1Q6KA

Cathepsin k complexed with t-butyl(1s)-1-cyclohexyl-2-oxoethylcarbamate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of the P1 SAR of aldehyde cathepsin K inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1q6kA00
4W5BA 2DCBA 4YYQA 1QOLA 2OZ2A 2E00A 3OVXA 4AXLA 2DC7A 2HH5A 2DC9A 4OEMA 1YK7A 5CHVA 4X6JA 3M99A 4YVAA 2O6XA 4BPVA 3P5XA 2JQFR 4CZWA 4BS6A 3KX1A 3S3QA 1CTEA 1NPZA 1YVBA 1PE6A 1YK8A 3K8UA 3MORA 5A24A 1POPA 2DJFB 3P5UA 3QJ3A 1CSBB 2FQ9A 3DF0A 3HHIA 4N8WA 1HUCB 3RVVA 1PPNA 4FK5A 1X9YA 3BPFA 2DC8A 1KHPA 3PW3A 1VSNA 2HXZA 3V6EA 3HD3A 1TL9A 3ZUAA 1AYUA 2AU1A 1QDQA 1PIPA 1GECE 2OULA 1AYWA 4YYSA 1F2AA 3MHSA 2IPPB 4QH6A 1BGOA 3WXEA 4K7CA 1AYVA 3MTNA 3RVXA 1MDWA 1GCBA 5CHTA 1MEMA 2P86A 6PADA 2XU5A 2FT2A 5J94A 1BQIA 3HWNA 2HD5A 1ITOA 1YALA 2PNSA 4Q8GA 2G7YA 1K3BB 3IEJA 2G6DA 1KXRA 1MEGA 2B1MA 2YJ9A 3OVZA 1A6RA 1THEA 5EF4A 4I04A 1U9WA 5K16A 3I06A 2VHSA 3BOWA 1AU2A 2C0YA 2JQGR 4OELA 3IOQA 5CVMA 3WXGA 1KFUL 2XU3A 1PPDA 3P5WA 4CDEB 4MZSA 1PADA 3CBKA 2GHUA 2AYNA 2DCDA 1DEUA 3OISA 5CVNB 3KKUA 4QRXA 2PADA 3CH2X 4BS5A 1MHWA 2B1NA 4XR7A 2E03A 2F7DA 1Y08A 3H89A 4CDCB 2F1GA 2NQGA 2G8EA 1PPPA 4DMXA 3IMAA 2R9CA 2CB5A 2PREA 3C9EA 3O1GA 1NLJA 1VJVA 1ZCMA 1EWLA 2FTDA 1CPJA 4W4UA 2FRAA 3P5VA 5PADA 3N3GA 1IWDA 1FH0A 3OF9A 3B79A 2YJBA 4WA6A 3S3RA 1NQCA 2DZZA 3HHAA 4PP2E 1XKGA 2R9MA 2BDLA 3USVA 3ERVA 1EWPA 2AUXA 1CJLA 3PNRA 4N79A 2IBIA 3N3KA 1DF0A 3F75A 2AS8A 1PBHA 2FYEA 2H7JA 4XUIA 1MIRA 3NHEA 4MZOA 9PAPA 2VHFA 2OP3A 4FIPA 5JA7A 4I07A 1NL6A 5JH3A 1F2CA 1U9QX 3D6SA 3U8EA 1SNKA 1MS6A 3LFYA 3QSDA 8PCHA 1PPOA 1M6DA 3H8CA 5F02A 1YT7A 5CVOB 1ZIVA 2NQIA 3IV2A 1CS8A 1ME3A 3K24A 2BDZA 3BCNA 3BWKA 2DC6A 4YYRA 4W5CA 4QRVA 2NQDB 3MHHA 2G8JA 2E01A 1NB5A 2FO5A 4KLBA 3E1ZB 4PI3A 1CVZA 1U9VA 3IUTA 4P6EA 1SP4B 4CDFB 3TNXA 1Y4HA 4P6GA 1EWMA 2Y5BA 1AIMA 1EF7A 3KW9A 3WXFA 1CQDA 4Q8HA 2DCAA 2E02A 4ZUXU 3PBHA 1AECA 1CB5A 4YV8A 3H7DA 3KWZA 4BSQA 1ME4A 2R9OA 1PCIA 3K9MA 4QBBA 4QRGA 4G54A 2ATOA 3N4CA 2R9NA 4YYVA 1KFXL 4BQVA 4N4ZA 3H8BA 3CH3X 1Q6KA 2XU4A 3GCBA 3IHPA 3KFQA 3LXSA 1EWOA 2YJCA 3OF8A 3V6CA 1GMYA 4I05A 7PCKA 1KHQA 2PBHA 2R9FA 2P7UA 1BY8A 2GFOA 4CDDB 1NB3A 3F5VA 2R6NA 1F2BA 4X6IA 3AI8A 2DZYA 1F29A 4DMYA 3RVWA 2CIOA 3BC3A 2P0RA 2ACTA 1AU0A 2XU1A 4HWYA 2YJ8A 4RY2A 3BPMA 2AVWA 1BP4A 2AIMA 1JQPA 3I3TA 1O0EA 1AU4A 1GLOA 3O0UA 1S4VA 3KWBX 4MSXA 3H6SA 1QMYA 3QT4A 1U9XA 1QXPA 1STFE 4YYUA 3PDFA 1U5IA 2DCCA 4X6HA 1TU6A 4FJCA 1ICFA 2Y6EA 1ATKA 2NQAA 2AUZA 4YYWA 2ARYA 1TLOA 1CV8A 3CBJA 4PADA 2FRQA 5FPWA 2YJ2A 3KSEA 2FUDA 2WBFX 1PXVA 4PP1A 4AXMA 2HHNA 2AYOA 5EGWA 1AU3A 2DJGB
chains in the Genus database with same CATH superfamily
4W5BA 2DCBA 4YYQA 1QOLA 2OZ2A 2BTWB 2E00A 4XZXA 3OVXA 4AXLA 2DC7A 2HH5A 2DC9A 4OEMA 1YK7A 5CHVA 4X6JA 3M99A 4YVAA 2O6XA 4BPVA 3P5XA 2JQFR 4CZWA 4REZA 4BS6A 4RF1A 3KX1A 3S3QA 1CTEA 1NPZA 4HXDB 1YVBA 1PE6A 1YK8A 3K8UA 3MORA 5EGWA 5A24A 1POPA 2DJFB 3P5UA 3QJ3A 1CSBB 2FQ9A 3DF0A 2DOSA 2J7QC 3HHIA 4N8WA 3TMPA 1HUCB 3RVVA 1PPNA 4FK5A 3BBAA 1X9YA 3BPFA 3PHUA 5KO3A 2DC8A 1KHPA 3PW3A 1VSNA 2HXZA 3V6EA 3HD3A 1TL9A 3ZUAA 1AYUA 2AU1A 1QDQA 1PIPA 1GECE 2OULA 1AYWA 4YYSA 4D8IA 1F2AA 2BTWA 3MHSA 2IPPB 4QH6A 3W31A 1BGOA 3WXEA 4K7CA 3MP2A 1AYVA 2FE8A 3PHWA 3MTNA 3RVXA 1MDWA 1GCBA 5CHTA 1MEMA 4ZTBA 2P86A 6PADA 2XU5A 2FT2A 4P16A 5J94A 1BQIA 3MJ5A 3HWNA 4OVZA 2HD5A 1ITOA 1YALA 3MTVA 2PNSA 4Q8GA 2G7YA 1K3BB 5EZSA 3IEJA 2G6DA 1KXRA 1MEGA 2B1MA 2YJ9A 3OVZA 1A6RA 1THEA 5EF4A 4I04A 4IP3A 1U9WA 5K16A 3I06A 2VHSA 3BOWA 1AU2A 2C0YA 2JQGR 4OELA 3IOQA 5CVMA 3WXGA 2BU3A 1KFUL 2XU3A 1PPDA 3P5WA 4OVZB 4CDEB 4MZSA 1PADA 3CBKA 2GHUA 3PHXA 2AYNA 4D8EA 2DCDA 3ZNHA 1DEUA 3OISA 4BOPA 5CVNB 3IFUA 3KKUA 4QRXA 2PADA 3CH2X 4BS5A 1MHWA 2B1NA 4XR7A 2E03A 2F7DA 1Y08A 3H89A 4CDCB 2F1GA 2NQGA 2G8EA 1PPPA 4DMXA 3IMAA 2R9CA 2CB5A 2PREA 3C9EA 3O1GA 1NLJA 1VJVA 1ZCMA 4R3DA 4MM3B 1EWLA 2FTDA 1CPJA 4PT5A 4W4UA 2FRAA 3P5VA 5PADA 3N3GA 1IWDA 1FH0A 3OF9A 3B79A 2YJBA 4WA6A 3S3RA 4D8BA 1NQCA 2DZZA 3HHAA 4PP2E 1XKGA 2R9MA 2BDLA 3USVA 3ERVA 4BOZA 1EWPA 4RF0A 2AUXA 1CJLA 3PNRA 4N79A 2IBIA 3N3KA 1DF0A 3F75A 3PT2A 2AS8A 1PBHA 2FYEA 2H7JA 1MIRA 4XUIA 3NHEA 4MZOA 3E9SA 9PAPA 3PRPA 2VHFA 2OP3A 4FIPA 5JA7A 4I07A 1NL6A 5JH3A 1F2CA 1U9QX 3D6SA 3U8EA 1SNKA 1MS6A 3LFYA 3QSDA 8PCHA 1PPOA 1M6DA 3H8CA 5E6JA 5F02A 1YT7A 5CVOB 1ZIVA 2UZJA 2NQIA 3IV2A 1CS8A 1ME3A 3K24A 2BDZA 3BCNA 3BWKA 4IUMA 2DC6A 4YYRA 4W5CA 3W30A 3PSEA 4QRVA 2NQDB 3MHHA 2G8JA 3BB7A 2E01A 1NB5A 2FO5A 4KLBA 3E1ZB 4PI3A 1CVZA 4OW0A 1U9VA 3IUTA 4P6EA 1SP4B 4CDFB 3TNXA 1Y4HA 4P6GA 1EWMA 2Y5BA 1AIMA 1EF7A 3KW9A 3WXFA 3O65A 1CQDA 4Q8HA 2AGAA 2DCAA 2E02A 4ZUXU 3PBHA 1AECA 1CB5A 4YV8A 3H7DA 3KWZA 4BSQA 1ME4A 2R9OA 1PCIA 1YZBA 1DKIA 3K9MA 1PVJA 4QBBA 4QRGA 4G54A 3B21A 2ATOA 3N4CA 2R9NA 3C0RA 4YYVA 1KFXL 5JZEA 4BQVA 4N4ZA 5EZQA 3H8BA 3CH3X 1Q6KA 2J7QA 2XU4A 3GCBA 3IHPA 3KFQA 3LXSA 4MI7A 4GUAA 1EWOA 2YJCA 3OF8A 3V6CA 1GMYA 4I05A 7PCKA 1KHQA 2PBHA 2R9FA 2P7UA 1BY8A 2GFOA 4CDDB 3RNVA 1NB3A 3F5VA 2R6NA 1F2BA 4X6IA 3AI8A 2DZYA 1F29A 4WURA 4DMYA 3RVWA 2CIOA 2HWKA 3BC3A 2P0RA 2ACTA 1AU0A 2XU1A 4HWYA 2YJ8A 4A5UA 4BOUA 4RY2A 3BPMA 2AVWA 1BP4A 2AIMA 1JQPA 3I3TA 3TRKA 1O0EA 1AU4A 1GLOA 3O0UA 1S4VA 3KWBX 4MSXA 3H6SA 4M0WA 1QMYA 3QT4A 1U9XA 4RNAA 1QXPA 1STFE 3OQCA 4YYUA 4RKXA 3PDFA 1U5IA 2DCCA 4X6HA 3PRMA 1TU6A 4FJCA 1ICFA 2Y6EA 1ATKA 2NQAA 2AUZA 4YYWA 4BOSA 2Z84A 2JTCA 2ARYA 1TLOA 1CV8A 3CBJA 4PADA 2FRQA 5FPWA 2YJ2A 3BY4A 3KSEA 4BOQA 2FUDA 2WBFX 1PXVA 2JRIA 4PP1A 4AXMA 2HHNA 2AYOA 1UKFA 1AU3A 2DJGB
chains in the Genus database with same CATH topology
4W5BA 2DCBA 4YYQA 1QOLA 2OZ2A 2E00A 3OVXA 4AXLA 2DC7A 2HH5A 2DC9A 4OEMA 1YK7A 5CHVA 4X6JA 3M99A 4YVAA 1GX3A 2O6XA 4BPVA 3P5XA 2JQFR 4CZWA 4BS6A 3KX1A 3S3QA 1CTEA 1NPZA 1YVBA 1PE6A 1YK8A 3K8UA 3MORA 5A24A 1POPA 2DJFB 3P5UA 1W4TA 3QJ3A 1CSBB 2FQ9A 3DF0A 3HHIA 4C5PA 4N8WA 1HUCB 3RVVA 1PPNA 4FK5A 1X9YA 3BPFA 2DC8A 1KHPA 3PW3A 1VSNA 2HXZA 3V6EA 3HD3A 1TL9A 3ZUAA 1AYUA 2AU1A 1QDQA 1PIPA 1GECE 2OULA 1AYWA 4YYSA 1F2AA 3MHSA 2IPPB 4QH6A 1BGOA 3WXEA 4K7CA 1AYVA 3MTNA 3RVXA 1MDWA 1GCBA 5CHTA 1MEMA 2P86A 6PADA 2XU5A 2FT2A 5J94A 1BQIA 3HWNA 2HD5A 1ITOA 1YALA 2PNSA 4Q8GA 2G7YA 1K3BB 3IEJA 2G6DA 1KXRA 1MEGA 2B1MA 2YJ9A 3OVZA 1A6RA 1THEA 5EF4A 4I04A 1U9WA 5K16A 3I06A 2VHSA 3BOWA 1AU2A 2C0YA 2JQGR 4OELA 3IOQA 5CVMA 3WXGA 1KFUL 2XU3A 1PPDA 3P5WA 4CDEB 4MZSA 1PADA 3CBKA 2GHUA 2AYNA 2DCDA 1DEUA 3OISA 5CVNB 3KKUA 4QRXA 2PADA 3CH2X 4BS5A 1MHWA 2B1NA 4XR7A 2E03A 2F7DA 1Y08A 3H89A 4CDCB 2F1GA 2NQGA 2G8EA 1PPPA 4DMXA 3IMAA 2R9CA 2CB5A 2PREA 3C9EA 3O1GA 1NLJA 1VJVA 1ZCMA 1EWLA 2FTDA 1CPJA 4W4UA 2FRAA 3P5VA 5PADA 3N3GA 1IWDA 1FH0A 3OF9A 4NV7A 3B79A 2YJBA 4WA6A 3S3RA 1NQCA 2DZZA 3HHAA 4PP2E 1XKGA 2R9MA 2BDLA 3USVA 3ERVA 1EWPA 2AUXA 1CJLA 3PNRA 4N79A 2IBIA 3N3KA 1DF0A 3F75A 2AS8A 1PBHA 2FYEA 2H7JA 4XUIA 1MIRA 3NHEA 4NV8A 4MZOA 9PAPA 1W6FA 2VHFA 2OP3A 4FIPA 5JA7A 4I07A 1NL6A 5JH3A 1F2CA 1U9QX 3D6SA 3U8EA 1SNKA 1MS6A 3LFYA 3QSDA 8PCHA 1PPOA 1M6DA 3H8CA 5F02A 1YT7A 5CVOB 1ZIVA 2NQIA 3IV2A 1CS8A 1ME3A 2VFBA 3K24A 2BDZA 3BCNA 3BWKA 2DC6A 4YYRA 4W5CA 4QRVA 2NQDB 3MHHA 2G8JA 2E01A 1NB5A 2FO5A 3D9WA 4KLBA 3E1ZB 4PI3A 1CVZA 1U9VA 3IUTA 4P6EA 1SP4B 4CDFB 3TNXA 1Y4HA 4P6GA 1EWMA 2Y5BA 1AIMA 1EF7A 3KW9A 3WXFA 1CQDA 4Q8HA 2DCAA 2E02A 4ZUXU 3PBHA 1AECA 1CB5A 4YV8A 3H7DA 3KWZA 4BSQA 1ME4A 2R9OA 1PCIA 3K9MA 4BGFA 4QBBA 4QRGA 4G54A 2ATOA 3N4CA 3LTWA 2R9NA 2BSZA 4B55A 4YYVA 1KFXL 1W5RA 4BQVA 4N4ZA 3H8BA 3CH3X 1Q6KA 2XU4A 3GCBA 3IHPA 3KFQA 3LXSA 1EWOA 2YJCA 3OF8A 3V6CA 1GMYA 4I05A 7PCKA 1KHQA 2PBHA 2R9FA 2P7UA 1BY8A 2GFOA 4CDDB 1NB3A 3F5VA 2VFCA 2R6NA 1F2BA 4X6IA 3AI8A 2DZYA 1F29A 4DMYA 3RVWA 2CIOA 3BC3A 2P0RA 2ACTA 1AU0A 2XU1A 4HWYA 2YJ8A 4RY2A 3BPMA 2AVWA 1BP4A 2AIMA 1JQPA 3I3TA 1O0EA 1E2TA 1AU4A 1GLOA 3O0UA 1S4VA 4GUZA 3KWBX 4MSXA 3H6SA 1QMYA 3QT4A 1U9XA 1QXPA 1STFE 4YYUA 3PDFA 1U5IA 2DCCA 4X6HA 1TU6A 4FJCA 1ICFA 2Y6EA 1ATKA 2NQAA 2AUZA 4YYWA 2ARYA 1TLOA 1CV8A 3CBJA 4PADA 2FRQA 5FPWA 2YJ2A 3KSEA 2FUDA 2WBFX 1PXVA 4PP1A 4AXMA 2HHNA 2AYOA 5EGWA 1AU3A 2DJGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5B A;  2DCB A;  4YYQ A;  1QOL A;  2OZ2 A;  2E00 A;  3OVX A;  4AXL A;  2DC7 A;  2HH5 A;  2DC9 A;  4OEM A;  1YK7 A;  5CHV A;  4X6J A;  3M99 A;  4YVA A;  2O6X A;  4BPV A;  3P5X A;  2JQF R;  4CZW A;  4BS6 A;  3KX1 A;  3S3Q A;  1CTE A;  1NPZ A;  1YVB A;  1PE6 A;  1YK8 A;  3K8U A;  3MOR A;  5A24 A;  1POP A;  2DJF B;  3P5U A;  3QJ3 A;  1CSB B;  2FQ9 A;  3DF0 A;  3HHI A;  4N8W A;  1HUC B;  3RVV A;  1PPN A;  4FK5 A;  1X9Y A;  3BPF A;  2DC8 A;  1KHP A;  3PW3 A;  1VSN A;  2HXZ A;  3V6E A;  3HD3 A;  1TL9 A;  3ZUA A;  1AYU A;  2AU1 A;  1QDQ A;  1PIP A;  1GEC E;  2OUL A;  1AYW A;  4YYS A;  1F2A A;  3MHS A;  2IPP B;  4QH6 A;  1BGO A;  3WXE A;  4K7C A;  1AYV A;  3MTN A;  3RVX A;  1MDW A;  1GCB A;  5CHT A;  1MEM A;  2P86 A;  6PAD A;  2XU5 A;  2FT2 A;  5J94 A;  1BQI A;  3HWN A;  2HD5 A;  1ITO A;  1YAL A;  2PNS A;  4Q8G A;  2G7Y A;  1K3B B;  3IEJ A;  2G6D A;  1KXR A;  1MEG A;  2B1M A;  2YJ9 A;  3OVZ A;  1A6R A;  1THE A;  5EF4 A;  4I04 A;  1U9W A;  5K16 A;  3I06 A;  2VHS A;  3BOW A;  1AU2 A;  2C0Y A;  2JQG R;  4OEL A;  3IOQ A;  5CVM A;  3WXG A;  1KFU L;  2XU3 A;  1PPD A;  3P5W A;  4CDE B;  4MZS A;  1PAD A;  3CBK A;  2GHU A;  2AYN A;  2DCD A;  1DEU A;  3OIS A;  5CVN B;  3KKU A;  4QRX A;  2PAD A;  3CH2 X;  4BS5 A;  1MHW A;  2B1N A;  4XR7 A;  2E03 A;  2F7D A;  1Y08 A;  3H89 A;  4CDC B;  2F1G A;  2NQG A;  2G8E A;  1PPP A;  4DMX A;  3IMA A;  2R9C A;  2CB5 A;  2PRE A;  3C9E A;  3O1G A;  1NLJ A;  1VJV A;  1ZCM A;  1EWL A;  2FTD A;  1CPJ A;  4W4U A;  2FRA A;  3P5V A;  5PAD A;  3N3G A;  1IWD A;  1FH0 A;  3OF9 A;  3B79 A;  2YJB A;  4WA6 A;  3S3R A;  1NQC A;  2DZZ A;  3HHA A;  4PP2 E;  1XKG A;  2R9M A;  2BDL A;  3USV A;  3ERV A;  1EWP A;  2AUX A;  1CJL A;  3PNR A;  4N79 A;  2IBI A;  3N3K A;  1DF0 A;  3F75 A;  2AS8 A;  1PBH A;  2FYE A;  2H7J A;  4XUI A;  1MIR A;  3NHE A;  4MZO A;  9PAP A;  2VHF A;  2OP3 A;  4FIP A;  5JA7 A;  4I07 A;  1NL6 A;  5JH3 A;  1F2C A;  1U9Q X;  3D6S A;  3U8E A;  1SNK A;  1MS6 A;  3LFY A;  3QSD A;  8PCH A;  1PPO A;  1M6D A;  3H8C A;  5F02 A;  1YT7 A;  5CVO B;  1ZIV A;  2NQI A;  3IV2 A;  1CS8 A;  1ME3 A;  3K24 A;  2BDZ A;  3BCN A;  3BWK A;  2DC6 A;  4YYR A;  4W5C A;  4QRV A;  2NQD B;  3MHH A;  2G8J A;  2E01 A;  1NB5 A;  2FO5 A;  4KLB A;  3E1Z B;  4PI3 A;  1CVZ A;  1U9V A;  3IUT A;  4P6E A;  1SP4 B;  4CDF B;  3TNX A;  1Y4H A;  4P6G A;  1EWM A;  2Y5B A;  1AIM A;  1EF7 A;  3KW9 A;  3WXF A;  1CQD A;  4Q8H A;  2DCA A;  2E02 A;  4ZUX U;  3PBH A;  1AEC A;  1CB5 A;  4YV8 A;  3H7D A;  3KWZ A;  4BSQ A;  1ME4 A;  2R9O A;  1PCI A;  3K9M A;  4QBB A;  4QRG A;  4G54 A;  2ATO A;  3N4C A;  2R9N A;  4YYV A;  1KFX L;  4BQV A;  4N4Z A;  3H8B A;  3CH3 X;  1Q6K A;  2XU4 A;  3GCB A;  3IHP A;  3KFQ A;  3LXS A;  1EWO A;  2YJC A;  3OF8 A;  3V6C A;  1GMY A;  4I05 A;  7PCK A;  1KHQ A;  2PBH A;  2R9F A;  2P7U A;  1BY8 A;  2GFO A;  4CDD B;  1NB3 A;  3F5V A;  2R6N A;  1F2B A;  4X6I A;  3AI8 A;  2DZY A;  1F29 A;  4DMY A;  3RVW A;  2CIO A;  3BC3 A;  2P0R A;  2ACT A;  1AU0 A;  2XU1 A;  4HWY A;  2YJ8 A;  4RY2 A;  3BPM A;  2AVW A;  1BP4 A;  2AIM A;  1JQP A;  3I3T A;  1O0E A;  1AU4 A;  1GLO A;  3O0U A;  1S4V A;  3KWB X;  4MSX A;  3H6S A;  1QMY A;  3QT4 A;  1U9X A;  1QXP A;  1STF E;  4YYU A;  3PDF A;  1U5I A;  2DCC A;  4X6H A;  1TU6 A;  4FJC A;  1ICF A;  2Y6E A;  1ATK A;  2NQA A;  2AUZ A;  4YYW A;  2ARY A;  1TLO A;  1CV8 A;  3CBJ A;  4PAD A;  2FRQ A;  5FPW A;  2YJ2 A;  3KSE A;  2FUD A;  2WBF X;  1PXV A;  4PP1 A;  4AXM A;  2HHN A;  2AYO A;  5EGW A;  1AU3 A;  2DJG B; 
#chains in the Genus database with same CATH topology
 4W5B A;  2DCB A;  4YYQ A;  1QOL A;  2OZ2 A;  2BTW B;  2E00 A;  4XZX A;  3OVX A;  4AXL A;  2DC7 A;  2HH5 A;  2DC9 A;  4OEM A;  1YK7 A;  5CHV A;  4X6J A;  3M99 A;  4YVA A;  2O6X A;  4BPV A;  3P5X A;  2JQF R;  4CZW A;  4REZ A;  4BS6 A;  4RF1 A;  3KX1 A;  3S3Q A;  1CTE A;  1NPZ A;  4HXD B;  1YVB A;  1PE6 A;  1YK8 A;  3K8U A;  3MOR A;  5EGW A;  5A24 A;  1POP A;  2DJF B;  3P5U A;  3QJ3 A;  1CSB B;  2FQ9 A;  3DF0 A;  2DOS A;  2J7Q C;  3HHI A;  4N8W A;  3TMP A;  1HUC B;  3RVV A;  1PPN A;  4FK5 A;  3BBA A;  1X9Y A;  3BPF A;  3PHU A;  5KO3 A;  2DC8 A;  1KHP A;  3PW3 A;  1VSN A;  2HXZ A;  3V6E A;  3HD3 A;  1TL9 A;  3ZUA A;  1AYU A;  2AU1 A;  1QDQ A;  1PIP A;  1GEC E;  2OUL A;  1AYW A;  4YYS A;  4D8I A;  1F2A A;  2BTW A;  3MHS A;  2IPP B;  4QH6 A;  3W31 A;  1BGO A;  3WXE A;  4K7C A;  3MP2 A;  1AYV A;  2FE8 A;  3PHW A;  3MTN A;  3RVX A;  1MDW A;  1GCB A;  5CHT A;  1MEM A;  4ZTB A;  2P86 A;  6PAD A;  2XU5 A;  2FT2 A;  4P16 A;  5J94 A;  1BQI A;  3MJ5 A;  3HWN A;  4OVZ A;  2HD5 A;  1ITO A;  1YAL A;  3MTV A;  2PNS A;  4Q8G A;  2G7Y A;  1K3B B;  5EZS A;  3IEJ A;  2G6D A;  1KXR A;  1MEG A;  2B1M A;  2YJ9 A;  3OVZ A;  1A6R A;  1THE A;  5EF4 A;  4I04 A;  4IP3 A;  1U9W A;  5K16 A;  3I06 A;  2VHS A;  3BOW A;  1AU2 A;  2C0Y A;  2JQG R;  4OEL A;  3IOQ A;  5CVM A;  3WXG A;  2BU3 A;  1KFU L;  2XU3 A;  1PPD A;  3P5W A;  4OVZ B;  4CDE B;  4MZS A;  1PAD A;  3CBK A;  2GHU A;  3PHX A;  2AYN A;  4D8E A;  2DCD A;  3ZNH A;  1DEU A;  3OIS A;  4BOP A;  5CVN B;  3IFU A;  3KKU A;  4QRX A;  2PAD A;  3CH2 X;  4BS5 A;  1MHW A;  2B1N A;  4XR7 A;  2E03 A;  2F7D A;  1Y08 A;  3H89 A;  4CDC B;  2F1G A;  2NQG A;  2G8E A;  1PPP A;  4DMX A;  3IMA A;  2R9C A;  2CB5 A;  2PRE A;  3C9E A;  3O1G A;  1NLJ A;  1VJV A;  1ZCM A;  4R3D A;  4MM3 B;  1EWL A;  2FTD A;  1CPJ A;  4PT5 A;  4W4U A;  2FRA A;  3P5V A;  5PAD A;  3N3G A;  1IWD A;  1FH0 A;  3OF9 A;  3B79 A;  2YJB A;  4WA6 A;  3S3R A;  4D8B A;  1NQC A;  2DZZ A;  3HHA A;  4PP2 E;  1XKG A;  2R9M A;  2BDL A;  3USV A;  3ERV A;  4BOZ A;  1EWP A;  4RF0 A;  2AUX A;  1CJL A;  3PNR A;  4N79 A;  2IBI A;  3N3K A;  1DF0 A;  3F75 A;  3PT2 A;  2AS8 A;  1PBH A;  2FYE A;  2H7J A;  1MIR A;  4XUI A;  3NHE A;  4MZO A;  3E9S A;  9PAP A;  3PRP A;  2VHF A;  2OP3 A;  4FIP A;  5JA7 A;  4I07 A;  1NL6 A;  5JH3 A;  1F2C A;  1U9Q X;  3D6S A;  3U8E A;  1SNK A;  1MS6 A;  3LFY A;  3QSD A;  8PCH A;  1PPO A;  1M6D A;  3H8C A;  5E6J A;  5F02 A;  1YT7 A;  5CVO B;  1ZIV A;  2UZJ A;  2NQI A;  3IV2 A;  1CS8 A;  1ME3 A;  3K24 A;  2BDZ A;  3BCN A;  3BWK A;  4IUM A;  2DC6 A;  4YYR A;  4W5C A;  3W30 A;  3PSE A;  4QRV A;  2NQD B;  3MHH A;  2G8J A;  3BB7 A;  2E01 A;  1NB5 A;  2FO5 A;  4KLB A;  3E1Z B;  4PI3 A;  1CVZ A;  4OW0 A;  1U9V A;  3IUT A;  4P6E A;  1SP4 B;  4CDF B;  3TNX A;  1Y4H A;  4P6G A;  1EWM A;  2Y5B A;  1AIM A;  1EF7 A;  3KW9 A;  3WXF A;  3O65 A;  1CQD A;  4Q8H A;  2AGA A;  2DCA A;  2E02 A;  4ZUX U;  3PBH A;  1AEC A;  1CB5 A;  4YV8 A;  3H7D A;  3KWZ A;  4BSQ A;  1ME4 A;  2R9O A;  1PCI A;  1YZB A;  1DKI A;  3K9M A;  1PVJ A;  4QBB A;  4QRG A;  4G54 A;  3B21 A;  2ATO A;  3N4C A;  2R9N A;  3C0R A;  4YYV A;  1KFX L;  5JZE A;  4BQV A;  4N4Z A;  5EZQ A;  3H8B A;  3CH3 X;  1Q6K A;  2J7Q A;  2XU4 A;  3GCB A;  3IHP A;  3KFQ A;  3LXS A;  4MI7 A;  4GUA A;  1EWO A;  2YJC A;  3OF8 A;  3V6C A;  1GMY A;  4I05 A;  7PCK A;  1KHQ A;  2PBH A;  2R9F A;  2P7U A;  1BY8 A;  2GFO A;  4CDD B;  3RNV A;  1NB3 A;  3F5V A;  2R6N A;  1F2B A;  4X6I A;  3AI8 A;  2DZY A;  1F29 A;  4WUR A;  4DMY A;  3RVW A;  2CIO A;  2HWK A;  3BC3 A;  2P0R A;  2ACT A;  1AU0 A;  2XU1 A;  4HWY A;  2YJ8 A;  4A5U A;  4BOU A;  4RY2 A;  3BPM A;  2AVW A;  1BP4 A;  2AIM A;  1JQP A;  3I3T A;  3TRK A;  1O0E A;  1AU4 A;  1GLO A;  3O0U A;  1S4V A;  3KWB X;  4MSX A;  3H6S A;  4M0W A;  1QMY A;  3QT4 A;  1U9X A;  4RNA A;  1QXP A;  1STF E;  3OQC A;  4YYU A;  4RKX A;  3PDF A;  1U5I A;  2DCC A;  4X6H A;  3PRM A;  1TU6 A;  4FJC A;  1ICF A;  2Y6E A;  1ATK A;  2NQA A;  2AUZ A;  4YYW A;  4BOS A;  2Z84 A;  2JTC A;  2ARY A;  1TLO A;  1CV8 A;  3CBJ A;  4PAD A;  2FRQ A;  5FPW A;  2YJ2 A;  3BY4 A;  3KSE A;  4BOQ A;  2FUD A;  2WBF X;  1PXV A;  2JRI A;  4PP1 A;  4AXM A;  2HHN A;  2AYO A;  1UKF A;  1AU3 A;  2DJG B; 
#chains in the Genus database with same CATH homology
 4W5B A;  2DCB A;  4YYQ A;  1QOL A;  2OZ2 A;  2E00 A;  3OVX A;  4AXL A;  2DC7 A;  2HH5 A;  2DC9 A;  4OEM A;  1YK7 A;  5CHV A;  4X6J A;  3M99 A;  4YVA A;  1GX3 A;  2O6X A;  4BPV A;  3P5X A;  2JQF R;  4CZW A;  4BS6 A;  3KX1 A;  3S3Q A;  1CTE A;  1NPZ A;  1YVB A;  1PE6 A;  1YK8 A;  3K8U A;  3MOR A;  5A24 A;  1POP A;  2DJF B;  3P5U A;  1W4T A;  3QJ3 A;  1CSB B;  2FQ9 A;  3DF0 A;  3HHI A;  4C5P A;  4N8W A;  1HUC B;  3RVV A;  1PPN A;  4FK5 A;  1X9Y A;  3BPF A;  2DC8 A;  1KHP A;  3PW3 A;  1VSN A;  2HXZ A;  3V6E A;  3HD3 A;  1TL9 A;  3ZUA A;  1AYU A;  2AU1 A;  1QDQ A;  1PIP A;  1GEC E;  2OUL A;  1AYW A;  4YYS A;  1F2A A;  3MHS A;  2IPP B;  4QH6 A;  1BGO A;  3WXE A;  4K7C A;  1AYV A;  3MTN A;  3RVX A;  1MDW A;  1GCB A;  5CHT A;  1MEM A;  2P86 A;  6PAD A;  2XU5 A;  2FT2 A;  5J94 A;  1BQI A;  3HWN A;  2HD5 A;  1ITO A;  1YAL A;  2PNS A;  4Q8G A;  2G7Y A;  1K3B B;  3IEJ A;  2G6D A;  1KXR A;  1MEG A;  2B1M A;  2YJ9 A;  3OVZ A;  1A6R A;  1THE A;  5EF4 A;  4I04 A;  1U9W A;  5K16 A;  3I06 A;  2VHS A;  3BOW A;  1AU2 A;  2C0Y A;  2JQG R;  4OEL A;  3IOQ A;  5CVM A;  3WXG A;  1KFU L;  2XU3 A;  1PPD A;  3P5W A;  4CDE B;  4MZS A;  1PAD A;  3CBK A;  2GHU A;  2AYN A;  2DCD A;  1DEU A;  3OIS A;  5CVN B;  3KKU A;  4QRX A;  2PAD A;  3CH2 X;  4BS5 A;  1MHW A;  2B1N A;  4XR7 A;  2E03 A;  2F7D A;  1Y08 A;  3H89 A;  4CDC B;  2F1G A;  2NQG A;  2G8E A;  1PPP A;  4DMX A;  3IMA A;  2R9C A;  2CB5 A;  2PRE A;  3C9E A;  3O1G A;  1NLJ A;  1VJV A;  1ZCM A;  1EWL A;  2FTD A;  1CPJ A;  4W4U A;  2FRA A;  3P5V A;  5PAD A;  3N3G A;  1IWD A;  1FH0 A;  3OF9 A;  4NV7 A;  3B79 A;  2YJB A;  4WA6 A;  3S3R A;  1NQC A;  2DZZ A;  3HHA A;  4PP2 E;  1XKG A;  2R9M A;  2BDL A;  3USV A;  3ERV A;  1EWP A;  2AUX A;  1CJL A;  3PNR A;  4N79 A;  2IBI A;  3N3K A;  1DF0 A;  3F75 A;  2AS8 A;  1PBH A;  2FYE A;  2H7J A;  4XUI A;  1MIR A;  3NHE A;  4NV8 A;  4MZO A;  9PAP A;  1W6F A;  2VHF A;  2OP3 A;  4FIP A;  5JA7 A;  4I07 A;  1NL6 A;  5JH3 A;  1F2C A;  1U9Q X;  3D6S A;  3U8E A;  1SNK A;  1MS6 A;  3LFY A;  3QSD A;  8PCH A;  1PPO A;  1M6D A;  3H8C A;  5F02 A;  1YT7 A;  5CVO B;  1ZIV A;  2NQI A;  3IV2 A;  1CS8 A;  1ME3 A;  2VFB A;  3K24 A;  2BDZ A;  3BCN A;  3BWK A;  2DC6 A;  4YYR A;  4W5C A;  4QRV A;  2NQD B;  3MHH A;  2G8J A;  2E01 A;  1NB5 A;  2FO5 A;  3D9W A;  4KLB A;  3E1Z B;  4PI3 A;  1CVZ A;  1U9V A;  3IUT A;  4P6E A;  1SP4 B;  4CDF B;  3TNX A;  1Y4H A;  4P6G A;  1EWM A;  2Y5B A;  1AIM A;  1EF7 A;  3KW9 A;  3WXF A;  1CQD A;  4Q8H A;  2DCA A;  2E02 A;  4ZUX U;  3PBH A;  1AEC A;  1CB5 A;  4YV8 A;  3H7D A;  3KWZ A;  4BSQ A;  1ME4 A;  2R9O A;  1PCI A;  3K9M A;  4BGF A;  4QBB A;  4QRG A;  4G54 A;  2ATO A;  3N4C A;  3LTW A;  2R9N A;  2BSZ A;  4B55 A;  4YYV A;  1KFX L;  1W5R A;  4BQV A;  4N4Z A;  3H8B A;  3CH3 X;  1Q6K A;  2XU4 A;  3GCB A;  3IHP A;  3KFQ A;  3LXS A;  1EWO A;  2YJC A;  3OF8 A;  3V6C A;  1GMY A;  4I05 A;  7PCK A;  1KHQ A;  2PBH A;  2R9F A;  2P7U A;  1BY8 A;  2GFO A;  4CDD B;  1NB3 A;  3F5V A;  2VFC A;  2R6N A;  1F2B A;  4X6I A;  3AI8 A;  2DZY A;  1F29 A;  4DMY A;  3RVW A;  2CIO A;  3BC3 A;  2P0R A;  2ACT A;  1AU0 A;  2XU1 A;  4HWY A;  2YJ8 A;  4RY2 A;  3BPM A;  2AVW A;  1BP4 A;  2AIM A;  1JQP A;  3I3T A;  1O0E A;  1E2T A;  1AU4 A;  1GLO A;  3O0U A;  1S4V A;  4GUZ A;  3KWB X;  4MSX A;  3H6S A;  1QMY A;  3QT4 A;  1U9X A;  1QXP A;  1STF E;  4YYU A;  3PDF A;  1U5I A;  2DCC A;  4X6H A;  1TU6 A;  4FJC A;  1ICF A;  2Y6E A;  1ATK A;  2NQA A;  2AUZ A;  4YYW A;  2ARY A;  1TLO A;  1CV8 A;  3CBJ A;  4PAD A;  2FRQ A;  5FPW A;  2YJ2 A;  3KSE A;  2FUD A;  2WBF X;  1PXV A;  4PP1 A;  4AXM A;  2HHN A;  2AYO A;  5EGW A;  1AU3 A;  2DJG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...