1Q6KA

Cathepsin k complexed with t-butyl(1s)-1-cyclohexyl-2-oxoethylcarbamate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Exploration of the P1 SAR of aldehyde cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1q6kA00
1ATKA 1NL6A 3H7DA 1PIPA 1GLOA 2IPPB 4W5CA 1EWPA 4YYQA 1EF7A 3D6SA 3CH2X 5K16A 3LXSA 1YALA 3OF9A 1NPZA 1YK8A 3BWKA 3IEJA 1PE6A 3WXFA 1O0EA 1YVBA 2R9CA 2NQGA 3P5XA 3HHAA 4P6EA 1ME4A 2PNSA 2P7UA 1CS8A 2R9NA 4MZOA 5J94A 2GHUA 1SP4B 2HXZA 1TL9A 2E00A 1AIMA 2CIOA 2OP3A 2DZZA 3QSDA 3K8UA 1POPA 3O0UA 1KXRA 4HWYA 1K3BB 2DJGB 1F29A 2PBHA 1EWLA 1AU2A 2AS8A 4X6IA 5CVNB 5JH3A 3KFQA 2ATOA 4CZWA 2FYEA 2F7DA 1VSNA 3QJ3A 1GMYA 3KX1A 1NQCA 4CDEB 4CDCB 1ICFA 4QRVA 3V6CA 1F2AA 1PPOA 5A24A 2G6DA 2OZ2A 3TNXA 4W4UA 3ZUAA 1ZIVA 2Y6EA 2DCBA 4BS6A 2B1MA 4K7CA 1SNKA 1MS6A 2DCDA 2G7YA 3S3RA 1YT7A 3AI8A 3MTNA 1THEA 1CSBB 4KLBA 2VHSA 2AIMA 4AXMA 4XR7A 3H8BA 3I3TA 1KFXL 1Y08A 2R9MA 3IMAA 3CBJA 2E01A 4PI3A 3RVWA 3OVZA 1U9XA 1BY8A 2AYNA 4RY2A 3HD3A 1HUCB 1KHPA 3CBKA 1PPNA 3OVXA 2DC8A 4G54A 2FQ9A 3PDFA 5F02A 4FJCA 1PXVA 4N79A 2CB5A 1MHWA 3DF0A 3NHEA 2IBIA 2DCCA 1A6RA 1GECE 4I05A 4W5BA 1CV8A 4MZSA 2P0RA 4YYVA 3N3GA 1ZCMA 3RVVA 1PCIA 2Y5BA 2NQIA 3P5UA 2AUZA 1NB5A 3PW3A 2FT2A 2ACTA 1CB5A 1IWDA 1MEGA 2WBFX 4BQVA 2G8JA 2G8EA 2B1NA 1TLOA 2YJ2A 2E03A 2XU3A 4QBBA 1JQPA 2NQDB 2PADA 1ME3A 3H89A 2O6XA 5FPWA 8PCHA 6PADA 3K24A 1AECA 2DZYA 2H7JA 4FK5A 1QOLA 1CVZA 1BGOA 2AUXA 3MORA 1DF0A 1FH0A 4DMYA 2R9FA 3P5VA 3F75A 4WA6A 4PADA 3HHIA 1AYWA 2NQAA 1Y4HA 2HH5A 1PPPA 1MIRA 2FRAA 1CQDA 1AYUA 3HWNA 3OF8A 2FRQA 5CHTA 1AU0A 2YJCA 1PPDA 2DC7A 3WXEA 4MSXA 1U9WA 3BPFA 4AXLA 2DC9A 4YYRA 1U5IA 2BDLA 1S4VA 2AYOA 3PBHA 2R6NA 3USVA 3B79A 3KWZA 3IOQA 1Q6KA 1U9VA 3BC3A 2JQFR 4QRGA 4QH6A 1KFUL 2YJ8A 1AU3A 3WXGA 1CJLA 1VJVA 2FUDA 3K9MA 4YYUA 4BSQA 1YK7A 3IV2A 1XKGA 2OULA 3O1GA 1CTEA 3H8CA 3C9EA 1U9QX 1F2BA 4BS5A 2YJ9A 4YVAA 4YYWA 2FTDA 4CDFB 3KSEA 3BPMA 9PAPA 3U8EA 4DMXA 4YYSA 4XUIA 2DCAA 4Q8HA 2AU1A 4Q8GA 3LFYA 4I07A 3I06A 1PBHA 3MHHA 1NB3A 4X6HA 2P86A 3BCNA 2HD5A 3PNRA 1EWMA 1F2CA 2XU4A 2GFOA 3OISA 2YJBA 1ITOA 2C0YA 3GCBA 1QXPA 1M6DA 5JA7A 4FIPA 1DEUA 2XU1A 5PADA 1PADA 2JQGR 1AU4A 1CPJA 2DC6A 3KWBX 4OELA 2AVWA 3ERVA 3M99A 7PCKA 3MHSA 1EWOA 1TU6A 1GCBA 3V6EA 1AYVA 3N3KA 4N4ZA 3P5WA 3RVXA 1KHQA 1STFE 4QRXA 3QT4A 4CDDB 3E1ZB 1MDWA 3S3QA 1X9YA 4PP2E 1QDQA 5CVOB 4BPVA 1QMYA 1BQIA 2XU5A 4N8WA 4YV8A 3IHPA 3BOWA 4OEMA 1BP4A 2HHNA 2R9OA 4P6GA 1NLJA 5CHVA 2E02A 5EF4A 4I04A 2DJFB 3CH3X 2VHFA 1MEMA 4ZUXU 3IUTA 3H6SA 5CVMA 2ARYA 2BDZA 2F1GA 3N4CA 3KKUA 2FO5A 3KW9A 4PP1A 4X6JA 2PREA 3F5VA 5EGWA
chains in the Genus database with same CATH superfamily
1ATKA 1NL6A 3H7DA 1PIPA 1GLOA 2IPPB 4W5CA 1EWPA 4YYQA 3PRMA 4RKXA 3OQCA 1EF7A 3D6SA 2AGAA 3CH2X 5K16A 3LXSA 5KO3A 1YALA 3OF9A 1NPZA 4BOPA 1YK8A 3BWKA 3IEJA 1PE6A 3WXFA 1O0EA 1YVBA 2R9CA 2NQGA 3P5XA 3HHAA 1DKIA 4P6EA 1ME4A 2PNSA 2P7UA 1CS8A 2R9NA 4MZOA 5J94A 2GHUA 1SP4B 2HXZA 1TL9A 2E00A 1AIMA 2CIOA 2OP3A 2DZZA 3QSDA 3K8UA 1POPA 3O0UA 1KXRA 4HWYA 1K3BB 2DJGB 4BOUA 1F29A 2PBHA 1EWLA 1AU2A 2AS8A 2J7QC 3MP2A 4X6IA 5CVNB 3BY4A 5JH3A 3KFQA 4PT5A 2ATOA 4CZWA 2FYEA 2F7DA 2BTWB 1VSNA 3PHXA 4HXDB 3QJ3A 1GMYA 3KX1A 1NQCA 4CDEB 4CDCB 4A5UA 1ICFA 4QRVA 3V6CA 1F2AA 1PPOA 4D8IA 5A24A 4BOQA 2G6DA 2OZ2A 3TNXA 4W4UA 4BOZA 3ZUAA 1ZIVA 4OVZA 2Y6EA 2DCBA 4BS6A 2B1MA 4K7CA 1SNKA 1MS6A 2JRIA 2DCDA 2G7YA 3S3RA 1YT7A 3AI8A 3MTNA 1THEA 1CSBB 4KLBA 4MM3B 2VHSA 2AIMA 4AXMA 4XR7A 3H8BA 3I3TA 1KFXL 5EZSA 1Y08A 2R9MA 3IMAA 3CBJA 2E01A 4PI3A 4D8BA 4GUAA 3OVZA 3RVWA 1U9XA 5E6JA 3PRPA 1BY8A 2AYNA 4RY2A 3HD3A 1HUCB 1KHPA 3CBKA 1PPNA 3OVXA 2DC8A 4G54A 2FQ9A 3PDFA 5F02A 4FJCA 1PXVA 4N79A 2CB5A 1MHWA 3DF0A 2FE8A 3NHEA 2IBIA 2DCCA 1A6RA 1GECE 4I05A 4W5BA 1CV8A 4MZSA 2P0RA 4YYVA 3MJ5A 3N3GA 1ZCMA 4M0WA 3RVVA 1PCIA 2Y5BA 2NQIA 3P5UA 2AUZA 1NB5A 2JTCA 3PW3A 2FT2A 2ACTA 1PVJA 1CB5A 1IWDA 3PHUA 1MEGA 3ZNHA 4BOSA 2WBFX 4BQVA 2G8JA 2G8EA 2B1NA 1TLOA 2YJ2A 2E03A 2XU3A 4QBBA 1JQPA 2NQDB 2PADA 4D8EA 1ME3A 3H89A 2O6XA 4RF1A 5FPWA 8PCHA 6PADA 3K24A 1AECA 2DOSA 2DZYA 3PHWA 2H7JA 4FK5A 1QOLA 1CVZA 2J7QA 3MTVA 1BGOA 2AUXA 3MORA 1DF0A 1FH0A 4DMYA 4IP3A 3O65A 2R9FA 3P5VA 3F75A 4WA6A 4PADA 3HHIA 4REZA 1AYWA 3B21A 2NQAA 1Y4HA 4P16A 4OW0A 2HH5A 4RF0A 1PPPA 1MIRA 2FRAA 1CQDA 5JZEA 1AYUA 3HWNA 3OF8A 2FRQA 5CHTA 1AU0A 2YJCA 1PPDA 2DC7A 3W30A 3WXEA 4MSXA 3IFUA 1U9WA 3BPFA 4AXLA 2DC9A 4YYRA 1U5IA 2BDLA 1S4VA 2AYOA 3PBHA 2R6NA 3USVA 3B79A 3KWZA 3IOQA 1Q6KA 1U9VA 3BC3A 2JQFR 4QRGA 4QH6A 1KFUL 2YJ8A 1AU3A 4OVZB 3E9SA 1CJLA 3WXGA 1VJVA 4MI7A 2FUDA 3K9MA 4YYUA 4BSQA 1YK7A 3IV2A 1XKGA 2OULA 3O1GA 1CTEA 3H8CA 3C9EA 1U9QX 1F2BA 4BS5A 2YJ9A 4YVAA 4YYWA 2FTDA 4CDFB 2BU3A 3KSEA 3BPMA 3PSEA 9PAPA 3U8EA 4RNAA 4DMXA 4YYSA 4XUIA 2DCAA 4Q8HA 2AU1A 4Q8GA 3LFYA 4I07A 3C0RA 3I06A 1PBHA 3MHHA 1NB3A 4X6HA 2P86A 2BTWA 2HD5A 3BCNA 3PNRA 1EWMA 1F2CA 2XU4A 3RNVA 2GFOA 3OISA 2Z84A 1UKFA 2YJBA 1ITOA 2C0YA 3GCBA 1QXPA 3TMPA 1M6DA 5JA7A 4FIPA 1YZBA 1DEUA 2XU1A 4IUMA 5PADA 1PADA 2JQGR 1AU4A 1CPJA 2DC6A 3KWBX 4OELA 2AVWA 3ERVA 3M99A 7PCKA 4WURA 3MHSA 1EWOA 1TU6A 1GCBA 3V6EA 1AYVA 3N3KA 4N4ZA 3P5WA 3RVXA 1KHQA 1STFE 4QRXA 3QT4A 4CDDB 3E1ZB 3PT2A 2UZJA 1MDWA 3S3QA 1X9YA 4PP2E 3TRKA 1QDQA 5CVOB 4BPVA 1QMYA 1BQIA 2XU5A 4N8WA 4YV8A 3IHPA 5EZQA 3BOWA 4OEMA 1BP4A 2HHNA 2R9OA 4P6GA 1NLJA 5CHVA 2E02A 5EF4A 4I04A 2DJFB 3CH3X 2VHFA 3BBAA 1MEMA 4ZTBA 3W31A 3BB7A 4XZXA 4ZUXU 3IUTA 3H6SA 5CVMA 2ARYA 2BDZA 2F1GA 3N4CA 4R3DA 3KKUA 2FO5A 3KW9A 4PP1A 4X6JA 2HWKA 2PREA 3F5VA 5EGWA
chains in the Genus database with same CATH topology
1ATKA 1NL6A 3H7DA 1PIPA 1GLOA 2IPPB 4W5CA 1EWPA 4YYQA 1EF7A 3D6SA 3CH2X 5K16A 3LXSA 1YALA 3OF9A 1NPZA 1YK8A 3BWKA 3IEJA 1PE6A 3WXFA 1O0EA 1YVBA 2R9CA 2NQGA 3P5XA 4C5PA 3HHAA 4P6EA 4GUZA 1ME4A 2PNSA 2P7UA 1CS8A 2R9NA 4MZOA 5J94A 2GHUA 1SP4B 2HXZA 1TL9A 1GX3A 2E00A 1AIMA 2CIOA 2OP3A 2DZZA 3QSDA 3K8UA 1POPA 3O0UA 1KXRA 4HWYA 1K3BB 2DJGB 1F29A 2PBHA 1EWLA 1AU2A 2AS8A 4X6IA 5CVNB 5JH3A 3KFQA 2ATOA 4CZWA 2FYEA 2F7DA 1VSNA 3QJ3A 1GMYA 3KX1A 1NQCA 4CDEB 4CDCB 1ICFA 4QRVA 3V6CA 1F2AA 1PPOA 5A24A 2G6DA 2OZ2A 3TNXA 4W4UA 3ZUAA 1ZIVA 2Y6EA 2DCBA 4BS6A 2B1MA 4K7CA 1SNKA 1MS6A 2DCDA 2G7YA 3S3RA 1YT7A 3AI8A 3MTNA 1W6FA 1THEA 1CSBB 4KLBA 2VHSA 2AIMA 4AXMA 4XR7A 3H8BA 3I3TA 1KFXL 1Y08A 2R9MA 3IMAA 3CBJA 2E01A 4PI3A 3RVWA 3OVZA 1U9XA 4B55A 1BY8A 2AYNA 4RY2A 3HD3A 1HUCB 1KHPA 3CBKA 1PPNA 3OVXA 2DC8A 4G54A 2FQ9A 3PDFA 5F02A 4FJCA 1PXVA 1W5RA 4N79A 2CB5A 1MHWA 3DF0A 3NHEA 2IBIA 2DCCA 1A6RA 1GECE 4I05A 4W5BA 1CV8A 4MZSA 2P0RA 4YYVA 3N3GA 1ZCMA 3RVVA 1PCIA 2Y5BA 2NQIA 3P5UA 2AUZA 1NB5A 3PW3A 2FT2A 2ACTA 1CB5A 1IWDA 1MEGA 2WBFX 4BQVA 2G8JA 2G8EA 2B1NA 1TLOA 2YJ2A 2E03A 2XU3A 4QBBA 1JQPA 2NQDB 2PADA 1ME3A 3H89A 2O6XA 5FPWA 8PCHA 6PADA 3K24A 1AECA 2DZYA 2H7JA 4FK5A 1QOLA 1CVZA 1BGOA 2AUXA 3MORA 1DF0A 1FH0A 4DMYA 2R9FA 3P5VA 3F75A 4WA6A 4PADA 3HHIA 1AYWA 4BGFA 2NQAA 1Y4HA 2VFBA 2HH5A 1PPPA 1MIRA 2FRAA 1CQDA 1AYUA 3HWNA 3OF8A 2FRQA 5CHTA 1AU0A 2YJCA 1PPDA 2DC7A 3WXEA 4MSXA 1U9WA 3BPFA 4AXLA 2DC9A 4YYRA 1U5IA 2BDLA 1S4VA 2AYOA 3PBHA 2R6NA 3USVA 3B79A 3KWZA 3IOQA 1Q6KA 1U9VA 3BC3A 2JQFR 4QRGA 4QH6A 3D9WA 1KFUL 2YJ8A 1AU3A 3WXGA 1CJLA 1VJVA 2FUDA 3K9MA 4YYUA 4BSQA 1YK7A 3IV2A 1XKGA 2OULA 3O1GA 1CTEA 3H8CA 3C9EA 1U9QX 1F2BA 4BS5A 2YJ9A 4YVAA 4YYWA 2FTDA 4CDFB 3KSEA 3BPMA 9PAPA 3U8EA 4DMXA 3LTWA 4YYSA 4XUIA 2DCAA 4Q8HA 1E2TA 2AU1A 4Q8GA 3LFYA 4I07A 3I06A 1PBHA 3MHHA 1NB3A 4X6HA 2P86A 3BCNA 2HD5A 3PNRA 1EWMA 4NV7A 1F2CA 2XU4A 2GFOA 3OISA 2YJBA 1ITOA 2C0YA 3GCBA 1QXPA 1M6DA 1W4TA 5JA7A 4FIPA 1DEUA 2XU1A 5PADA 1PADA 2JQGR 1AU4A 1CPJA 2DC6A 3KWBX 4OELA 2AVWA 3ERVA 3M99A 7PCKA 3MHSA 1EWOA 1TU6A 1GCBA 3V6EA 1AYVA 3N3KA 4N4ZA 2VFCA 3P5WA 3RVXA 1KHQA 1STFE 4QRXA 4NV8A 3QT4A 4CDDB 3E1ZB 1MDWA 3S3QA 1X9YA 4PP2E 1QDQA 5CVOB 4BPVA 1QMYA 1BQIA 2XU5A 4N8WA 4YV8A 3IHPA 3BOWA 4OEMA 1BP4A 2HHNA 2R9OA 4P6GA 1NLJA 5CHVA 2E02A 5EF4A 4I04A 2DJFB 3CH3X 2VHFA 2BSZA 1MEMA 4ZUXU 3IUTA 3H6SA 5CVMA 2ARYA 2BDZA 2F1GA 3N4CA 3KKUA 2FO5A 3KW9A 4PP1A 4X6JA 2PREA 3F5VA 5EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATK A;  1NL6 A;  3H7D A;  1PIP A;  1GLO A;  2IPP B;  4W5C A;  1EWP A;  4YYQ A;  1EF7 A;  3D6S A;  3CH2 X;  5K16 A;  3LXS A;  1YAL A;  3OF9 A;  1NPZ A;  1YK8 A;  3BWK A;  3IEJ A;  1PE6 A;  3WXF A;  1O0E A;  1YVB A;  2R9C A;  2NQG A;  3P5X A;  3HHA A;  4P6E A;  1ME4 A;  2PNS A;  2P7U A;  1CS8 A;  2R9N A;  4MZO A;  5J94 A;  2GHU A;  1SP4 B;  2HXZ A;  1TL9 A;  2E00 A;  1AIM A;  2CIO A;  2OP3 A;  2DZZ A;  3QSD A;  3K8U A;  1POP A;  3O0U A;  1KXR A;  4HWY A;  1K3B B;  2DJG B;  1F29 A;  2PBH A;  1EWL A;  1AU2 A;  2AS8 A;  4X6I A;  5CVN B;  5JH3 A;  3KFQ A;  2ATO A;  4CZW A;  2FYE A;  2F7D A;  1VSN A;  3QJ3 A;  1GMY A;  3KX1 A;  1NQC A;  4CDE B;  4CDC B;  1ICF A;  4QRV A;  3V6C A;  1F2A A;  1PPO A;  5A24 A;  2G6D A;  2OZ2 A;  3TNX A;  4W4U A;  3ZUA A;  1ZIV A;  2Y6E A;  2DCB A;  4BS6 A;  2B1M A;  4K7C A;  1SNK A;  1MS6 A;  2DCD A;  2G7Y A;  3S3R A;  1YT7 A;  3AI8 A;  3MTN A;  1THE A;  1CSB B;  4KLB A;  2VHS A;  2AIM A;  4AXM A;  4XR7 A;  3H8B A;  3I3T A;  1KFX L;  1Y08 A;  2R9M A;  3IMA A;  3CBJ A;  2E01 A;  4PI3 A;  3RVW A;  3OVZ A;  1U9X A;  1BY8 A;  2AYN A;  4RY2 A;  3HD3 A;  1HUC B;  1KHP A;  3CBK A;  1PPN A;  3OVX A;  2DC8 A;  4G54 A;  2FQ9 A;  3PDF A;  5F02 A;  4FJC A;  1PXV A;  4N79 A;  2CB5 A;  1MHW A;  3DF0 A;  3NHE A;  2IBI A;  2DCC A;  1A6R A;  1GEC E;  4I05 A;  4W5B A;  1CV8 A;  4MZS A;  2P0R A;  4YYV A;  3N3G A;  1ZCM A;  3RVV A;  1PCI A;  2Y5B A;  2NQI A;  3P5U A;  2AUZ A;  1NB5 A;  3PW3 A;  2FT2 A;  2ACT A;  1CB5 A;  1IWD A;  1MEG A;  2WBF X;  4BQV A;  2G8J A;  2G8E A;  2B1N A;  1TLO A;  2YJ2 A;  2E03 A;  2XU3 A;  4QBB A;  1JQP A;  2NQD B;  2PAD A;  1ME3 A;  3H89 A;  2O6X A;  5FPW A;  8PCH A;  6PAD A;  3K24 A;  1AEC A;  2DZY A;  2H7J A;  4FK5 A;  1QOL A;  1CVZ A;  1BGO A;  2AUX A;  3MOR A;  1DF0 A;  1FH0 A;  4DMY A;  2R9F A;  3P5V A;  3F75 A;  4WA6 A;  4PAD A;  3HHI A;  1AYW A;  2NQA A;  1Y4H A;  2HH5 A;  1PPP A;  1MIR A;  2FRA A;  1CQD A;  1AYU A;  3HWN A;  3OF8 A;  2FRQ A;  5CHT A;  1AU0 A;  2YJC A;  1PPD A;  2DC7 A;  3WXE A;  4MSX A;  1U9W A;  3BPF A;  4AXL A;  2DC9 A;  4YYR A;  1U5I A;  2BDL A;  1S4V A;  2AYO A;  3PBH A;  2R6N A;  3USV A;  3B79 A;  3KWZ A;  3IOQ A;  1Q6K A;  1U9V A;  3BC3 A;  2JQF R;  4QRG A;  4QH6 A;  1KFU L;  2YJ8 A;  1AU3 A;  3WXG A;  1CJL A;  1VJV A;  2FUD A;  3K9M A;  4YYU A;  4BSQ A;  1YK7 A;  3IV2 A;  1XKG A;  2OUL A;  3O1G A;  1CTE A;  3H8C A;  3C9E A;  1U9Q X;  1F2B A;  4BS5 A;  2YJ9 A;  4YVA A;  4YYW A;  2FTD A;  4CDF B;  3KSE A;  3BPM A;  9PAP A;  3U8E A;  4DMX A;  4YYS A;  4XUI A;  2DCA A;  4Q8H A;  2AU1 A;  4Q8G A;  3LFY A;  4I07 A;  3I06 A;  1PBH A;  3MHH A;  1NB3 A;  4X6H A;  2P86 A;  3BCN A;  2HD5 A;  3PNR A;  1EWM A;  1F2C A;  2XU4 A;  2GFO A;  3OIS A;  2YJB A;  1ITO A;  2C0Y A;  3GCB A;  1QXP A;  1M6D A;  5JA7 A;  4FIP A;  1DEU A;  2XU1 A;  5PAD A;  1PAD A;  2JQG R;  1AU4 A;  1CPJ A;  2DC6 A;  3KWB X;  4OEL A;  2AVW A;  3ERV A;  3M99 A;  7PCK A;  3MHS A;  1EWO A;  1TU6 A;  1GCB A;  3V6E A;  1AYV A;  3N3K A;  4N4Z A;  3P5W A;  3RVX A;  1KHQ A;  1STF E;  4QRX A;  3QT4 A;  4CDD B;  3E1Z B;  1MDW A;  3S3Q A;  1X9Y A;  4PP2 E;  1QDQ A;  5CVO B;  4BPV A;  1QMY A;  1BQI A;  2XU5 A;  4N8W A;  4YV8 A;  3IHP A;  3BOW A;  4OEM A;  1BP4 A;  2HHN A;  2R9O A;  4P6G A;  1NLJ A;  5CHV A;  2E02 A;  5EF4 A;  4I04 A;  2DJF B;  3CH3 X;  2VHF A;  1MEM A;  4ZUX U;  3IUT A;  3H6S A;  5CVM A;  2ARY A;  2BDZ A;  2F1G A;  3N4C A;  3KKU A;  2FO5 A;  3KW9 A;  4PP1 A;  4X6J A;  2PRE A;  3F5V A;  5EGW A; 
#chains in the Genus database with same CATH topology
 1ATK A;  1NL6 A;  3H7D A;  1PIP A;  1GLO A;  2IPP B;  4W5C A;  1EWP A;  4YYQ A;  3PRM A;  4RKX A;  3OQC A;  1EF7 A;  3D6S A;  2AGA A;  3CH2 X;  5K16 A;  3LXS A;  5KO3 A;  1YAL A;  3OF9 A;  1NPZ A;  4BOP A;  1YK8 A;  3BWK A;  3IEJ A;  1PE6 A;  3WXF A;  1O0E A;  1YVB A;  2R9C A;  2NQG A;  3P5X A;  3HHA A;  1DKI A;  4P6E A;  1ME4 A;  2PNS A;  2P7U A;  1CS8 A;  2R9N A;  4MZO A;  5J94 A;  2GHU A;  1SP4 B;  2HXZ A;  1TL9 A;  2E00 A;  1AIM A;  2CIO A;  2OP3 A;  2DZZ A;  3QSD A;  3K8U A;  1POP A;  3O0U A;  1KXR A;  4HWY A;  1K3B B;  2DJG B;  4BOU A;  1F29 A;  2PBH A;  1EWL A;  1AU2 A;  2AS8 A;  2J7Q C;  3MP2 A;  4X6I A;  5CVN B;  3BY4 A;  5JH3 A;  3KFQ A;  4PT5 A;  2ATO A;  4CZW A;  2FYE A;  2F7D A;  2BTW B;  1VSN A;  3PHX A;  4HXD B;  3QJ3 A;  1GMY A;  3KX1 A;  1NQC A;  4CDE B;  4CDC B;  4A5U A;  1ICF A;  4QRV A;  3V6C A;  1F2A A;  1PPO A;  4D8I A;  5A24 A;  4BOQ A;  2G6D A;  2OZ2 A;  3TNX A;  4W4U A;  4BOZ A;  3ZUA A;  1ZIV A;  4OVZ A;  2Y6E A;  2DCB A;  4BS6 A;  2B1M A;  4K7C A;  1SNK A;  1MS6 A;  2JRI A;  2DCD A;  2G7Y A;  3S3R A;  1YT7 A;  3AI8 A;  3MTN A;  1THE A;  1CSB B;  4KLB A;  4MM3 B;  2VHS A;  2AIM A;  4AXM A;  4XR7 A;  3H8B A;  3I3T A;  1KFX L;  5EZS A;  1Y08 A;  2R9M A;  3IMA A;  3CBJ A;  2E01 A;  4PI3 A;  4D8B A;  4GUA A;  3OVZ A;  3RVW A;  1U9X A;  5E6J A;  3PRP A;  1BY8 A;  2AYN A;  4RY2 A;  3HD3 A;  1HUC B;  1KHP A;  3CBK A;  1PPN A;  3OVX A;  2DC8 A;  4G54 A;  2FQ9 A;  3PDF A;  5F02 A;  4FJC A;  1PXV A;  4N79 A;  2CB5 A;  1MHW A;  3DF0 A;  2FE8 A;  3NHE A;  2IBI A;  2DCC A;  1A6R A;  1GEC E;  4I05 A;  4W5B A;  1CV8 A;  4MZS A;  2P0R A;  4YYV A;  3MJ5 A;  3N3G A;  1ZCM A;  4M0W A;  3RVV A;  1PCI A;  2Y5B A;  2NQI A;  3P5U A;  2AUZ A;  1NB5 A;  2JTC A;  3PW3 A;  2FT2 A;  2ACT A;  1PVJ A;  1CB5 A;  1IWD A;  3PHU A;  1MEG A;  3ZNH A;  4BOS A;  2WBF X;  4BQV A;  2G8J A;  2G8E A;  2B1N A;  1TLO A;  2YJ2 A;  2E03 A;  2XU3 A;  4QBB A;  1JQP A;  2NQD B;  2PAD A;  4D8E A;  1ME3 A;  3H89 A;  2O6X A;  4RF1 A;  5FPW A;  8PCH A;  6PAD A;  3K24 A;  1AEC A;  2DOS A;  2DZY A;  3PHW A;  2H7J A;  4FK5 A;  1QOL A;  1CVZ A;  2J7Q A;  3MTV A;  1BGO A;  2AUX A;  3MOR A;  1DF0 A;  1FH0 A;  4DMY A;  4IP3 A;  3O65 A;  2R9F A;  3P5V A;  3F75 A;  4WA6 A;  4PAD A;  3HHI A;  4REZ A;  1AYW A;  3B21 A;  2NQA A;  1Y4H A;  4P16 A;  4OW0 A;  2HH5 A;  4RF0 A;  1PPP A;  1MIR A;  2FRA A;  1CQD A;  5JZE A;  1AYU A;  3HWN A;  3OF8 A;  2FRQ A;  5CHT A;  1AU0 A;  2YJC A;  1PPD A;  2DC7 A;  3W30 A;  3WXE A;  4MSX A;  3IFU A;  1U9W A;  3BPF A;  4AXL A;  2DC9 A;  4YYR A;  1U5I A;  2BDL A;  1S4V A;  2AYO A;  3PBH A;  2R6N A;  3USV A;  3B79 A;  3KWZ A;  3IOQ A;  1Q6K A;  1U9V A;  3BC3 A;  2JQF R;  4QRG A;  4QH6 A;  1KFU L;  2YJ8 A;  1AU3 A;  4OVZ B;  3E9S A;  1CJL A;  3WXG A;  1VJV A;  4MI7 A;  2FUD A;  3K9M A;  4YYU A;  4BSQ A;  1YK7 A;  3IV2 A;  1XKG A;  2OUL A;  3O1G A;  1CTE A;  3H8C A;  3C9E A;  1U9Q X;  1F2B A;  4BS5 A;  2YJ9 A;  4YVA A;  4YYW A;  2FTD A;  4CDF B;  2BU3 A;  3KSE A;  3BPM A;  3PSE A;  9PAP A;  3U8E A;  4RNA A;  4DMX A;  4YYS A;  4XUI A;  2DCA A;  4Q8H A;  2AU1 A;  4Q8G A;  3LFY A;  4I07 A;  3C0R A;  3I06 A;  1PBH A;  3MHH A;  1NB3 A;  4X6H A;  2P86 A;  2BTW A;  2HD5 A;  3BCN A;  3PNR A;  1EWM A;  1F2C A;  2XU4 A;  3RNV A;  2GFO A;  3OIS A;  2Z84 A;  1UKF A;  2YJB A;  1ITO A;  2C0Y A;  3GCB A;  1QXP A;  3TMP A;  1M6D A;  5JA7 A;  4FIP A;  1YZB A;  1DEU A;  2XU1 A;  4IUM A;  5PAD A;  1PAD A;  2JQG R;  1AU4 A;  1CPJ A;  2DC6 A;  3KWB X;  4OEL A;  2AVW A;  3ERV A;  3M99 A;  7PCK A;  4WUR A;  3MHS A;  1EWO A;  1TU6 A;  1GCB A;  3V6E A;  1AYV A;  3N3K A;  4N4Z A;  3P5W A;  3RVX A;  1KHQ A;  1STF E;  4QRX A;  3QT4 A;  4CDD B;  3E1Z B;  3PT2 A;  2UZJ A;  1MDW A;  3S3Q A;  1X9Y A;  4PP2 E;  3TRK A;  1QDQ A;  5CVO B;  4BPV A;  1QMY A;  1BQI A;  2XU5 A;  4N8W A;  4YV8 A;  3IHP A;  5EZQ A;  3BOW A;  4OEM A;  1BP4 A;  2HHN A;  2R9O A;  4P6G A;  1NLJ A;  5CHV A;  2E02 A;  5EF4 A;  4I04 A;  2DJF B;  3CH3 X;  2VHF A;  3BBA A;  1MEM A;  4ZTB A;  3W31 A;  3BB7 A;  4XZX A;  4ZUX U;  3IUT A;  3H6S A;  5CVM A;  2ARY A;  2BDZ A;  2F1G A;  3N4C A;  4R3D A;  3KKU A;  2FO5 A;  3KW9 A;  4PP1 A;  4X6J A;  2HWK A;  2PRE A;  3F5V A;  5EGW A; 
#chains in the Genus database with same CATH homology
 1ATK A;  1NL6 A;  3H7D A;  1PIP A;  1GLO A;  2IPP B;  4W5C A;  1EWP A;  4YYQ A;  1EF7 A;  3D6S A;  3CH2 X;  5K16 A;  3LXS A;  1YAL A;  3OF9 A;  1NPZ A;  1YK8 A;  3BWK A;  3IEJ A;  1PE6 A;  3WXF A;  1O0E A;  1YVB A;  2R9C A;  2NQG A;  3P5X A;  4C5P A;  3HHA A;  4P6E A;  4GUZ A;  1ME4 A;  2PNS A;  2P7U A;  1CS8 A;  2R9N A;  4MZO A;  5J94 A;  2GHU A;  1SP4 B;  2HXZ A;  1TL9 A;  1GX3 A;  2E00 A;  1AIM A;  2CIO A;  2OP3 A;  2DZZ A;  3QSD A;  3K8U A;  1POP A;  3O0U A;  1KXR A;  4HWY A;  1K3B B;  2DJG B;  1F29 A;  2PBH A;  1EWL A;  1AU2 A;  2AS8 A;  4X6I A;  5CVN B;  5JH3 A;  3KFQ A;  2ATO A;  4CZW A;  2FYE A;  2F7D A;  1VSN A;  3QJ3 A;  1GMY A;  3KX1 A;  1NQC A;  4CDE B;  4CDC B;  1ICF A;  4QRV A;  3V6C A;  1F2A A;  1PPO A;  5A24 A;  2G6D A;  2OZ2 A;  3TNX A;  4W4U A;  3ZUA A;  1ZIV A;  2Y6E A;  2DCB A;  4BS6 A;  2B1M A;  4K7C A;  1SNK A;  1MS6 A;  2DCD A;  2G7Y A;  3S3R A;  1YT7 A;  3AI8 A;  3MTN A;  1W6F A;  1THE A;  1CSB B;  4KLB A;  2VHS A;  2AIM A;  4AXM A;  4XR7 A;  3H8B A;  3I3T A;  1KFX L;  1Y08 A;  2R9M A;  3IMA A;  3CBJ A;  2E01 A;  4PI3 A;  3RVW A;  3OVZ A;  1U9X A;  4B55 A;  1BY8 A;  2AYN A;  4RY2 A;  3HD3 A;  1HUC B;  1KHP A;  3CBK A;  1PPN A;  3OVX A;  2DC8 A;  4G54 A;  2FQ9 A;  3PDF A;  5F02 A;  4FJC A;  1PXV A;  1W5R A;  4N79 A;  2CB5 A;  1MHW A;  3DF0 A;  3NHE A;  2IBI A;  2DCC A;  1A6R A;  1GEC E;  4I05 A;  4W5B A;  1CV8 A;  4MZS A;  2P0R A;  4YYV A;  3N3G A;  1ZCM A;  3RVV A;  1PCI A;  2Y5B A;  2NQI A;  3P5U A;  2AUZ A;  1NB5 A;  3PW3 A;  2FT2 A;  2ACT A;  1CB5 A;  1IWD A;  1MEG A;  2WBF X;  4BQV A;  2G8J A;  2G8E A;  2B1N A;  1TLO A;  2YJ2 A;  2E03 A;  2XU3 A;  4QBB A;  1JQP A;  2NQD B;  2PAD A;  1ME3 A;  3H89 A;  2O6X A;  5FPW A;  8PCH A;  6PAD A;  3K24 A;  1AEC A;  2DZY A;  2H7J A;  4FK5 A;  1QOL A;  1CVZ A;  1BGO A;  2AUX A;  3MOR A;  1DF0 A;  1FH0 A;  4DMY A;  2R9F A;  3P5V A;  3F75 A;  4WA6 A;  4PAD A;  3HHI A;  1AYW A;  4BGF A;  2NQA A;  1Y4H A;  2VFB A;  2HH5 A;  1PPP A;  1MIR A;  2FRA A;  1CQD A;  1AYU A;  3HWN A;  3OF8 A;  2FRQ A;  5CHT A;  1AU0 A;  2YJC A;  1PPD A;  2DC7 A;  3WXE A;  4MSX A;  1U9W A;  3BPF A;  4AXL A;  2DC9 A;  4YYR A;  1U5I A;  2BDL A;  1S4V A;  2AYO A;  3PBH A;  2R6N A;  3USV A;  3B79 A;  3KWZ A;  3IOQ A;  1Q6K A;  1U9V A;  3BC3 A;  2JQF R;  4QRG A;  4QH6 A;  3D9W A;  1KFU L;  2YJ8 A;  1AU3 A;  3WXG A;  1CJL A;  1VJV A;  2FUD A;  3K9M A;  4YYU A;  4BSQ A;  1YK7 A;  3IV2 A;  1XKG A;  2OUL A;  3O1G A;  1CTE A;  3H8C A;  3C9E A;  1U9Q X;  1F2B A;  4BS5 A;  2YJ9 A;  4YVA A;  4YYW A;  2FTD A;  4CDF B;  3KSE A;  3BPM A;  9PAP A;  3U8E A;  4DMX A;  3LTW A;  4YYS A;  4XUI A;  2DCA A;  4Q8H A;  1E2T A;  2AU1 A;  4Q8G A;  3LFY A;  4I07 A;  3I06 A;  1PBH A;  3MHH A;  1NB3 A;  4X6H A;  2P86 A;  3BCN A;  2HD5 A;  3PNR A;  1EWM A;  4NV7 A;  1F2C A;  2XU4 A;  2GFO A;  3OIS A;  2YJB A;  1ITO A;  2C0Y A;  3GCB A;  1QXP A;  1M6D A;  1W4T A;  5JA7 A;  4FIP A;  1DEU A;  2XU1 A;  5PAD A;  1PAD A;  2JQG R;  1AU4 A;  1CPJ A;  2DC6 A;  3KWB X;  4OEL A;  2AVW A;  3ERV A;  3M99 A;  7PCK A;  3MHS A;  1EWO A;  1TU6 A;  1GCB A;  3V6E A;  1AYV A;  3N3K A;  4N4Z A;  2VFC A;  3P5W A;  3RVX A;  1KHQ A;  1STF E;  4QRX A;  4NV8 A;  3QT4 A;  4CDD B;  3E1Z B;  1MDW A;  3S3Q A;  1X9Y A;  4PP2 E;  1QDQ A;  5CVO B;  4BPV A;  1QMY A;  1BQI A;  2XU5 A;  4N8W A;  4YV8 A;  3IHP A;  3BOW A;  4OEM A;  1BP4 A;  2HHN A;  2R9O A;  4P6G A;  1NLJ A;  5CHV A;  2E02 A;  5EF4 A;  4I04 A;  2DJF B;  3CH3 X;  2VHF A;  2BSZ A;  1MEM A;  4ZUX U;  3IUT A;  3H6S A;  5CVM A;  2ARY A;  2BDZ A;  2F1G A;  3N4C A;  3KKU A;  2FO5 A;  3KW9 A;  4PP1 A;  4X6J A;  2PRE A;  3F5V A;  5EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...