  2BDL A;  3ZUA A;  2YJB A;  3QJ3 A;  2JRI A;  2DZZ A;  3K8U A;  3B79 A;  4CDE B;  4YYS A;  1STF E;  4OEM A;  4N79 A;  1DKI A;  1ICF A;  3E1Z B;  4AXL A;  4BS6 A;  2XU5 A;  2FRQ A;  1U9W A;  2P86 A;  4MZS A;  1K3B B;  2AIM A;  2J7Q A;  4KLB A;  3I06 A;  3PHU A;  1TLO A;  3KKU A;  1F2C A;  4BOZ A;  1CSB B;  2E00 A;  1GLO A;  3BPF A;  1PAD A;  5F02 A;  4MI7 A;  3H89 A;  1YAL A;  1AEC A;  4D8B A;  1AU0 A;  2O6X A;  1BQI A;  1YT7 A;  2XU3 A;  2AYO A;  1EF7 A;  3CBJ A;  1AU2 A;  1MHW A;  4P16 A;  3MHS A;  4FIP A;  1S4V A;  3WXG A;  4BOP A;  1PBH A;  4DMY A;  1Y4H A;  8PCH A;  2JQF R;  3C9E A;  1CS8 A;  2XU1 A;  2YJC A;  4GUA A;  2B1M A;  4BPV A;  4G54 A;  3BWK A;  2F7D A;  5CHV A;  3M99 A;  4FK5 A;  3P5V A;  2F1G A;  2BDZ A;  4X6J A;  2PRE A;  3PHW A;  3OVX A;  1KXR A;  3TRK A;  3KWZ A;  3H7D A;  3CH2 X;  3KFQ A;  1POP A;  4PAD A;  3W30 A;  1AYW A;  4PI3 A;  3WXF A;  2ACT A;  1PPP A;  1KHP A;  1ZIV A;  5EF4 A; 
#chains in the Genus database with same CATH homology
 3BC3 A;  1U9Q X;  4BSQ A;  2P0R A;  4HWY A;  1THE A;  2CIO A;  2G8J A;  1CB5 A;  1MEG A;  1BP4 A;  3O0U A;  4YV8 A;  3U8E A;  2AUX A;  3IOQ A;  4CDF B;  3QT4 A;  4BQV A;  3P5X A;  3NHE A;  1PE6 A;  1JQP A;  2BSZ A;  2PBH A;  2G8E A;  2DZY A;  2B1N A;  4GUZ A;  2NQA A;  2DC7 A;  2HHN A;  3LFY A;  1VJV A;  2E02 A;  3IEJ A;  2DCD A;  1PPN A;  4Q8G A;  4CZW A;  2XU4 A;  1PCI A;  3P5W A;  2VFC A;  3S3R A;  4YYW A;  5EGW A;  1PPO A;  3HHA A;  3H8C A;  1QDQ A;  1YK7 A;  3K24 A;  4XR7 A;  1TU6 A;  3N4C A;  2HD5 A;  2PNS A;  3D6S A;  2NQD B;  3OVZ A;  3O1G A;  1CJL A;  1GMY A;  4P6E A;  1BGO A;  2DCB A;  3BOW A;  2YJ2 A;  5JA7 A;  4NV7 A;  1DF0 A;  2GHU A;  3PW3 A;  4BGF A;  4QRG A;  5PAD A;  2OUL A;  1KFU L;  3H6S A;  1CTE A;  3LTW A;  4PP2 E;  2OZ2 A;  1W5R A;  1CQD A;  2R9F A;  5J94 A;  1XKG A;  3PBH A;  4WA6 A;  1MEM A;  3MHH A;  4NV8 A;  4YYQ A;  9PAP A;  3TNX A;  3H8B A;  1AU4 A;  4MZO A;  3PDF A;  3S3Q A;  4W5C A;  3OF8 A;  3CBK A;  2ARY A;  2R9M A;  2JQG R;  3OIS A;  3KX1 A;  4YYR A;  3IHP A;  5A24 A;  3P5U A;  3MOR A;  1U9V A;  2FYE A;  4YYV A;  2NQG A;  1NLJ A;  1VSN A;  4BS5 A;  3RVX A;  1QMY A;  1AIM A;  2FO5 A;  1MS6 A;  3IV2 A;  1CV8 A;  1AYU A;  4X6I A;  2R9O A;  4OEL A;  1HUC B;  1YK8 A;  2DC9 A;  2IPP B;  1ME3 A;  4N8W A;  2GFO A;  3V6C A;  5CVM A;  6PAD A;  2OP3 A;  4QBB A;  3RVW A;  2CB5 A;  2E03 A;  2HH5 A;  2YJ9 A;  2G6D A;  1F2B A;  5CVN B;  1E2T A;  4DMX A;  1QXP A;  4W5B A;  3N3G A;  4YVA A;  2R9C A;  4X6H A;  2R6N A;  1Y08 A;  4P6G A;  1NB5 A;  2FQ9 A;  5K16 A;  4AXM A;  2PAD A;  5CHT A;  1GCB A;  4CDC B;  3N3K A;  1TL9 A;  1NPZ A;  2YJ8 A;  3KWB X;  1DEU A;  1ZCM A;  2AUZ A;  7PCK A;  1M6D A;  3AI8 A;  1NL6 A;  2E01 A;  4QRV A;  2AYN A;  2AU1 A;  1ME4 A;  4I04 A;  3BCN A;  1ITO A;  1NB3 A;  2DC6 A;  1CVZ A;  1FH0 A;  5JH3 A;  1Q6K A;  1F2A A;  1YVB A;  2G7Y A;  2WBF X;  1EWO A;  4YYU A;  1SP4 B;  2AVW A;  2VHS A;  3D9W A;  3HWN A;  2FT2 A;  3IUT A;  4RY2 A;  4CDD B;  4MSX A;  3IMA A;  4QH6 A;  3V6E A;  3F5V A;  1U9X A;  1A6R A;  1BY8 A;  3PNR A;  2DCC A;  3DF0 A;  3KW9 A;  1GEC E;  2AS8 A;  2ATO A;  2FTD A;  4ZUX U;  4I05 A;  2DJG B;  2VHF A;  1PPD A;  2R9N A;  1AYV A;  3F75 A;  1QOL A;  3K9M A;  4Q8H A;  1NQC A;  4QRX A;  2DCA A;  4K7C A;  3RVV A;  2C0Y A;  3WXE A;  2IBI A;  4I07 A;  2H7J A;  1KFX L;  1EWL A;  1PIP A;  4N4Z A;  5FPW A;  4C5P A;  2Y5B A;  3ERV A;  1F29 A;  1AU3 A;  1EWM A;  3OF9 A;  3HD3 A;  2DC8 A;  3I3T A;  1X9Y A;  3QSD A;  2DJF B;  3BPM A;  5CVO B;  4W4U A;  1ATK A;  4FJC A;  3LXS A;  3MTN A;  1CPJ A;  1IWD A;  1O0E A;  2FRA A;  2FUD A;  3HHI A;  3CH3 X;  2HXZ A;  1MDW A;  1MIR A;  1SNK A;  2Y6E A;  1KHQ A;  1PXV A;  1EWP A;  4PP1 A;  3KSE A;  3USV A;  3GCB A;  2NQI A;  4XUI A;  2P7U A;  1U5I A;  2BDL A;  3ZUA A;  1W6F A;  2YJB A;  1W4T A;  3QJ3 A;  1GX3 A;  2DZZ A;  3K8U A;  3B79 A;  4CDE B;  4YYS A;  1STF E;  4B55 A;  4OEM A;  4N79 A;  1ICF A;  3E1Z B;  4AXL A;  4BS6 A;  2XU5 A;  2FRQ A;  1U9W A;  2P86 A;  4MZS A;  1K3B B;  2AIM A;  4KLB A;  3I06 A;  1TLO A;  3KKU A;  1F2C A;  1CSB B;  2E00 A;  1GLO A;  3BPF A;  1PAD A;  5F02 A;  3H89 A;  1YAL A;  1AEC A;  1AU0 A;  2O6X A;  1BQI A;  1YT7 A;  2XU3 A;  2AYO A;  1EF7 A;  3CBJ A;  1AU2 A;  1MHW A;  3MHS A;  4FIP A;  1S4V A;  3WXG A;  4DMY A;  1PBH A;  1Y4H A;  8PCH A;  2JQF R;  3C9E A;  1CS8 A;  2XU1 A;  2YJC A;  2B1M A;  4BPV A;  4G54 A;  3BWK A;  2F7D A;  5CHV A;  3M99 A;  4FK5 A;  3P5V A;  2F1G A;  2BDZ A;  4X6J A;  2PRE A;  3OVX A;  1KXR A;  3KWZ A;  3H7D A;  3CH2 X;  3KFQ A;  1POP A;  4PAD A;  2VFB A;  1AYW A;  4PI3 A;  3WXF A;  2ACT A;  1PPP A;  1KHP A;  1ZIV A;  5EF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...