4R3DA

Crystal structure of mers coronavirus papain like protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
324
structure length
319
Chain Sequence
b'LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3
publication title The Crystal Structures of Middle East Respiratory Syndrome Coronavirus Papain-like Protease and Its Complex with an Inhibitor
rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
total genus 82
structure length 319
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08715 Viral_protease Papain like viral protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4r3dA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4r3dA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4r3dA03
3MJ5A 4RF1A 5KO3A 4OVZA 4OVZB 3E9SA 3MP2A 2FE8A 4REZA 4OW0A 4MM3B 4M0WA 4PT5A 4RNAA 4R3DA 4WURA 4P16A 5E6JA 4RF0A
chains in the Genus database with same CATH superfamily
1FRRA 4WJOA 1QMYA 4GH9A 2DZIA 2L4EA 3C0RB 4OHJA 2BDZA 3FUXA 3PVLA 3L08A 2CE7A 2DAJA 4LCDE 3K92A 4ZRKA 3HM6X 5L95C 2INCC 3SFDB 1THEA 3A9KA 3GQ3A 5J94A 4DV7M 2W3RA 1U9VA 2JXXA 5AZHA 2ZTDA 2V3SA 2DZKA 2KVZA 2BJWA 4AKHA 4C4VA 1X1MA 2IO2B 3TEXA 2DC6A 1ZCMA 1CVZA 1KYIA 3KUCB 3PT2B 1WXSA 4WJNA 2HAKA 3RCZA 1MJDA 3KFQA 1N5XA 1EE8A 4HEOA 3K24A 2HHHM 4FVMA 1DOIA 2L0FA 1T0RC 3T1YM 4L15A 3R8BA 2G1EA 3AE7B 2FIFA 3VLFB 1VD2A 1ZAEA 2BYFA 1UELA 2J52A 2ATOA 3HHZA 1KF6B 5JHAA 2CB5A 3U8EA 4FWHA 3RGPA 2J5YA 3VUYA 3AOEA 1XMQM 2NCNA 3E21A 3IAS1 3BK2A 2KXEA 4L16A 3OG5A 3TSSA 4EFOA 1BGOA 1YIWA 4KGTA 3M62B 3UMMA 1Z6TA 3VH4B 4EEWA 1T6BX 1VZ6A 4GLSC 2X38A 4GHLA 5EDSA 2VIIA 2DZZA 1LM8B 2DI0A 1G4AE 2W3SA 5DCNA 3HU3A 3ZXVA 1BP4A 1L0XB 1N33M 1UUPA 3B89A 4C80A 3R66C 2OULA 4YYUA 2G5GX 2LVNC 3TNXA 2V6ZM 1NJFA 1P3QU 3AEGB 4WQOB 4JPSA 3MMPA 1YOVB 5BPVA 1T5XD 4B7HA 2W82A 2UU7A 2ON8A 2R65A 3HHIA 3S3RA 3P5XA 1V6EA 1XD3B 1HNZM 1IBLM 1OIPA 2ZNVC 2AUXA 4DXGA 2JYEA 3SFZA 3MHVC 1F9JA 1FCCC 3N3KB 4MDKE 2XEWA 2DCAA 1PPOA 2KWUB 2DZJA 2H7JA 4IBIA 2N4FA 1AU2A 2M0AA 1ZE3D 5C1ZA 4BOZB 1CQDA 1PFDA 1QOFA 3C58A 2D10A 3IXSA 4I81A 1TS5A 3PHXB 5FPWA 2OOBB 1UH6A 1CK1A 4RCOA 1ISNA 1YN5A 1JW9D 2MBEA 1KLGD 2ZCCA 3BPFA 2WP9B 1LO5D 3FD9A 4DR5M 2JSVX 4ZRPA 3QWLA 4AKIA 4D82A 3VRBB 4BPVA 4XE0A 2HL7A 1TGUA 1VG5A 5PADA 2LVAA 3AI8A 2WXFA 2BB5A 3P5VA 1IXRC 1P1AA 3SMPA 2OEDA 3QHTA 4K7SA 4BOZA 3GLIA 4FA6A 2KNAA 5DPWA 1YUBA 3LXSA 3QT4A 2OOBA 5FTLA 4W9GA 3SHFA 1L6UA 2CIOA 2L05A 2KRKA 2V1UA 2IGGA 3E1ZB 3NWLA 3ECIA 1FPYA 2R2OA 4P6GA 1CQVA 3GCBA 2YJ2A 2AQ3B 4HWIB 2K22A 1W5SA 3GQ5A 3UF8A 5IO9A 4ANVA 1KFYB 3AV8A 1DGBA 2KDLA 1EWMA 1T0YA 2JY7A 2WXQA 3LYYA 3UIPB 4WWPA 2BS3B 4OVZB 3E9SA 3GPUA 3OQCA 2PTLA 2KHWB 2WNMA 1K3WA 3B2FA 3L54A 1NNJA 1CPJA 1TH3A 2KJHB 1WYWB 1YJJA 1OAOC 4PT5A 2F5OA 1QAQA 3MP9A 3IHPA 1PYWD 4JI8M 1DKIA 4X65M 2KFKB 1CSBB 5C2TB 3DDCB 3KOXE 3UGBB 5LNK1 1QXPA 4W9DA 2IZVB 4K81A 4HLQA 2AGAA 2FCQA 4A90A 3T6PA 3UIOB 3FC4A 5EXXA 2L76A 3FTFA 1V97A 4KHPM 2K25A 1YJIA 2N9XA 1GNUA 4FK5A 2Y5BB 2UWQA 3HY5A 4LF5M 4A9AA 1PPPA 4DV0M 1QAOA 2R4JA 1QQWA 4MM3B 3KWZA 1MHWA 4C00A 2XH9A 2R4EA 1EWOA 3APDA 3BCNA 2WX0A 2ZVNA 1HJPA 3AL0C 3N3GA 4HXDA 4GMVA 4II2B 2KWDA 4ZUXU 2OPFA 2WYQA 3SARA 2FOIC 1TKYA 2UUCM 3PLUA 4BOUA 1WGRA 3N4CA 5A24A 2DXIA 1J09A 1NJGA 3SATA 2DAFA 2LZ6A 4HK2A 2BGFA 4L2YA 4NQLB 2JP7A 2OQ4A 3X23A 3Q8BA 4ANXA 2Y5BA 4IM0A 4HDQA 1D2NA 2KMCA 1CZPA 3HU1A 3F5VA 3P4PB 4XZ4A 3WIMA 1F4IA 3ZVVA 1ME3A 1AN8A 1KFXL 4G4NA 2RGOA 1YT7A 2BU3A 4EKUA 2R46A 1NI3A 3B7ZA 3BVGA 3BB7A 3V05A 3VVWB 3NUHB 5FK9C 4OZCA 1XXHB 1WXVA 2JNHA 2G8LA 1SE9A 4LJ5A 1HTQA 4X6IA 2QBYA 1Z5AA 1C9FA 1L4DB 1I4GA 3W5VB 1DGHA 3P42A 4I8OA 4RKXA 1PPDA 1SSNA 4NQKE 3KVWA 4IWQA 2GRIA 3L28A 3GP7A 2KZRA 1FNNA 2B76B 4W9HA 1SXJE 1HEZE 2YJ9A 3Q69A 4YY3M 1JQPA 1N36M 2DC9A 3TCAA 3ZCBB 2QEJC 2RDHA 5JH5C 3NZSA 2WXJA 1STEA 4IBBA 5KO3A 5A2QS 1A5TA 2DKLA 3LCVB 1WRIA 1GCBA 1TGZB 4K1RB 3GE8C 2R18A 1XLQA 3DZDA 3KX1A 1QDRA 4LDTB 2MP2B 1XF5L 8CATA 1FCLA 4CDDB 1WJ4A 2Z4SA 2ZAOA 1DO0A 2KJ6A 3ZNHA 2MH8A 2XU5A 3PW3A 3I5JC 5C3JB 1MI0A 4BLCA 2C7NB 3OF9A 4ANWA 1MIRA 2GBNA 1VEKA 4P6EA 1GB1A 3E4RA 3NBXX 3GLFA 1BMLC 5EP4A 2UUAM 3ZQ4A 1EFUB 1NPZA 3M99A 2RMMA 1A6RA 1QOLA 1D5ZC 3MP2A 2M0XA 4YSXB 5EXSA 5EGWA 1OIZA 2LHDA 4AWJA 3SR6A 2MP2A 3EIEA 4E3CA 2NMQA 1JCKB 2IGHA 3RN9C 1U9QX 1V5OA 3J27B 2F5SA 3N32A 4JV5M 4MGHA 1RWSA 2CU3A 3BYYB 4QRXA 3MHSA 4FWDA 3ML8A 3RULA 1WJ7A 3PDFA 3Q8AA 1L2DA 2EJSA 1R4NB 3DQVA 3L13A 1NV9A 5HFYA 3ZH9B 4DHZE 2N1WA 4G4QA 2BWBA 2K0PA 2JXTA 4DHJD 1KH0A 3FILB 4CISA 3V6CB 4R71A 3U6LA 3FUVA 2DAMA 1NYRA 2IDYA 4PI3A 4HKZE 1F2CA 4ZHOA 2BWES 3WXFA 1ACCA 4R3DA 2AIMA 5KPZA 2V0GA 4GN1A 5ITXA 1JR3D 2KQSA 5F3WA 4GC9A 4IIWA 2WXKA 3KW5B 1EIJA 4GOCA 3AE4B 2Y0TA 1H4RA 4PYZA 2YR0A 2AYOB 3ILKA 1AW7A 1F52A 5FR6A 3ZTCA 3DBSA 4P17A 5DYIA 4DV1M 2FCMA 3QARA 3JW0X 4BSQA 4M9ZA 3WHLA 3U4EG 1WMHB 1YLAA 1XKGA 1TS2A 2WXGA 2FRQA 1XWIA 1C4AA 3N1ZC 5BYRA 4M02A 1F77A 3FILA 3KQ4A 3LQQA 2YEPB 1V1PA 1ZGUB 3K9OB 4IUMB 3GPYA 4D8IA 2DAEA 1SIFA 4N6EB 4BKSA 1G8PA 2L09A 5J2RA 4B3SM 2KDBA 5KQDA 1BUIC 1TT5B 4B08A 4JWUC 4PS3A 4G4RA 3W1YA 2XNAC 2DAIA 2AYOA 3DVGX 4MSXA 3RI7C 1RRBA 4PDIA 2MSED 2K5PA 3O65A 3KOYE 1FNWA 3D6SA 4DBGB 3NOBA 4KODA 5EP1A 4KZ0A 2K9XA 3BC3A 3C19A 2PBHA 4YSYB 4YVAA 1WR1B 3A1QA 3NS1A 2N9EB 2EMTA 3JSVB 4GU2A 1NENB 2X8AA 1IN5A 1ZOYB 4MB7A 1WHCA 2LD9A 1U4AA 1Q39A 4KLBA 4CQNA 2C98A 2O6VB 1J7BA 3VK7A 2WDVB 2Y5CA 3CSTA 3AJIB 1EWLA 2P7UA 1N5WA 2JPHA 3MORA 1IN7A 5ITTA 3H89A 4JI0M 3GZNI 4KKJA 3DFZA 2WDQB 2FE8A 4ZOHC 1IY0A 4DBGA 5TR5A 1PPNA 2I7NA 3FYCA 4FULA 2CUZA 5J17A 1GC7A 5DFLA 2O5RA 3HD3A 3RUIB 1VDLA 2L7IA 4AOFA 5KPRA 5HG2A 5IA7A 1AYVA 2PKOA 3HJQA 2LTUA 3I4YA 1XB2B 2R61A 4P7IA 3KKUA 3MTVA 2IY0B 4JYAM 2NS5A 2P0RA 2O6VA 3KH0A 4DR1M 4XK8F 5KHOA 3ZDMC 4DDID 1TTNA 4IM2A 4XYCA 3U6MA 3R3MA 4LG2A 2FBWB 4XR7A 2LH0A 4N8WA 5JZEA 3BIID 2J4XA 1L2BA 2PPHA 1ESFA 4EUTA 2G7YA 1E8ZA 4DR4M 2LUMA 3LJ3A 5FTKA 1LXDA 1V92A 4USAA 4CO7A 2KDEB 3A33B 1OQRA 2DZOB 3FTEA 3ZRCA 2XU3A 1WIAA 2BPSA 3LB8C 1UFZA 2HTHA 2FQ9A 1GJSA 3NHEA 4WA6A 4LF6M 3X0WA 2GBKA 1RU3A 2KZSA 5KPTA 2B3TA 2KLCA 3ONSA 3TJPA 1VQ1A 5HKHA 2KXJA 1R7SA 1TH2A 3MFGA 2BT6A 2UXCM 4W9EA 4YV8A 3D8BA 5JI2E 1WRDB 3AE8B 9PAPA 1Z59A 3T9LA 4CDCB 3RNEC 2IPKD 2D07B 1FO4A 3T1HM 3OTOM 1SP4B 2L3ZA 2KKCA 1CTEA 4N4ZA 2N7DA 2C5LC 2L83A 2NBWB 1PJTA 1QOAA 3VDUA 1GLNA 4S17A 3QIJA 1OEYA 1MDWA 2DZMA 2HXZA 1SXJC 1V86A 2Q5WD 4WAFA 1TYGB 4XDCA 1TKEA 3EA6A 5F02A 3MC8A 2GOWA 4LTUA 2LMCA 2P5TA 4GDKB 1R4MI 3I51A 5C18A 1D6EC 3KOZE 4JI2M 2FCNA 3FTCA 3MJWA 1QT9A 2NR2A 4ICVA 2CEAA 3V61A 3Q3NC 4J3OD 4F7ZA 3AV0A 3M3JA 1IY1A 4US9A 4FCVA 1WSPA 3H4JA 3IV2A 2KA6B 3KUDB 3Q3JA 1TY0A 2KOXA 5H92C 1E90A 2BKRB 1B9RA 2JZ0A 2YQZA 2R6NA 3MHHA 2JY6B 4LY6A 2KDFB 4FBJB 4JI1M 1P7FA 5DNYA 2QSFX 4IDIA 1HT1E 3TEWA 1UBIA 1YQ4B 1IWDA 3Q8EA 3BVZA 3M7GA 1RAXA 3HHAA 4HEA1 1POPA 3EFCA 2G9HD 3PZDA 1E7PB 4US8A 3SHQA 3U7DA 1FNVA 3TL5A 2JY5A 2HJ1A 4XGAB 4PDGA 4DV3M 3UI3A 4HKQA 3H7SA 1QAMA 3AE2B 3Q3MC 4BS6A 1ITOA 1Y4HA 1W5TA 1ZW7A 1OQYA 5FR3A 3VK8A 3IECA 3WAMA 3UQBA 1VR9A 3FUUA 2OO9A 4AG6A 5BO4B 1NBFC 4LF4M 4MI7A 1F2RC 3GRYA 4TQ0A 3KS4A 1NI2A 4QNMA 1QZEA 1WWTA 3TBLD 5CHTA 2HTME 4JLCA 1S3SG 4FCTA 3CMMB 5BR8M 3CWIA 4WJQA 1S3SA 3H4MA 2KX3A 1L6VA 2C7MB 4RGMA 5D7GA 3TWLA 2AQ2B 4KDLB 2IPPB 2Z84A 2ARYA 3FRHA 3Q6BA 2MH7A 4GIPA 2CU1A 4EOYA 4D81A 1WGHA 2AQ1B 2W54A 3T8MA 3KXEC 1GJTA 1IQPA 1NY6A 5GKNA 1UGJA 1OJLA 3N9YC 2XGNA 1J0GA 3VR9B 2R44A 2LGSA 4NAMA 2LWXA 1CB5A 2Y5PA 4B9KA 3L2AA 2HE7A 1GL7A 1NDDA 4L78A 1FIQA 4II3B 4KKIA 2O6XA 3H6NA 2I1KA 1ORYB 1V5TA 3SDLC 4QRVA 2RDGA 3H7PA 2UZJA 4C4VB 1K3BB 4IOIE 3V62A 5CVOB 1KJTA 2BW2A 1UD7A 2CHWA 4N79A 3C9EA 2D3AA 5AZFA 5E26A 1HA5A 2M17A 3FYDA 3RGSA 4YYRA 3DBLI 3CF2A 4YL8A 4ZYSA 3JYUA 3K9MA 8PCHA 2K9DA 2MGWA 1CV8A 3BWKA 1JROA 2E3TA 2V3PA 2I38A 1ZIVA 2DWLA 1SXTA 2G8JA 2CS4A 3A4SC 3U60B 2L4FA 2D3BA 2R2QA 2N7JA 2FUG1 3GPPA 5TSSA 3TWMA 1F29A 1E10A 3GE3C 1AU0A 4W9KA 1GABA 1GECE 3A46A 4JWSC 4YXDB 3USVA 1NV8A 2MX2A 3NVVA 1TJEA 1OFIA 1GJZA 3SAUA 1M4VA 2DENB 2KQ4X 3ZGZA 5D2MB 1EU3A 4JQWC 4BFRA 4CDFB 1EWCA 2NPTA 1HQRD 3ZLZA 2HDEA 2VF8A 2LVQD 5AUKA 3U60A 4DUZM 2OJRA 3ZRFA 3B2GA 1SE4A 1V9JA 2NQAA 4L6V6 4A5UA 1YZBA 2VHFA 4Z6YA 3DBRI 3QAUA 1NEKB 4JGHB 1V34A 4C7YA 4F8CB 2WBFX 5J18A 1L2CA 3HM3A 2DENA 5D3DA 1ZKHA 4PYUA 2NQGA 1V8CA 1ZV1A 3GLHE 3AEAB 3S2AA 5FSWA 5ITRA 2IO3B 3T3OA 4TKNA 3TMPB 4A55A 2B1NA 2FRAA 3TWKA 4HCPB 2PREA 1ME4A 2Z8YM 2L6OA 1TS4A 2PLPA 2ZZPB 3TIXA 3KOWE 3DVNV 3PRPA 3GRRA 2YFQA 1YALA 5E6JA 3PSEA 4KT0F 4PADA 1WGNA 3BYTB 4BBAA 1N32M 4X62M 4AS1A 1JWMD 4JXJA 4FLHA 4OVVA 3RFWA 1IBXB 2NQIA 3GLIB 2D3GA 3DWGC 2BTWA 2DWZB 1FFUA 3WXEA 4FN2A 4MSQB 3TMPA 1PBHA 1SXJA 4WW0A 4IP3A 4ANRA 3HUIA 3PNVA 3ZTDA 2BF8B 4WH4A 2DJFB 3KFUG 4W4UA 1KTKA 2BB6A 2WXRA 4LJAA 1H6UA 1C78A 2EO2A 4W5BA 1R2YA 2KDIA 3BWUD 4DR7M 3NVYA 4X66M 2KEBA 3SYKA 4FHJA 3ZXRA 4R7GA 3MC0B 1E9RA 4MGKE 1Q1OA 3UZUA 3PPAA 1IBXA 3HVDA 3AFHA 1WYGA 4N58A 2DAKA 1MPEA 1PJSA 4KVGB 4TSSA 3VHTC 1QDTA 3AE5B 2G4SA 3PZ8A 2J7QC 4FD2A 1QANA 2DWMA 4Q8HA 3CBJA 2E5LM 3VDZA 5IAAC 3N1XC 5IT9S 1J8CA 4DHZB 1C4CA 2Y3AA 5BYSA 2AHMA 2LGIA 2ZW0A 4MEMA 4LLGM 1OAIA 3ZKJC 1N34M 3L16A 4LFCM 1WY8A 2VH1A 1MJGM 3FUTA 2BDLA 3M6AA 1HNXM 4JI3M 2R9NA 1SJED 4IW0A 4CHKA 2KFJA 1EU4A 5IZ7D 2G3QB 4NJ7A 3AB5A 5EZSA 1J19A 1OFFA 3VXWA 1XHBA 3PBHA 1E9SA 3O0UA 1L5PA 1VJKA 2C9OA 4HPPA 2XK5A 1GKIA 1WXAA 2CV2A 1FXIA 4BBNC 3TE6A 2FO5A 1OQQA 2LXAA 2BQQA 2VH2A 4P6VF 4DMYA 4A3VB 3B7NA 3NVWA 3IBEA 2Y21A 2B1MA 4HXDB 3A9JB 2ZBKB 3VR8B 1IUEA 1UKFA 4F1IA 1WGKA 3LQRA 4GGQA 4HCNB 2F4VM 4NJCA 4FADA 3RNVA 1SE3A 1STFE 1ZPSA 1QUSA 2YNMD 1I4PA 3SAVA 2XN9C 2G3QA 1E6EB 2K8CA 1NVID 1OKSA 4XDDA 2XU4A 2KNZA 3HHWA 3DHHC 5BMIA 2MHJA 1A70A 4A6QA 2D2QA 1YX5B 5T8IA 2KAJA 3A9JA 4HPMB 3W67A 4ITKA 4LNKA 2RPVA 2R6FA 1HUCB 1E9MA 4G0NB 2WSEF 4HWYA 2M60A 1HZ5A 1FH0A 2MEKA 3RT3B 1M6DA 2LXEA 2KNVA 2ZW1A 3RVXA 2QBYB 2DOSA 1JB0F 4M9XA 1NHWC 1DGHB 3KSXA 2BYVE 3AI5A 3ZDTA 3QYEA 1LFDA 3CSFA 3KP0E 2KACA 2LBCA 1KLUD 1AARA 2WWZA 4M0DA 4OX9M 2V1CA 2ZAMA 3ENEA 3P4QB 3M0EA 3VRAB 2KVRA 3K9PA 2J0KA 2WU5B 3BXWA 4G4OA 1EF1A 2UU9M 3GLGB 1P98A 1KHQA 3KSEA 5G2NA 3A98B 2EELA 2PVGC 1PGAA 1CUKA 4AKGA 1Q0WB 4OW0A 3VFDA 1EM7A 1WM3A 3L4PA 1WM2A 1N63A 2JWZA 1LV7A 1RFKA 1QLBB 3ZNHB 1IN6A 1MFWA 2C9WB 1F2RI 1QYRA 4G50A 2JRIA 1JWAD 3HHXA 2BBCA 2WHIA 4ZYNA 4A20A 4GC5A 4FCWA 3CIRB 1T3TA 2HKJA 2DCCA 3GLFB 4YTPB 2CHVA 4QRGA 3B08A 4IBGA 4AQYM 2MCNB 4KSKC 3BVMA 2DC7A 5G5GA 1E94E 1RLFA 4AXLA 3GLGA 4B3TM 2RSUA 4MGIE 2ZNVB 1DOXA 5IWAM 1ZMVA 4W9FA 2AVWA 1KXRA 1V2YA 3M63B 3GRVA 1SE2A 3NJTA 1JALA 4LJ9A 2K47A 1Z5SB 1OGWA 3AEEB 2OOAA 5D3IB 1GMYA 5ITQA 4TMAB 1RFAA 3ZJVA 3PRMA 4JI7M 2UXDM 1PVJA 3GQ4A 3JR4A 5GMVA 1TTEA 1PQSA 1PCIA 3GZNB 1YD8U 2HH5A 2ZPYA 4HDOA 4YYWA 3OISA 3Q8GA 3K8UA 4L1BA 2N9PC 2V3NA 4DR3M 4NJ6A 4EZKA 3QSDA 2K8BA 2RKOA 1DEUA 4I4LA 4MGZE 3AMZA 4WIPA 2A5YB 4ZPXA 4OELA 1TIFA 3V6EA 2L8JA 1E8WA 2GMIC 2HD5A 5L8RF 1VDVA 3LW5F 3RNFC 4FIPA 1WH3A 4S12A 1N78A 1WXMA 1C3TA 3A45A 1GUAB 4LNIA 4DUYM 1JWBD 2J7QB 4YYSA 1I7HA 2ERCA 3KW6A 4IBFA 2C9CA 3VAWA 1MEMA 1VJVA 4YSZB 1CS8A 4BQVA 2ZCBA 1HR0M 3AE9B 5CVNB 4AJYB 2KLGA 3V3XA 2O2VB 1PIPA 2DHRA 2DZYA 1L4ZB 4KV2A 4DDGD 3B1LX 4XZXA 2DZNB 3FKEA 3K2LA 2QHOA 5EP2A 3SEBA 1GC6A 1V1PB 4NZLB 3W1SC 2LGYA 3L25A 4GUAA 2IY1B 3P1MA 2CJOA 4PS7A 2L7RA 4NAWB 2DNAA 4RM8A 2VQFM 1MS6A 2H88B 2K1FA 1L8QA 1D5XC 1C79A 2GNOA 2J7QA 4GRIA 5C1BA 2JZ1A 2EKIA 3ZC7B 4QHSA 1I4QA 2CKHB 3MTNA 1EF7A 2CHXA 4S0RA 1X9YA 2CHZA 3O65B 2FNJB 4CJ6A 3TRKA 4URKA 1GG3A 2VF7A 2O2VA 2QIEB 2R45A 3A1QB 1QVRA 2KQ7A 5CHWA 1MEGA 5FLXS 2OP3A 1AIMA 3N1YC 2G45B 4NAWA 4LDTD 1D3ZA 2KHHA 1N75A 2V4IB 1YE9A 3PTFC 3WHKA 3C8YA 2WX1A 4HPLB 4QH6A 3B0AA 2DLBA 2SEBD 3DHGC 2MBHA 3TPZA 2C60A 2MJ5B 1R4MB 3FUWA 1F0ZA 4YTMB 3AULA 3MHSD 4AG5A 2AL3A 4W9CA 4M8NA 1I35A 1LTMA 4FJYA 4LJ7A 1TS3A 4DV6M 3CH3X 2UUBM 1V33A 4M0WA 1SGHA 1YN4A 5CHFA 3DPDA 3F92A 3K1JA 2KYWA 2NBVB 2PE9A 2JYTA 1L1TA 4G54A 4NSRA 2ZM6M 1UBQA 1P3QQ 3QYBA 1AU3A 1ENFA 1YX6B 4KLNA 1C77A 5JZEB 3KWBX 1KSFX 3W0FA 3WCQA 1FEHA 1GPXA 1ET6A 3VTWA 3D32A 3I57A 4KZCA 3F75A 2G4DB 4YT0B 3KS8A 2GHUA 3DBHI 2D7GA 3AOGA 2KK8A 4Q2JA 3IFUA 1C1KA 3GP1A 3C3EA 1MG4A 5AEKB 4OZAA 1N61A 3NHEB 2PIAA 4RY2A 4AI6A 4IBDA 2KRUA 2KN4A 4DV2M 2IYDB 3AEBB 1WIVA 3D8LA 4C7ZA 4BKSD 1YK8A 3IT4B 3HHYA 2JZ3B 1GVNA 5FKAC 3DVGY 4WWMA 3A42A 3NBIA 4A8XC 4GIVA 1Z2MA 1D0LA 1XXHE 2CR5A 2INPE 2LGDA 2KTRB 2LI5A 5EZQA 4X57B 1K50A 3AE3B 2LHCA 3DCGA 3ZYYX 5HHDG 2C0YA 1JR3E 4BOPA 2LHEA 3I9V1 2BYEA 1ZMUA 3FRIA 3H8CA 3VTVA 3BY4B 3ZJUA 1JWUD 2JXNA 3HZJA 4LNOA 3AKZA 4RKUF 3L29A 1E5WA 3U6OA 2JX5A 2QMTA 4B0EA 1GOZA 1AUAA 3FAHA 3JVZX 1UNSA 4BS5A 3R2IA 2D3CA 3SD5A 2KTRA 1KLVA 4B6WA 4DWFA 1HE8A 3APFA 2PMVA 2R9OA 2LVPC 3PHWA 3DBLB 4TQ1A 3SMSA 2Z4RA 3E56A 1KM7A 3NY5A 4QAYA 5EF4A 1GO5A 3T15A 2DJGB 3C9PA 2LVOC 3MHZA 1K3XA 2J0JA 2KANA 2BTEA 3BY4A 1WJUA 4RF1A 3PHUA 5LXIB 1NLJA 1ZXIA 1CMXB 2XSZA 3LCUA 3U6QA 2F5NA 2O6VD 5LLIA 4QBBA 1Q10A 1XC8A 2KC1A 3C3DA 1SJHD 4RGNA 2VQEM 4Q7JA 2V9HA 4I6PA 2INNE 1WGDA 2JU6X 3DHIC 3AM9A 4O1NA 3EUB2 1V80A 2D7HA 1FXTB 4N59A 1S4VA 3JAMS 5BYQA 2AS8A 2WS3B 1YMHE 4LCBA 4BZAA 3B21A 3GLHA 2EMSA 1AYFA 1B1ZA 2ZJDA 4PCZA 2RR9A 1WX9A 3LFYA 1WE6A 1DV0A 5DPTA 1D4BA 3CTWB 1WJ6A 2HWJA 3H8BA 4B0MA 2G8EA 3PXGA 3TQSA 2VRRB 2YEPF 2DCDA 1NB3A 3DF0A 1JQ4A 5EP3A 1I4WA 3DBRB 2CJNA 5L83A 5E6OA 4PP1A 1NQCA 4YHHM 3U61A 3DOAA 4Q8GA 1MVKA 3MJ5A 3W1SA 1XCTL 2N35A 2KD0A 4LF7M 1FRDA 4DMXA 1SB3C 2JUOA 4W5CA 3VKGA 4I04A 2JTCA 5CX3A 2DBYA 1XCQL 3QX1A 2TSSA 5D6JB 3IT6B 4KIKA 1T6OA 1RYJA 1WZ0A 4CYEA 2F5PA 4BB9A 4K7UA 2QCZA 1ZDXA 4LNNA 1GL6A 2KO3A 2LRUA 2WQYB 2F1GA 3OJ3A 1E7VA 3APCA 3P4SB 1ZMWA 2KZUA 3HVZA 5MPOA 1DGJA 2L52A 3H7PB 4FW9A 1MG8A 3WXGA 2CV0A 2DVWB 2RRUA 2DWNA 1U9WA 3NZ3A 1IP9A 2JT4B 4RM9A 4CZWA 2XFTA 2B3AA 4BAXA 1MHXA 2CP8A 4BKGA 4DXAB 1A5RA 1P0RA 3PRZA 2BS2B 2I2YA 4LNFA 5CHVC 4JN6A 2L2DA 3HX3A 2DC8A 2N9KA 3OAWA 2MBQA 3H7DA 2WXPA 3RMKC 4DV5M 1LGRA 1IN8A 1SBBB 1T0SC 2KX0A 2GQFA 4UN2B 1EF5A 1WX7A 2BVCA 2DHYA 4ZRIA 1NO1A 2E01A 2JWSA 2BNKA 2RDBC 2XZFA 2MJ3A 2N7EA 4WWOA 1T3QA 1NY5A 1PJJA 3WAPA 1E8XA 4M8MA 4ZDVA 2GLSA 4BVUC 2HJ8A 2PNSA 2N1VA 4HJGE 1PE6A 1IBMM 3VUXA 4OU7A 1TKGA 2Z59B 2C96A 4AXMA 1FD6A 1R5LA 1TLOA 3NZUA 2NPTB 2K6BA 4ZTBA 1F1HA 3KYDD 2KTFA 3U30A 1XNRM 2NBUA 3HJSA 1HNWM 5DYGA 3BOSA 5EE3A 2M56B 2QC8A 5EXPA 3JR5A 3RNBC 4LF8M 2OHFA 1R6BX 2PEAA 2P86A 1WGGA 3ZNGC 1IYFA 4YYQA 5EXTA 1JRPA 3ZNID 4D8BA 5G5HA 2MRPA 2AEHA 2WSCF 4QNRA 1RM6C 2XFSA 4K0KM 2MW5A 4Y28F 2VZKB 3OVXA 3RVVA 3CBKA 4GB9A 4FJZA 1FXAA 2IGDA 4NXNM 3PRPB 4W9LA 2A4ZA 1KRHA 2UXBM 2SAKA 6PADA 1XMOM 2FIDA 3PSEB 1NHGC 2DYMA 3DA1A 2PADA 2MBOA 3GS2A 3C0RA 3KUZA 2CV1A 2K8HA 3U6PA 4GKJM 2CWBA 4AW4A 4G6ZA 4NRWA 4REZA 1C1YB 2BTWB 2XF3A 3QAQA 1SEBD 5IREB 1S1QB 3L26A 3W5UB 1SXJB 3PVSA 2WGSA 3H6SA 4ITQA 4ANUA 2L32A 2W55A 2EKFA 2MWSB 1L1ZA 3IMAA 1YK7A 4PP2E 5E6NA 5JXVA 2DZLA 2RGFA 3N20C 4CIZA 4OZBA 4H2AA 3PT2A 3AECB 2GI9A 4IBJA 1G71A 3ZIMA 3I63C 3KLSX 4RFBA 2QP9X 2LVPA 1JMLA 2ZEQA 2J0MA 3PV1A 5AZGA 4YYVA 2LVOA 3RVWA 4MELA 2VHSA 4IJFA 4XGIA 3TUOA 3S3QA 1TY2A 4XBOA 5IN7A 3KWLA 1H8CA 2UYZB 4C56C 3KDSE 1OTRB 3FE3A 3URYA 2AYNA 5EE0A 2Z0EB 3VUWA 2QENA 2Z3XA 4FJCA 4PS8A 1N62A 3R8FA 2IJ0A 5GXGB 5IOIA 5FTJA 1MX0A 1L2NA 1DF0A 2OZ2A 5AUIA 2R9FA 3L10B 1UGMA 2NTSA 2WDRB 4WAAA 1G3IA 1N60A 3VKHA 2HCBA 4KSLC 1XT9B 1WI0A 3RPFC 3WA0A 3I04M 1L0VB 3THGA 3FKYA 3QK0A 2XU1A 7PCKA 2WXHA 3RZFA 3UQAA 2Y20A 3P63A 2R0IA 4IWOA 4QHTA 2KWVB 1I4RA 3KSJA 2XK5B 3U52E 1QQRA 4NNJB 3I4VA 2E02A 2C99A 1FM0D 1OTRA 2J7NA 2WSFF 3B74A 1AECA 1Z5BA 2J53A 1OFHA 3IAM1 4HLEA 3MC9A 1LQBA 3PZ7A 3W30A 2VZKD 3J9CA 3N3KA 1WE7A 1WXQA 4LJ4A 3VTUA 2YJ8A 4MZSA 4FXCA 4MZOA 4WP2A 2IO1B 2X8XX 2QNJA 1XLPA 3PHXA 1J7CA 3HGIA 2JQGR 2QZ4A 1XLOA 1K51A 4IG7B 4DK5A 1PM5A 1R2ZA 2D11A 2JVCA 4EZLA 2JZPA 4JI6M 3Q8FA 2FH0A 1GAQB 3O1GA 1FNUA 1HTOA 3NVZA 2K0BX 4X6HA 1L0YB 1TH4A 1SXJD 4JX1C 3IG3A 3IEJA 1O0EA 2KWCA 2HHNA 4D80A 2ACZB 2YJBA 2FT2A 1TDZA 2XEPA 2KW0A 2M8SA 4DR6M 2FTDA 2WZJA 3ETRA 4NC6A 1PJIA 2K3UA 1KFUL 4GEWA 1G59A 4IBKA 2Y0QA 5EQTA 2LGXA 4K3CA 5IKCM 1QZMA 1C7YA 2M19A 2ACTA 4I6NB 4AP4C 3J7BA 3OLMD 1UWMA 1PRBA 4M9SA 3P4RB 1EO6A 2K6QA 5CHVA 2LWPA 3QWZB 3AEFB 4LJ6A 1P7EA 2QILA 3SFEB 3EFUA 2X4AA 4GXBA 4WURA 2H5XA 4I07A 1Q3BA 1NL6A 2FCSA 4F2LA 4KX6B 3K9PB 1XQQA 1J7KA 4OVZA 2XZUA 1J5EM 4GKKM 4WQMA 3AH7A 3BZDB 3IFWB 4MT5A 1I42A 3HHMA 3M95A 3PLVA 4IJEA 1GLOA 3L17A 3P2BA 4YTNB 3HWSA 4QOSA 1UF0A 4L4UA 1IFYA 4XUIA 2KMMA 2X49A 2N0SB 4HRSA 2JRIB 3UJNA 2KFKA 1ROEA 3W9CB 2V1YA 3AU5A 5IP4D 3PGEA 1G41A 2JZZA 3K8ZA 4I5SA 3QQ8B 1TF0B 1I4XA 3U6DA 3H1UA 1AIPC 1EWPA 1NSFA 1IBKM 4N9F4 2N9LA 2MQJA 1Y8GA 1KFVA 2WLBA 2K6DB 3PFIA 3W68A 3RD2A 2W9NA 4MM3A 2R62A 4BKTA 4AQ7A 3BBZA 2MROB 1ZQ9A 1P9DU 3CGWA 2PVOD 4LJOB 1WFYA 4M00A 3V60A 1SIJA 2JY8A 4EZJA 1C4PA 4PK1A 3TEZA 1YVBA 5LXHA 3PRMB 4DQOC 3RFZB 2WXLA 3DWMA 4BOSC 4DHJB 3TL4X 1E7UA 1BY8A 1XO3A 2WDTB 4L8RC 2LUEA 1PGXA 2DHZA 2WXIA 3OVZA 2BYTA 1SG9A 5K16A 2KNBA 4X6JA 4D8EA 3LMMA 2WU2B 1AYUA 3J7AS 4LJPB 3RNGC 1JQJC 4XWTA 3ZUAA 2QQ8A 4W9IA 2FS1A 5BMGA 2ZPNA 3V6EB 3IOQA 3UK6A 2QJLA 3QCAA 2HD5B 2M1MA 4RGOS 3RE8A 1TZ1A 1UM8A 3QC8B 2QDFA 1X37A 2XLJA 4W9JA 1TU6A 3WANA 1TDHA 4XWWA 1L7YA 2L00B 3IVFA 2KT7A 1XXHA 2Y6EA 3R2TA 3ERVA 3PREA 3R9XB 5DPSA 3DBHB 3LVVA 1D5MC 3PO0A 1BXTA 2XBBC 4TV3A 2FAZA 3NG0A 5JHBA 2YJCA 4I6LB 4GDLB 1JR3A 2QHOB 3LDZE 3CF0A 4YWGG 4IBEA 3RNCC 1DOYA 3U2SC 2GBJA 4TUWA 1J7AA 3GLIE 3Q14C 1NB5A 4AZFA 2APLA 7CATA 1IGCA 1PADA 3HJ8A 3PS6A 1Q02A 1Y08A 1PDXA 2NQ8C 2KMAA 2ZVOA 1I4HA 1QOBA 3OWEB 2L1AA 2QPAA 1ET9A 3AEDB 4AUQC 1XXGA 3MTNB 2F5QA 2CHQA 1ZP0B 4JE3B 1F2AA 5EE1A 2BKFA 2JUJA 3ZJTA 1K8RB 3NS8A 4FWGA 1IPGA 2O25A 1TZOA 4GDLA 2J42A 1Q3CA 3GB1A 3LVWA 1BVSA 1VEJA 2LASA 4FJVB 3OF8A 4K3BA 3PNYA 2LEKA 3GPXA 3SC3A 1TL9A 2KJRA 3QJ3A 2MBBB 3U6SA 3WALA 1Q6KA 1PGYA 1PUTA 1MN3A 2FUHB 4NL4H 2QSDA 2JQFR 2LFIA 3T38A 4MH8A 1ATKA 1MU5A 1E32A 3EGRA 4Z8XA 3AE1B 5D94A 3ABVB 3BK1A 4X64M 4M01A 1YJ1A 5HI1A 5I4DA 3U7ZA 1D0MA 2LHGA 4M0WB 1VCBA 4LGYA 1F2BA 4FHKA 2DX5B 4MH0E 3J81S 3AN1A 1XNQM 2GBRA 1IM2A 2FUDA 2NQDB 1FFVA 3LXFA 2IO0B 2Z7JA 5JI3E 1CJEA 2GB1A 1QUTA 4E71A 2C5RA 4KDIC 1AWDA 2PE6B 3U8ZA 4B7FA 1G6JA 4LJ8A 1NNUC 3ZUNA 3WAOA 3J80S 1JWSD 4KO8A 2JF5A 3CF6E 2E00A 1HZ6A 2G6DA 3CH2X 5LMUM 2FFJA 4LF9M 1CJLA 1XEEA 5C23A 2Q2EB 4LK0M 3AXCA 4EIWA 2YLMA 3NRZA 2JQRB 2M4NA 2AUZA 3U6CA 3V6CA 2EKKA 4OVUA 4PD2A 3J2PB 4MSMB 1OEYJ 4MJSB 4K7CA 3W0LB 3Q8XA 3ZQJA 2HWKA 4RH6A 3U5ZB 1N77A 2PW9A 5JH3A 4NXMM 4MACA 3SYLA 4ASWC 1T43A 2VDBB 4P16A 1TBEA 1VLBA 1VEGA 1KHPA 4DR2M 1NVMA 1VRAB 3V76A 3SAWA 1JRUA 2V4LA 3FTDA 1V81A 5E6PA 2DAGA 4DXFA 1WMHA 4ARCA 2JA2A 4NSOB 2O01F 3W2DA 5LMNM 2D5GA 2KN5A 4HL4A 2YVCA 1QF6A 2AL6A 3HK0A 4IUMA 3K9OA 2DYOA 4NPNA 4RMAA 3U6EA 4MJSA 2GFOA 4CDEB 1FMAD 2JWUA 3U5ZA 1YQBA 2BWFA 1VSNA 1ZXHA 2GBMA 4CGYB 3HRDD 3R7RA 1ICFA 2KDMA 2DWQA 3N30A 2MLBA 3RNAC 1I94M 2FYEA 4D2KA 4P1BC 3B9PA 1R4GA 1Q5WB 2MJEA 5JA7A 1WR1A 4I05A 1QILA 3HWNA 3JSVA 3GLGE 3Q8CA 3VDPA 1UZXB 1AU4A 2MR9A 3Q2AC 4XC2A 3T3NA 4II7A 4RNAA 2INDC 1DGFA 3H9DA 3PHWB 4L23A 5FTMA 4IC7B 4ZRQA 4LZZA 1YN3A 4ARIA 2BWEA 4B3RM 1AYWA 3AOEC 4HROA 4B3MM 3SASA 1R4NI 3KYCD 4IKGA 3GLFE 1N6ZA 1WF9A 4BOSA 3B79A 2H1RA 4HVBA 4P1CC 1XLNA 3IUTA 3HU2A 3QA8A 2OJWA 2R9CA 4GMQA 3Q3OC 5H37D 1IN4A 1YNTE 2AU1A 2DCBA 4G3XB 2ONQA 3BINA 1T0QC 2LNHC 4LFAM 1U9XA 4QOZC 3ML9A 2ZTCA 3DOWA 3GLHB 5FTNA 1HQYE 4IBCA 1VZ8A 2MJDA 1KOTA 2DNFA 3I06A 3GOEA 4GSWA 5G55A 2R9MA 2Z8LA 5CTRC 2A5UA 2L7HA 2E6XA 3BPMA 4JI4M 4A3OA 1E8YA 2ASQA 3ALBA 2BS4B 2WXMA 1K52A 4JL9A 1WX8A 1GB4A 2I1JA 4WWNA 2H89B 2DYBA 2AWTA 2BJVA 2L0TA 2J7OA 2EKEC 1Y8RC 3UINB 1NYQA 3PNRA 1D0KA 4WJPA 3KP1E 3DVNU 5DPRA 4W5WA 4B95A 3KW9A 4OEMA 4LZJA 2KC2A 3U61B 2M5ZA 1MHHE 4F1SA 3L0WB 4RGTA 3RYTA 4BBNF 1BT0A 1WJNA 4ZRJA 5ITXE 3MK6A 3QJZA 2LJ5A 3R7QA 1PJQA 3KWVA 1U5IA 4BOQA 2CRUA 3L27A 1IGDA 1WGYA 1PGBA 5BMHA 3VQIA 4KIKB 1UWXA 1Y56A 1IXZA 1HT2E 3A4RA 4JI5M 4KGRA 5CVMA 4NRVA 1DYQA 1IXSB 2IBIB 5H8YE 2F7DA 2WXOA 3O13A 4RF0A 1BQIA 4J6IA 3HKPA 4HJKA 3E46A 1IY2A 3VFKA 1HQCA 1FJGM 3KVFB 4GDKA 4G11A 1E0ZA 4ICUA 3IG5A 4B7GA 4NY0A 1R7RA 4GITA 4G3OA 1PXVA 2REXA 4JIOU 4TUUA 1C76A 3SHGB 2ZANA 1WR6E 2XSZD 2FNAA 1HXYD 3W31A 3SBJA 2ICIA 2LXCA 4EE2A 2IBIA 1IXSA 1WZ3A 3HIZA 1K82A 1DGGA 2NTTA 4ZHPA 5EE9A 4IM3A 2JY6A 3ZO5B 3EHVA 1TR8A 3EECA 2RD0A 3B9JA 4UDUC 3AE6B 1SNKA 1VDDA 1ZUD2 3EIHA 4XX5A 3P5WA 1ZDVA 4KGSA 1V1OA 2LRWA 3IHPC 5KHQA 3TEYA 1EWYC 3OJ4B 4LGMA 5ITUA 4LFBM 3I3TB 2MA9B 2D7EA 2LJIA 4ACFA 4CHTB 3AU4A 1WGLA 4AJWA 2EUCA 2I7PA 2WXNA 3IG8A 1DO2A 4LRTA 4GHAA 2PJHA 1YSYA 3ZW3A 1M94A 5KQ8A 3UGJA 1V49A 1YQ3B 1SF0A 3GO8A 2CFOA 4DV4M 3GRUA 2C7HA 3BOWA 3P5UA 2QCUA 2CHGA 2LVQA 3EC8A 3ZNZB 1QDQA 2K39A 3I01M 2RGHA 4A3PA 3VH3B 4E74A 4IWPA 4K7WA 1EUVB 3A9KB 1K53A 3H8HA 2JRHA 2NVUI 2E03A 3Q3FA 3SU8X 3I3TA 2EA0A 1VZ7A 3RZWC 4LRSA 3BBAA 3B7QA 4MGYE 4NOOB 2AX5A 5EJCA 1QKZA 1QOGA 2Z0DB 5ITYA 1Z5CA 2RPQA
chains in the Genus database with same CATH topology
1FRRA 4GH9A 4OHJA 3FUXA 2CE7A 3K92A 3SFDB 3GQ3A 4DV7M 2W3RA 2BJWA 4AKHA 3TEXA 1KYIA 1N5XA 1EE8A 2HHHM 4FVMA 1DOIA 3T1YM 4L15A 3R8BA 2G1EA 3AE7B 3VLFB 2J52A 1ZAEA 3HHZA 1KF6B 4FWHA 3RGPA 3AOEA 1XMQM 3IAS1 3BK2A 2KXEA 4L16A 3TSSA 4KGTA 3UMMA 1Z6TA 1T6BX 1VZ6A 4GLSC 2X38A 4GHLA 2VIIA 1G4AE 2W3SA 3HU3A 1L0XB 1N33M 1UUPA 4C80A 2G5GX 2V6ZM 1NJFA 3AEGB 4JPSA 5BPVA 1T5XD 4B7HA 2W82A 2ON8A 2R65A 1HNZM 1IBLM 4DXGA 2JYEA 3SFZA 3MHVC 1FCCC 4IBIA 2M0AA 1ZE3D 1PFDA 1QOFA 3C58A 3IXSA 4I81A 1TS5A 1CK1A 4RCOA 1YN5A 1JW9D 1KLGD 2WP9B 1LO5D 3FD9A 4DR5M 2JSVX 4ZRPA 3QWLA 4AKIA 4D82A 3VRBB 4XE0A 2HL7A 1TGUA 2WXFA 2BB5A 1IXRC 3SMPA 2OEDA 4BOZA 3GLIA 1YUBA 5FTLA 3SHFA 1L6UA 2KRKA 2V1UA 2IGGA 3NWLA 1CQVA 2AQ3B 2K22A 1W5SA 3GQ5A 1KFYB 3AV8A 1DGBA 2WXQA 3LYYA 2BS3B 4OVZB 3E9SA 3GPUA 3OQCA 2PTLA 2WNMA 1K3WA 3B2FA 1NNJA 1TH3A 1YJJA 4PT5A 2F5OA 1QAQA 3MP9A 1PYWD 4JI8M 1DKIA 4X65M 5C2TB 3KOXE 5LNK1 4HLQA 2AGAA 4A90A 3FC4A 5EXXA 3FTFA 1V97A 4KHPM 1YJIA 4A9AA 4LF5M 4DV0M 1QAOA 2R4JA 1QQWA 4MM3B 2XH9A 2R4EA 3AL0C 2KWDA 2OPFA 3SARA 2FOIC 1TKYA 2UUCM 4BOUA 2DXIA 1J09A 1NJGA 3SATA 4L2YA 2OQ4A 3Q8BA 1D2NA 1CZPA 3HU1A 3P4PB 1AN8A 4G4NA 2RGOA 2BU3A 2R46A 1NI3A 3BB7A 3BVGA 3V05A 3NUHB 5FK9C 4OZCA 1XXHB 2G8LA 4LJ5A 2QBYA 1Z5AA 1C9FA 1L4DB 1I4GA 3W5VB 1DGHA 3P42A 4I8OA 4RKXA 1SSNA 3KVWA 2GRIA 3L28A 3GP7A 1FNNA 2B76B 1SXJE 1HEZE 3Q69A 4YY3M 1N36M 3ZCBB 2QEJC 2RDHA 2WXJA 1STEA 4IBBA 5KO3A 5A2QS 1WRIA 2R18A 1XLQA 3DZDA 1XF5L 8CATA 1FCLA 2Z4SA 2ZAOA 1DO0A 3ZNHA 5C3JB 1MI0A 4BLCA 1GB1A 3E4RA 3GLFA 1BMLC 5EP4A 2UUAM 3ZQ4A 2RMMA 1D5ZC 3MP2A 4YSXB 5EXSA 2LHDA 3SR6A 3EIEA 2NMQA 1JCKB 2IGHA 3J27B 2F5SA 4JV5M 4MGHA 1RWSA 2CU3A 3BYYB 4FWDA 3Q8AA 1L2DA 5HFYA 3ZH9B 4G4QA 2K0PA 2JXTA 1KH0A 3FILB 4CISA 3U6LA 3FUVA 1NYRA 2IDYA 4HKZE 4ZHOA 1ACCA 4R3DA 5KPZA 2V0GA 5ITXA 1JR3D 5F3WA 4GC9A 4IIWA 2WXKA 3AE4B 2Y0TA 2YR0A 3ILKA 1AW7A 5DYIA 4DV1M 4M9ZA 3WHLA 3U4EG 1TS2A 2WXGA 1XWIA 1C4AA 5BYRA 1F77A 3KQ4A 3FILA 3LQQA 2YEPB 1V1PA 3GPYA 4D8IA 4N6EB 1G8PA 2L09A 4B3SM 5KQDA 1BUIC 4B08A 4JWUC 4G4RA 2XNAC 4PDIA 2K5PA 3O65A 3KOYE 1FNWA 4KODA 5EP1A 2K9XA 4YSYB 3NS1A 1NENB 2X8AA 1IN5A 1ZOYB 4MB7A 1Q39A 4CQNA 2C98A 2WDVB 2Y5CA 3VK7A 1J7BA 3AJIB 1N5WA 1IN7A 5ITTA 4JI0M 4KKJA 3DFZA 2WDQB 2FE8A 4ZOHC 1IY0A 2I7NA 3FYCA 2CUZA 2O5RA 2L7IA 5KPRA 5HG2A 2PKOA 3HJQA 3I4YA 2R61A 3MTVA 4JYAM 4DR1M 3U6MA 4LG2A 2FBWB 2LH0A 5JZEA 3BIID 2J4XA 1L2BA 1ESFA 4DR4M 2LUMA 5FTKA 4USAA 1OQRA 2DZOB 3FTEA 3LB8C 4LF6M 2KZSA 5KPTA 1R7SA 1TH2A 3MFGA 2BT6A 2UXCM 3D8BA 5JI2E 3AE8B 1Z59A 2IPKD 1FO4A 3T1HM 3OTOM 2L83A 1QOAA 3VDUA 1GLNA 1SXJC 2Q5WD 4WAFA 1TYGB 4XDCA 1TKEA 3EA6A 4LTUA 2LMCA 2P5TA 4GDKB 3I51A 5C18A 1D6EC 3KOZE 4JI2M 3FTCA 1QT9A 2CEAA 4J3OD 3AV0A 1IY1A 4US9A 4FCVA 1WSPA 2KA6B 1TY0A 5H92C 1B9RA 2YQZA 4LY6A 4JI1M 1P7FA 5DNYA 4IDIA 1HT1E 3TEWA 1YQ4B 3Q8EA 3BVZA 3M7GA 4HEA1 2G9HD 4US8A 1E7PB 1FNVA 3UI3A 4PDGA 4DV3M 4HKQA 1QAMA 3AE2B 1W5TA 5FR3A 3VK8A 1VR9A 3FUUA 4AG6A 4MI7A 4LF4M 1F2RC 3GRYA 4TQ0A 3KS4A 4QNMA 1WWTA 2HTME 4FCTA 5BR8M 3CWIA 1S3SA 3H4MA 1L6VA 4RGMA 5D7GA 3TWLA 2AQ2B 2Z84A 2MH7A 4GIPA 4D81A 2AQ1B 2W54A 3KXEC 1UGJA 1IQPA 1NY6A 5GKNA 1OJLA 3N9YC 2XGNA 3VR9B 4NAMA 2LWXA 2Y5PA 3L2AA 1GL7A 4L78A 1FIQA 4KKIA 1ORYB 2RDGA 2UZJA 4IOIE 2BW2A 5E26A 1HA5A 3FYDA 3RGSA 3CF2A 4ZYSA 1JROA 2E3TA 2V3PA 2I38A 2DWLA 1SXTA 3U60B 2N7JA 2FUG1 3GPPA 5TSSA 3TWMA 1E10A 3A46A 4JWSC 4YXDB 3NVVA 1TJEA 1OFIA 3SAUA 1M4VA 2KQ4X 3ZGZA 1EU3A 1EWCA 1HQRD 2HDEA 5AUKA 3U60A 4DUZM 3B2GA 1SE4A 4A5UA 1YZBA 4Z6YA 3QAUA 1NEKB 4C7YA 1L2CA 5D3DA 1V8CA 3AEAB 5FSWA 5ITRA 3T3OA 4A55A 3TWKA 2L6OA 1TS4A 3KOWE 3PRPA 3GRRA 2YFQA 5E6JA 3PSEA 3BYTB 4BBAA 1N32M 4X62M 4AS1A 1JWMD 4JXJA 3RFWA 1IBXB 3GLIB 3DWGC 2BTWA 2DWZB 1FFUA 3TMPA 1SXJA 4WW0A 4IP3A 3HUIA 3PNVA 4WH4A 3KFUG 1KTKA 2BB6A 2WXRA 4LJAA 1H6UA 1C78A 2EO2A 1R2YA 3BWUD 3NVYA 4DR7M 4X66M 2KEBA 3SYKA 4R7GA 3MC0B 1E9RA 4MGKE 3UZUA 1IBXA 3HVDA 3AFHA 1WYGA 4N58A 4TSSA 1MPEA 3AE5B 3PZ8A 2J7QC 4FD2A 1QANA 2DWMA 2E5LM 5IT9S 1C4CA 2Y3AA 5BYSA 2AHMA 2LGIA 2ZW0A 4LLGM 1N34M 4LFCM 3FUTA 3M6AA 1HNXM 4JI3M 1SJED 1EU4A 5IZ7D 3AB5A 5EZSA 1OFFA 1XHBA 1E9SA 1L5PA 1VJKA 2C9OA 1GKIA 2CV2A 1FXIA 3TE6A 1OQQA 4P6VF 4A3VB 3NVWA 2Y21A 4HXDB 2ZBKB 3VR8B 1IUEA 1UKFA 1WGKA 3LQRA 3RNVA 2F4VM 4NJCA 1SE3A 1ZPSA 2YNMD 1I4PA 3SAVA 2XN9C 1E6EB 1NVID 4XDDA 3HHWA 5BMIA 1Z5CA 1A70A 4A6QA 5T8IA 2KAJA 4ITKA 2RPVA 1E9MA 2M60A 1HZ5A 2MEKA 2LXEA 2ZW1A 2QBYB 2DOSA 4M9XA 1NHWC 1DGHB 3KSXA 3KP0E 2KACA 1KLUD 4M0DA 4OX9M 2V1CA 2ZAMA 3P4QB 3M0EA 3VRAB 2WU5B 4G4OA 2UU9M 3GLGB 3A98B 2EELA 2PVGC 1PGAA 3L4PA 4AKGA 4OW0A 3VFDA 1EM7A 1N63A 1LV7A 1RFKA 1QLBB 1IN6A 1F2RI 1QYRA 2JRIA 1JWAD 3HHXA 2BBCA 4GC5A 4FCWA 3CIRB 1T3TA 2HKJA 3GLFB 4YTPB 2CHVA 4IBGA 4AQYM 3BVMA 5G5GA 1E94E 3GLGA 4B3TM 4MGIE 1DOXA 5IWAM 3GRVA 1SE2A 1JALA 4LJ9A 2K47A 3AEEB 5D3IB 5ITQA 4TMAB 3ZJVA 3PRMA 4JI7M 2UXDM 1PVJA 3GQ4A 3JR4A 4L1BA 2V3NA 4DR3M 2RKOA 4I4LA 4MGZE 3AMZA 4WIPA 2A5YB 4ZPXA 1VDVA 4S12A 1N78A 3A45A 4DUYM 1JWBD 1I7HA 2ERCA 3KW6A 4IBFA 2C9CA 4YSZB 1HR0M 3AE9B 3V3XA 2DHRA 1L4ZB 4XZXA 2DZNB 3FKEA 3K2LA 5EP2A 3SEBA 1V1PB 4NZLB 3L25A 4GUAA 3P1MA 2CJOA 4NAWB 2VQFM 2H88B 1L8QA 1D5XC 1C79A 2J7QA 4GRIA 5C1BA 2EKIA 3ZC7B 4QHSA 1I4QA 3TRKA 2QIEB 2R45A 1QVRA 5FLXS 5ITYA 1N75A 2V4IB 1YE9A 3WHKA 3C8YA 2DLBA 2SEBD 3TPZA 3FUWA 1F0ZA 4YTMB 4AG5A 4LJ7A 1TS3A 4DV6M 2UUBM 4M0WA 1YN4A 3K1JA 2JYTA 1L1TA 4NSRA 2ZM6M 1ENFA 4KLNA 1C77A 1KSFX 3W0FA 3WCQA 1FEHA 1GPXA 1ET6A 3I57A 4YT0B 3KS8A 3IFUA 2D7GA 3AOGA 4Q2JA 1C1KA 3GP1A 4OZAA 1N61A 4AI6A 4IBDA 2KRUA 2KN4A 4DV2M 3AEBB 3D8LA 4C7ZA 3IT4B 3HHYA 1GVNA 5FKAC 4WWMA 3A42A 3NBIA 4A8XC 2INPE 5EZQA 1K50A 3AE3B 3ZYYX 5HHDG 4BOPA 2LHEA 3I9V1 3ZJUA 1JWUD 3AKZA 3L29A 3U6OA 2JX5A 2QMTA 4B0EA 1GOZA 3FAHA 1UNSA 3R2IA 2PMVA 3PHWA 4TQ1A 3SMSA 2Z4RA 3E56A 3T15A 3MHZA 1K3XA 2BTEA 3BY4A 4RF1A 3PHUA 1ZXIA 2XSZA 3U6QA 2F5NA 1Q10A 1XC8A 1SJHD 4RGNA 2VQEM 2INNE 2JU6X 3AM9A 4O1NA 3EUB2 2D7HA 4N59A 3JAMS 5BYQA 2WS3B 1YMHE 4LCBA 3B21A 3GLHA 1AYFA 1B1ZA 4PCZA 1D4BA 3CTWB 4B0MA 3PXGA 3TQSA 2YEPF 1JQ4A 5EP3A 1I4WA 2CJNA 4YHHM 3U61A 3DOAA 1MVKA 3MJ5A 3W1SA 1XCTL 4LF7M 1FRDA 1SB3C 3VKGA 2JTCA 2DBYA 1XCQL 2TSSA 3IT6B 1RYJA 2F5PA 4BB9A 1ZDXA 1GL6A 2WQYB 3P4SB 2KZUA 3HVZA 5MPOA 1DGJA 2L52A 4FW9A 2CV0A 2DVWB 2DWNA 3NZ3A 2XFTA 1MHXA 2BS2B 2I2YA 4JN6A 2N9KA 2WXPA 4DV5M 1IN8A 1SBBB 2BNKA 2XZFA 2MJ3A 1T3QA 1NY5A 1PJJA 4HJGE 1IBMM 4OU7A 1TKGA 2C96A 1FD6A 4ZTBA 1XNRM 3HJSA 1HNWM 5DYGA 3BOSA 5EE3A 2M56B 5EXPA 3JR5A 4LF8M 2OHFA 1R6BX 5EXTA 1JRPA 4D8BA 5G5HA 4QNRA 1RM6C 2XFSA 4K0KM 2VZKB 1FXAA 2IGDA 4NXNM 1KRHA 2UXBM 2SAKA 1XMOM 1NHGC 2DYMA 3DA1A 3GS2A 3C0RA 2CV1A 3U6PA 4GKJM 4AW4A 4G6ZA 4NRWA 4REZA 2BTWB 2XF3A 1SEBD 5IREB 3L26A 3W5UB 1SXJB 3PVSA 4ITQA 2L32A 2W55A 1L1ZA 5JXVA 4OZBA 4H2AA 3PT2A 3AECB 2GI9A 4IBJA 4RFBA 3KLSX 2QP9X 1JMLA 4IJFA 4XGIA 3TUOA 1TY2A 4XBOA 3KWLA 4C56C 3KDSE 3URYA 5EE0A 2QENA 2Z3XA 1N62A 3R8FA 2IJ0A 5GXGB 5FTJA 1MX0A 5AUIA 2NTSA 2WDRB 1G3IA 1N60A 3VKHA 2HCBA 3RPFC 1L0VB 3THGA 2WXHA 2Y20A 3P63A 4QHTA 3KSJA 1I4RA 3U52E 1QQRA 3I4VA 2C99A 1FM0D 2J7NA 1Z5BA 3IAM1 2J53A 1OFHA 3W30A 3PZ7A 2VZKD 3J9CA 1WXQA 4LJ4A 4FXCA 3PHXA 1XLPA 1J7CA 3HGIA 2QZ4A 1XLOA 1K51A 1PM5A 1R2ZA 2JZPA 4JI6M 3Q8FA 1GAQB 1FNUA 3NVZA 1L0YB 1TH4A 1SXJD 4JX1C 4D80A 2ACZB 1TDZA 2XEPA 2KW0A 4DR6M 3ETRA 1PJIA 2K3UA 1G59A 4IBKA 2Y0QA 5EQTA 1QZMA 2M19A 3J7BA 1UWMA 3P4RB 4M9SA 3AEFB 4LJ6A 1P7EA 2QILA 3SFEB 2X4AA 4WURA 1Q3BA 4KX6B 1J7KA 4OVZA 2XZUA 1J5EM 4GKKM 4WQMA 3AH7A 3BZDB 4MT5A 4IJEA 4YTNB 3HWSA 4QOSA 4L4UA 2KMMA 2X49A 2N0SB 4HRSA 3UJNA 1ROEA 3W9CB 1G41A 3K8ZA 4I5SA 1I4XA 3U6DA 1NSFA 1IBKM 2N9LA 1KFVA 2WLBA 3PFIA 4AQ7A 2R62A 1ZQ9A 2PVOD 1SIJA 1C4PA 3TEZA 4DQOC 3RFZB 2WXLA 3DWMA 3TL4X 1XO3A 4L8RC 1PGXA 2WXIA 2BYTA 4D8EA 3LMMA 2WU2B 3J7AS 1JQJC 4XWTA 5BMGA 3UK6A 2QJLA 4RGOS 3RE8A 1UM8A 1X37A 2XLJA 1TDHA 4XWWA 1XXHA 3R2TA 3R9XB 3LVVA 1D5MC 3PO0A 1BXTA 4GDLB 1JR3A 3CF0A 4YWGG 4IBEA 1DOYA 3U2SC 4TUWA 1J7AA 4AZFA 7CATA 1IGCA 3HJ8A 1PDXA 2NQ8C 3OWEB 1I4HA 1QOBA 2L1AA 2QPAA 1ET9A 3AEDB 1XXGA 2F5QA 2CHQA 1ZP0B 4JE3B 5EE1A 3ZJTA 4FWGA 1TZOA 2J42A 1Q3CA 3GB1A 3LVWA 3PNYA 2LEKA 3GPXA 3SC3A 3U6SA 1PUTA 4NL4H 2QSDA 2LFIA 3T38A 4MH8A 1MU5A 1E32A 3EGRA 4Z8XA 3AE1B 3ABVB 3BK1A 4X64M 5HI1A 5I4DA 3U7ZA 4LGYA 4MH0E 3J81S 3AN1A 1XNQM 1IM2A 1FFVA 3LXFA 2Z7JA 5JI3E 1CJEA 2GB1A 2C5RA 1AWDA 4B7FA 4LJ8A 1NNUC 3J80S 1JWSD 4KO8A 3CF6E 1HZ6A 5LMUM 2FFJA 4LF9M 1XEEA 2Q2EB 4LK0M 4EIWA 3NRZA 2JQRB 3U6CA 4PD2A 3J2PB 3W0LB 3Q8XA 2HWKA 4RH6A 3U5ZB 1N77A 2PW9A 4NXMM 4MACA 3SYLA 4P16A 1VLBA 4DR2M 1NVMA 1VRAB 3SAWA 3FTDA 4DXFA 4ARCA 2JA2A 4NSOB 3W2DA 5LMNM 2D5GA 4HL4A 1QF6A 4IUMA 2DYOA 3U6EA 1FMAD 2JWUA 3U5ZA 1ZXHA 4CGYB 3HRDD 2KDMA 2DWQA 1I94M 4D2KA 3B9PA 2MJEA 1QILA 3Q8CA 3VDPA 3T3NA 4II7A 4RNAA 1DGFA 4L23A 5FTMA 4ZRQA 4LZZA 1YN3A 4ARIA 4B3RM 3AOEC 4HROA 4B3MM 3SASA 4IKGA 4BOSA 2H1RA 1XLNA 3HU2A 4GMQA 5H37D 1IN4A 1YNTE 2ONQA 2LNHC 4LFAM 4QOZC 3GLHB 5FTNA 1HQYE 4IBCA 1VZ8A 2MJDA 2Z8LA 2L7HA 2E6XA 4JI4M 2BS4B 2WXMA 1K52A 1GB4A 2H89B 2BJVA 2J7OA 1NYQA 3KP1E 4W5WA 4LZJA 3U61B 2M5ZA 1MHHE 4RGTA 5ITXE 3MK6A 3KWVA 4BOQA 3L27A 1IGDA 1PGBA 5BMHA 3VQIA 1UWXA 1Y56A 1IXZA 1HT2E 4JI5M 4KGRA 4NRVA 1DYQA 1IXSB 5H8YE 2WXOA 3O13A 4RF0A 3HKPA 1IY2A 1HQCA 1FJGM 1E0ZA 3IG5A 4B7GA 1R7RA 4GITA 1C76A 3SHGB 2ZANA 2XSZD 2FNAA 1HXYD 3W31A 3SBJA 2ICIA 4EE2A 1K82A 1DGGA 2NTTA 4ZHPA 5EE9A 3B9JA 4UDUC 3AE6B 1VDDA 1ZUD2 3EIHA 1ZDVA 4KGSA 1V1OA 3TEYA 1EWYC 4LGMA 5ITUA 4LFBM 2D7EA 2LJIA 4CHTB 2EUCA 2I7PA 2WXNA 3IG8A 1DO2A 4LRTA 4GHAA 1YSYA 5KQ8A 3UGJA 1YQ3B 1SF0A 3GO8A 2CFOA 4DV4M 3GRUA 2QCUA 2CHGA 2RGHA 1K53A 3H8HA 2EA0A 1VZ7A 4LRSA 3BBAA 4MGYE 2AX5A 4NOOB 5EJCA 1QKZA 1QOGA 2PLPA 2PIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJ5 A;  4RF1 A;  5KO3 A;  4OVZ A;  4OVZ B;  3E9S A;  3MP2 A;  2FE8 A;  4REZ A;  4OW0 A;  4MM3 B;  4M0W A;  4PT5 A;  4RNA A;  4R3D A;  4WUR A;  4P16 A;  5E6J A;  4RF0 A; 
#chains in the Genus database with same CATH topology
 1FRR A;  4WJO A;  1QMY A;  4GH9 A;  2DZI A;  2L4E A;  3C0R B;  4OHJ A;  2BDZ A;  3FUX A;  3PVL A;  3L08 A;  2CE7 A;  2DAJ A;  4LCD E;  3K92 A;  4ZRK A;  3HM6 X;  5L95 C;  2INC C;  3SFD B;  1THE A;  3A9K A;  3GQ3 A;  5J94 A;  4DV7 M;  2W3R A;  1U9V A;  2JXX A;  5AZH A;  2ZTD A;  2V3S A;  2DZK A;  2KVZ A;  2BJW A;  4AKH A;  4C4V A;  1X1M A;  2IO2 B;  3TEX A;  2DC6 A;  1ZCM A;  1CVZ A;  1KYI A;  3KUC B;  3PT2 B;  1WXS A;  4WJN A;  2HAK A;  3RCZ A;  1MJD A;  3KFQ A;  1N5X A;  1EE8 A;  4HEO A;  3K24 A;  2HHH M;  4FVM A;  1DOI A;  2L0F A;  1T0R C;  3T1Y M;  4L15 A;  3R8B A;  2G1E A;  3AE7 B;  2FIF A;  3VLF B;  1VD2 A;  1ZAE A;  2BYF A;  1UEL A;  2J52 A;  2ATO A;  3HHZ A;  1KF6 B;  5JHA A;  2CB5 A;  3U8E A;  4FWH A;  3RGP A;  2J5Y A;  3VUY A;  3AOE A;  1XMQ M;  2NCN A;  3E21 A;  3IAS 1;  3BK2 A;  2KXE A;  4L16 A;  3OG5 A;  3TSS A;  4EFO A;  1BGO A;  1YIW A;  4KGT A;  3M62 B;  3UMM A;  1Z6T A;  3VH4 B;  4EEW A;  1T6B X;  1VZ6 A;  4GLS C;  2X38 A;  4GHL A;  5EDS A;  2VII A;  2DZZ A;  1LM8 B;  2DI0 A;  1G4A E;  2W3S A;  5DCN A;  3HU3 A;  3ZXV A;  1BP4 A;  1L0X B;  1N33 M;  1UUP A;  3B89 A;  4C80 A;  3R66 C;  2OUL A;  4YYU A;  2G5G X;  2LVN C;  3TNX A;  2V6Z M;  1NJF A;  1P3Q U;  3AEG B;  4WQO B;  4JPS A;  3MMP A;  1YOV B;  5BPV A;  1T5X D;  4B7H A;  2W82 A;  2UU7 A;  2ON8 A;  2R65 A;  3HHI A;  3S3R A;  3P5X A;  1V6E A;  1XD3 B;  1HNZ M;  1IBL M;  1OIP A;  2ZNV C;  2AUX A;  4DXG A;  2JYE A;  3SFZ A;  3MHV C;  1F9J A;  1FCC C;  3N3K B;  4MDK E;  2XEW A;  2DCA A;  1PPO A;  2KWU B;  2DZJ A;  2H7J A;  4IBI A;  2N4F A;  1AU2 A;  2M0A A;  1ZE3 D;  5C1Z A;  4BOZ B;  1CQD A;  1PFD A;  1QOF A;  3C58 A;  2D10 A;  3IXS A;  4I81 A;  1TS5 A;  3PHX B;  5FPW A;  2OOB B;  1UH6 A;  1CK1 A;  4RCO A;  1ISN A;  1YN5 A;  1JW9 D;  2MBE A;  1KLG D;  2ZCC A;  3BPF A;  2WP9 B;  1LO5 D;  3FD9 A;  4DR5 M;  2JSV X;  4ZRP A;  3QWL A;  4AKI A;  4D82 A;  3VRB B;  4BPV A;  4XE0 A;  2HL7 A;  1TGU A;  1VG5 A;  5PAD A;  2LVA A;  3AI8 A;  2WXF A;  2BB5 A;  3P5V A;  1IXR C;  1P1A A;  3SMP A;  2OED A;  3QHT A;  4K7S A;  4BOZ A;  3GLI A;  4FA6 A;  2KNA A;  5DPW A;  1YUB A;  3LXS A;  3QT4 A;  2OOB A;  5FTL A;  4W9G A;  3SHF A;  1L6U A;  2CIO A;  2L05 A;  2KRK A;  2V1U A;  2IGG A;  3E1Z B;  3NWL A;  3ECI A;  1FPY A;  2R2O A;  4P6G A;  1CQV A;  3GCB A;  2YJ2 A;  2AQ3 B;  4HWI B;  2K22 A;  1W5S A;  3GQ5 A;  3UF8 A;  5IO9 A;  4ANV A;  1KFY B;  3AV8 A;  1DGB A;  2KDL A;  1EWM A;  1T0Y A;  2JY7 A;  2WXQ A;  3LYY A;  3UIP B;  4WWP A;  2BS3 B;  4OVZ B;  3E9S A;  3GPU A;  3OQC A;  2PTL A;  2KHW B;  2WNM A;  1K3W A;  3B2F A;  3L54 A;  1NNJ A;  1CPJ A;  1TH3 A;  2KJH B;  1WYW B;  1YJJ A;  1OAO C;  4PT5 A;  2F5O A;  1QAQ A;  3MP9 A;  3IHP A;  1PYW D;  4JI8 M;  1DKI A;  4X65 M;  2KFK B;  1CSB B;  5C2T B;  3DDC B;  3KOX E;  3UGB B;  5LNK 1;  1QXP A;  4W9D A;  2IZV B;  4K81 A;  4HLQ A;  2AGA A;  2FCQ A;  4A90 A;  3T6P A;  3UIO B;  3FC4 A;  5EXX A;  2L76 A;  3FTF A;  1V97 A;  4KHP M;  2K25 A;  1YJI A;  2N9X A;  1GNU A;  4FK5 A;  2Y5B B;  2UWQ A;  3HY5 A;  4LF5 M;  4A9A A;  1PPP A;  4DV0 M;  1QAO A;  2R4J A;  1QQW A;  4MM3 B;  3KWZ A;  1MHW A;  4C00 A;  2XH9 A;  2R4E A;  1EWO A;  3APD A;  3BCN A;  2WX0 A;  2ZVN A;  1HJP A;  3AL0 C;  3N3G A;  4HXD A;  4GMV A;  4II2 B;  2KWD A;  4ZUX U;  2OPF A;  2WYQ A;  3SAR A;  2FOI C;  1TKY A;  2UUC M;  3PLU A;  4BOU A;  1WGR A;  3N4C A;  5A24 A;  2DXI A;  1J09 A;  1NJG A;  3SAT A;  2DAF A;  2LZ6 A;  4HK2 A;  2BGF A;  4L2Y A;  4NQL B;  2JP7 A;  2OQ4 A;  3X23 A;  3Q8B A;  4ANX A;  2Y5B A;  4IM0 A;  4HDQ A;  1D2N A;  2KMC A;  1CZP A;  3HU1 A;  3F5V A;  3P4P B;  4XZ4 A;  3WIM A;  1F4I A;  3ZVV A;  1ME3 A;  1AN8 A;  1KFX L;  4G4N A;  2RGO A;  1YT7 A;  2BU3 A;  4EKU A;  2R46 A;  1NI3 A;  3B7Z A;  3BVG A;  3BB7 A;  3V05 A;  3VVW B;  3NUH B;  5FK9 C;  4OZC A;  1XXH B;  1WXV A;  2JNH A;  2G8L A;  1SE9 A;  4LJ5 A;  1HTQ A;  4X6I A;  2QBY A;  1Z5A A;  1C9F A;  1L4D B;  1I4G A;  3W5V B;  1DGH A;  3P42 A;  4I8O A;  4RKX A;  1PPD A;  1SSN A;  4NQK E;  3KVW A;  4IWQ A;  2GRI A;  3L28 A;  3GP7 A;  2KZR A;  1FNN A;  2B76 B;  4W9H A;  1SXJ E;  1HEZ E;  2YJ9 A;  3Q69 A;  4YY3 M;  1JQP A;  1N36 M;  2DC9 A;  3TCA A;  3ZCB B;  2QEJ C;  2RDH A;  5JH5 C;  3NZS A;  2WXJ A;  1STE A;  4IBB A;  5KO3 A;  5A2Q S;  1A5T A;  2DKL A;  3LCV B;  1WRI A;  1GCB A;  1TGZ B;  4K1R B;  3GE8 C;  2R18 A;  1XLQ A;  3DZD A;  3KX1 A;  1QDR A;  4LDT B;  2MP2 B;  1XF5 L;  8CAT A;  1FCL A;  4CDD B;  1WJ4 A;  2Z4S A;  2ZAO A;  1DO0 A;  2KJ6 A;  3ZNH A;  2MH8 A;  2XU5 A;  3PW3 A;  3I5J C;  5C3J B;  1MI0 A;  4BLC A;  2C7N B;  3OF9 A;  4ANW A;  1MIR A;  2GBN A;  1VEK A;  4P6E A;  1GB1 A;  3E4R A;  3NBX X;  3GLF A;  1BML C;  5EP4 A;  2UUA M;  3ZQ4 A;  1EFU B;  1NPZ A;  3M99 A;  2RMM A;  1A6R A;  1QOL A;  1D5Z C;  3MP2 A;  2M0X A;  4YSX B;  5EXS A;  5EGW A;  1OIZ A;  2LHD A;  4AWJ A;  3SR6 A;  2MP2 A;  3EIE A;  4E3C A;  2NMQ A;  1JCK B;  2IGH A;  3RN9 C;  1U9Q X;  1V5O A;  3J27 B;  2F5S A;  3N32 A;  4JV5 M;  4MGH A;  1RWS A;  2CU3 A;  3BYY B;  4QRX A;  3MHS A;  4FWD A;  3ML8 A;  3RUL A;  1WJ7 A;  3PDF A;  3Q8A A;  1L2D A;  2EJS A;  1R4N B;  3DQV A;  3L13 A;  1NV9 A;  5HFY A;  3ZH9 B;  4DHZ E;  2N1W A;  4G4Q A;  2BWB A;  2K0P A;  2JXT A;  4DHJ D;  1KH0 A;  3FIL B;  4CIS A;  3V6C B;  4R71 A;  3U6L A;  3FUV A;  2DAM A;  1NYR A;  2IDY A;  4PI3 A;  4HKZ E;  1F2C A;  4ZHO A;  2BWE S;  3WXF A;  1ACC A;  4R3D A;  2AIM A;  5KPZ A;  2V0G A;  4GN1 A;  5ITX A;  1JR3 D;  2KQS A;  5F3W A;  4GC9 A;  4IIW A;  2WXK A;  3KW5 B;  1EIJ A;  4GOC A;  3AE4 B;  2Y0T A;  1H4R A;  4PYZ A;  2YR0 A;  2AYO B;  3ILK A;  1AW7 A;  1F52 A;  5FR6 A;  3ZTC A;  3DBS A;  4P17 A;  5DYI A;  4DV1 M;  2FCM A;  3QAR A;  3JW0 X;  4BSQ A;  4M9Z A;  3WHL A;  3U4E G;  1WMH B;  1YLA A;  1XKG A;  1TS2 A;  2WXG A;  2FRQ A;  1XWI A;  1C4A A;  3N1Z C;  5BYR A;  4M02 A;  1F77 A;  3FIL A;  3KQ4 A;  3LQQ A;  2YEP B;  1V1P A;  1ZGU B;  3K9O B;  4IUM B;  3GPY A;  4D8I A;  2DAE A;  1SIF A;  4N6E B;  4BKS A;  1G8P A;  2L09 A;  5J2R A;  4B3S M;  2KDB A;  5KQD A;  1BUI C;  1TT5 B;  4B08 A;  4JWU C;  4PS3 A;  4G4R A;  3W1Y A;  2XNA C;  2DAI A;  2AYO A;  3DVG X;  4MSX A;  3RI7 C;  1RRB A;  4PDI A;  2MSE D;  2K5P A;  3O65 A;  3KOY E;  1FNW A;  3D6S A;  4DBG B;  3NOB A;  4KOD A;  5EP1 A;  4KZ0 A;  2K9X A;  3BC3 A;  3C19 A;  2PBH A;  4YSY B;  4YVA A;  1WR1 B;  3A1Q A;  3NS1 A;  2N9E B;  2EMT A;  3JSV B;  4GU2 A;  1NEN B;  2X8A A;  1IN5 A;  1ZOY B;  4MB7 A;  1WHC A;  2LD9 A;  1U4A A;  1Q39 A;  4KLB A;  4CQN A;  2C98 A;  2O6V B;  1J7B A;  3VK7 A;  2WDV B;  2Y5C A;  3CST A;  3AJI B;  1EWL A;  2P7U A;  1N5W A;  2JPH A;  3MOR A;  1IN7 A;  5ITT A;  3H89 A;  4JI0 M;  3GZN I;  4KKJ A;  3DFZ A;  2WDQ B;  2FE8 A;  4ZOH C;  1IY0 A;  4DBG A;  5TR5 A;  1PPN A;  2I7N A;  3FYC A;  4FUL A;  2CUZ A;  5J17 A;  1GC7 A;  5DFL A;  2O5R A;  3HD3 A;  3RUI B;  1VDL A;  2L7I A;  4AOF A;  5KPR A;  5HG2 A;  5IA7 A;  1AYV A;  2PKO A;  3HJQ A;  2LTU A;  3I4Y A;  1XB2 B;  2R61 A;  4P7I A;  3KKU A;  3MTV A;  2IY0 B;  4JYA M;  2NS5 A;  2P0R A;  2O6V A;  3KH0 A;  4DR1 M;  4XK8 F;  5KHO A;  3ZDM C;  4DDI D;  1TTN A;  4IM2 A;  4XYC A;  3U6M A;  3R3M A;  4LG2 A;  2FBW B;  4XR7 A;  2LH0 A;  4N8W A;  5JZE A;  3BII D;  2J4X A;  1L2B A;  2PPH A;  1ESF A;  4EUT A;  2G7Y A;  1E8Z A;  4DR4 M;  2LUM A;  3LJ3 A;  5FTK A;  1LXD A;  1V92 A;  4USA A;  4CO7 A;  2KDE B;  3A33 B;  1OQR A;  2DZO B;  3FTE A;  3ZRC A;  2XU3 A;  1WIA A;  2BPS A;  3LB8 C;  1UFZ A;  2HTH A;  2FQ9 A;  1GJS A;  3NHE A;  4WA6 A;  4LF6 M;  3X0W A;  2GBK A;  1RU3 A;  2KZS A;  5KPT A;  2B3T A;  2KLC A;  3ONS A;  3TJP A;  1VQ1 A;  5HKH A;  2KXJ A;  1R7S A;  1TH2 A;  3MFG A;  2BT6 A;  2UXC M;  4W9E A;  4YV8 A;  3D8B A;  5JI2 E;  1WRD B;  3AE8 B;  9PAP A;  1Z59 A;  3T9L A;  4CDC B;  3RNE C;  2IPK D;  2D07 B;  1FO4 A;  3T1H M;  3OTO M;  1SP4 B;  2L3Z A;  2KKC A;  1CTE A;  4N4Z A;  2N7D A;  2C5L C;  2L83 A;  2NBW B;  1PJT A;  1QOA A;  3VDU A;  1GLN A;  4S17 A;  3QIJ A;  1OEY A;  1MDW A;  2DZM A;  2HXZ A;  1SXJ C;  1V86 A;  2Q5W D;  4WAF A;  1TYG B;  4XDC A;  1TKE A;  3EA6 A;  5F02 A;  3MC8 A;  2GOW A;  4LTU A;  2LMC A;  2P5T A;  4GDK B;  1R4M I;  3I51 A;  5C18 A;  1D6E C;  3KOZ E;  4JI2 M;  2FCN A;  3FTC A;  3MJW A;  1QT9 A;  2NR2 A;  4ICV A;  2CEA A;  3V61 A;  3Q3N C;  4J3O D;  4F7Z A;  3AV0 A;  3M3J A;  1IY1 A;  4US9 A;  4FCV A;  1WSP A;  3H4J A;  3IV2 A;  2KA6 B;  3KUD B;  3Q3J A;  1TY0 A;  2KOX A;  5H92 C;  1E90 A;  2BKR B;  1B9R A;  2JZ0 A;  2YQZ A;  2R6N A;  3MHH A;  2JY6 B;  4LY6 A;  2KDF B;  4FBJ B;  4JI1 M;  1P7F A;  5DNY A;  2QSF X;  4IDI A;  1HT1 E;  3TEW A;  1UBI A;  1YQ4 B;  1IWD A;  3Q8E A;  3BVZ A;  3M7G A;  1RAX A;  3HHA A;  4HEA 1;  1POP A;  3EFC A;  2G9H D;  3PZD A;  1E7P B;  4US8 A;  3SHQ A;  3U7D A;  1FNV A;  3TL5 A;  2JY5 A;  2HJ1 A;  4XGA B;  4PDG A;  4DV3 M;  3UI3 A;  4HKQ A;  3H7S A;  1QAM A;  3AE2 B;  3Q3M C;  4BS6 A;  1ITO A;  1Y4H A;  1W5T A;  1ZW7 A;  1OQY A;  5FR3 A;  3VK8 A;  3IEC A;  3WAM A;  3UQB A;  1VR9 A;  3FUU A;  2OO9 A;  4AG6 A;  5BO4 B;  1NBF C;  4LF4 M;  4MI7 A;  1F2R C;  3GRY A;  4TQ0 A;  3KS4 A;  1NI2 A;  4QNM A;  1QZE A;  1WWT A;  3TBL D;  5CHT A;  2HTM E;  4JLC A;  1S3S G;  4FCT A;  3CMM B;  5BR8 M;  3CWI A;  4WJQ A;  1S3S A;  3H4M A;  2KX3 A;  1L6V A;  2C7M B;  4RGM A;  5D7G A;  3TWL A;  2AQ2 B;  4KDL B;  2IPP B;  2Z84 A;  2ARY A;  3FRH A;  3Q6B A;  2MH7 A;  4GIP A;  2CU1 A;  4EOY A;  4D81 A;  1WGH A;  2AQ1 B;  2W54 A;  3T8M A;  3KXE C;  1GJT A;  1IQP A;  1NY6 A;  5GKN A;  1UGJ A;  1OJL A;  3N9Y C;  2XGN A;  1J0G A;  3VR9 B;  2R44 A;  2LGS A;  4NAM A;  2LWX A;  1CB5 A;  2Y5P A;  4B9K A;  3L2A A;  2HE7 A;  1GL7 A;  1NDD A;  4L78 A;  1FIQ A;  4II3 B;  4KKI A;  2O6X A;  3H6N A;  2I1K A;  1ORY B;  1V5T A;  3SDL C;  4QRV A;  2RDG A;  3H7P A;  2UZJ A;  4C4V B;  1K3B B;  4IOI E;  3V62 A;  5CVO B;  1KJT A;  2BW2 A;  1UD7 A;  2CHW A;  4N79 A;  3C9E A;  2D3A A;  5AZF A;  5E26 A;  1HA5 A;  2M17 A;  3FYD A;  3RGS A;  4YYR A;  3DBL I;  3CF2 A;  4YL8 A;  4ZYS A;  3JYU A;  3K9M A;  8PCH A;  2K9D A;  2MGW A;  1CV8 A;  3BWK A;  1JRO A;  2E3T A;  2V3P A;  2I38 A;  1ZIV A;  2DWL A;  1SXT A;  2G8J A;  2CS4 A;  3A4S C;  3U60 B;  2L4F A;  2D3B A;  2R2Q A;  2N7J A;  2FUG 1;  3GPP A;  5TSS A;  3TWM A;  1F29 A;  1E10 A;  3GE3 C;  1AU0 A;  4W9K A;  1GAB A;  1GEC E;  3A46 A;  4JWS C;  4YXD B;  3USV A;  1NV8 A;  2MX2 A;  3NVV A;  1TJE A;  1OFI A;  1GJZ A;  3SAU A;  1M4V A;  2DEN B;  2KQ4 X;  3ZGZ A;  5D2M B;  1EU3 A;  4JQW C;  4BFR A;  4CDF B;  1EWC A;  2NPT A;  1HQR D;  3ZLZ A;  2HDE A;  2VF8 A;  2LVQ D;  5AUK A;  3U60 A;  4DUZ M;  2OJR A;  3ZRF A;  3B2G A;  1SE4 A;  1V9J A;  2NQA A;  4L6V 6;  4A5U A;  1YZB A;  2VHF A;  4Z6Y A;  3DBR I;  3QAU A;  1NEK B;  4JGH B;  1V34 A;  4C7Y A;  4F8C B;  2WBF X;  5J18 A;  1L2C A;  3HM3 A;  2DEN A;  5D3D A;  1ZKH A;  4PYU A;  2NQG A;  1V8C A;  1ZV1 A;  3GLH E;  3AEA B;  3S2A A;  5FSW A;  5ITR A;  2IO3 B;  3T3O A;  4TKN A;  3TMP B;  4A55 A;  2B1N A;  2FRA A;  3TWK A;  4HCP B;  2PRE A;  1ME4 A;  2Z8Y M;  2L6O A;  1TS4 A;  2PLP A;  2ZZP B;  3TIX A;  3KOW E;  3DVN V;  3PRP A;  3GRR A;  2YFQ A;  1YAL A;  5E6J A;  3PSE A;  4KT0 F;  4PAD A;  1WGN A;  3BYT B;  4BBA A;  1N32 M;  4X62 M;  4AS1 A;  1JWM D;  4JXJ A;  4FLH A;  4OVV A;  3RFW A;  1IBX B;  2NQI A;  3GLI B;  2D3G A;  3DWG C;  2BTW A;  2DWZ B;  1FFU A;  3WXE A;  4FN2 A;  4MSQ B;  3TMP A;  1PBH A;  1SXJ A;  4WW0 A;  4IP3 A;  4ANR A;  3HUI A;  3PNV A;  3ZTD A;  2BF8 B;  4WH4 A;  2DJF B;  3KFU G;  4W4U A;  1KTK A;  2BB6 A;  2WXR A;  4LJA A;  1H6U A;  1C78 A;  2EO2 A;  4W5B A;  1R2Y A;  2KDI A;  3BWU D;  4DR7 M;  3NVY A;  4X66 M;  2KEB A;  3SYK A;  4FHJ A;  3ZXR A;  4R7G A;  3MC0 B;  1E9R A;  4MGK E;  1Q1O A;  3UZU A;  3PPA A;  1IBX A;  3HVD A;  3AFH A;  1WYG A;  4N58 A;  2DAK A;  1MPE A;  1PJS A;  4KVG B;  4TSS A;  3VHT C;  1QDT A;  3AE5 B;  2G4S A;  3PZ8 A;  2J7Q C;  4FD2 A;  1QAN A;  2DWM A;  4Q8H A;  3CBJ A;  2E5L M;  3VDZ A;  5IAA C;  3N1X C;  5IT9 S;  1J8C A;  4DHZ B;  1C4C A;  2Y3A A;  5BYS A;  2AHM A;  2LGI A;  2ZW0 A;  4MEM A;  4LLG M;  1OAI A;  3ZKJ C;  1N34 M;  3L16 A;  4LFC M;  1WY8 A;  2VH1 A;  1MJG M;  3FUT A;  2BDL A;  3M6A A;  1HNX M;  4JI3 M;  2R9N A;  1SJE D;  4IW0 A;  4CHK A;  2KFJ A;  1EU4 A;  5IZ7 D;  2G3Q B;  4NJ7 A;  3AB5 A;  5EZS A;  1J19 A;  1OFF A;  3VXW A;  1XHB A;  3PBH A;  1E9S A;  3O0U A;  1L5P A;  1VJK A;  2C9O A;  4HPP A;  2XK5 A;  1GKI A;  1WXA A;  2CV2 A;  1FXI A;  4BBN C;  3TE6 A;  2FO5 A;  1OQQ A;  2LXA A;  2BQQ A;  2VH2 A;  4P6V F;  4DMY A;  4A3V B;  3B7N A;  3NVW A;  3IBE A;  2Y21 A;  2B1M A;  4HXD B;  3A9J B;  2ZBK B;  3VR8 B;  1IUE A;  1UKF A;  4F1I A;  1WGK A;  3LQR A;  4GGQ A;  4HCN B;  2F4V M;  4NJC A;  4FAD A;  3RNV A;  1SE3 A;  1STF E;  1ZPS A;  1QUS A;  2YNM D;  1I4P A;  3SAV A;  2XN9 C;  2G3Q A;  1E6E B;  2K8C A;  1NVI D;  1OKS A;  4XDD A;  2XU4 A;  2KNZ A;  3HHW A;  3DHH C;  5BMI A;  2MHJ A;  1A70 A;  4A6Q A;  2D2Q A;  1YX5 B;  5T8I A;  2KAJ A;  3A9J A;  4HPM B;  3W67 A;  4ITK A;  4LNK A;  2RPV A;  2R6F A;  1HUC B;  1E9M A;  4G0N B;  2WSE F;  4HWY A;  2M60 A;  1HZ5 A;  1FH0 A;  2MEK A;  3RT3 B;  1M6D A;  2LXE A;  2KNV A;  2ZW1 A;  3RVX A;  2QBY B;  2DOS A;  1JB0 F;  4M9X A;  1NHW C;  1DGH B;  3KSX A;  2BYV E;  3AI5 A;  3ZDT A;  3QYE A;  1LFD A;  3CSF A;  3KP0 E;  2KAC A;  2LBC A;  1KLU D;  1AAR A;  2WWZ A;  4M0D A;  4OX9 M;  2V1C A;  2ZAM A;  3ENE A;  3P4Q B;  3M0E A;  3VRA B;  2KVR A;  3K9P A;  2J0K A;  2WU5 B;  3BXW A;  4G4O A;  1EF1 A;  2UU9 M;  3GLG B;  1P98 A;  1KHQ A;  3KSE A;  5G2N A;  3A98 B;  2EEL A;  2PVG C;  1PGA A;  1CUK A;  4AKG A;  1Q0W B;  4OW0 A;  3VFD A;  1EM7 A;  1WM3 A;  3L4P A;  1WM2 A;  1N63 A;  2JWZ A;  1LV7 A;  1RFK A;  1QLB B;  3ZNH B;  1IN6 A;  1MFW A;  2C9W B;  1F2R I;  1QYR A;  4G50 A;  2JRI A;  1JWA D;  3HHX A;  2BBC A;  2WHI A;  4ZYN A;  4A20 A;  4GC5 A;  4FCW A;  3CIR B;  1T3T A;  2HKJ A;  2DCC A;  3GLF B;  4YTP B;  2CHV A;  4QRG A;  3B08 A;  4IBG A;  4AQY M;  2MCN B;  4KSK C;  3BVM A;  2DC7 A;  5G5G A;  1E94 E;  1RLF A;  4AXL A;  3GLG A;  4B3T M;  2RSU A;  4MGI E;  2ZNV B;  1DOX A;  5IWA M;  1ZMV A;  4W9F A;  2AVW A;  1KXR A;  1V2Y A;  3M63 B;  3GRV A;  1SE2 A;  3NJT A;  1JAL A;  4LJ9 A;  2K47 A;  1Z5S B;  1OGW A;  3AEE B;  2OOA A;  5D3I B;  1GMY A;  5ITQ A;  4TMA B;  1RFA A;  3ZJV A;  3PRM A;  4JI7 M;  2UXD M;  1PVJ A;  3GQ4 A;  3JR4 A;  5GMV A;  1TTE A;  1PQS A;  1PCI A;  3GZN B;  1YD8 U;  2HH5 A;  2ZPY A;  4HDO A;  4YYW A;  3OIS A;  3Q8G A;  3K8U A;  4L1B A;  2N9P C;  2V3N A;  4DR3 M;  4NJ6 A;  4EZK A;  3QSD A;  2K8B A;  2RKO A;  1DEU A;  4I4L A;  4MGZ E;  3AMZ A;  4WIP A;  2A5Y B;  4ZPX A;  4OEL A;  1TIF A;  3V6E A;  2L8J A;  1E8W A;  2GMI C;  2HD5 A;  5L8R F;  1VDV A;  3LW5 F;  3RNF C;  4FIP A;  1WH3 A;  4S12 A;  1N78 A;  1WXM A;  1C3T A;  3A45 A;  1GUA B;  4LNI A;  4DUY M;  1JWB D;  2J7Q B;  4YYS A;  1I7H A;  2ERC A;  3KW6 A;  4IBF A;  2C9C A;  3VAW A;  1MEM A;  1VJV A;  4YSZ B;  1CS8 A;  4BQV A;  2ZCB A;  1HR0 M;  3AE9 B;  5CVN B;  4AJY B;  2KLG A;  3V3X A;  2O2V B;  1PIP A;  2DHR A;  2DZY A;  1L4Z B;  4KV2 A;  4DDG D;  3B1L X;  4XZX A;  2DZN B;  3FKE A;  3K2L A;  2QHO A;  5EP2 A;  3SEB A;  1GC6 A;  1V1P B;  4NZL B;  3W1S C;  2LGY A;  3L25 A;  4GUA A;  2IY1 B;  3P1M A;  2CJO A;  4PS7 A;  2L7R A;  4NAW B;  2DNA A;  4RM8 A;  2VQF M;  1MS6 A;  2H88 B;  2K1F A;  1L8Q A;  1D5X C;  1C79 A;  2GNO A;  2J7Q A;  4GRI A;  5C1B A;  2JZ1 A;  2EKI A;  3ZC7 B;  4QHS A;  1I4Q A;  2CKH B;  3MTN A;  1EF7 A;  2CHX A;  4S0R A;  1X9Y A;  2CHZ A;  3O65 B;  2FNJ B;  4CJ6 A;  3TRK A;  4URK A;  1GG3 A;  2VF7 A;  2O2V A;  2QIE B;  2R45 A;  3A1Q B;  1QVR A;  2KQ7 A;  5CHW A;  1MEG A;  5FLX S;  2OP3 A;  1AIM A;  3N1Y C;  2G45 B;  4NAW A;  4LDT D;  1D3Z A;  2KHH A;  1N75 A;  2V4I B;  1YE9 A;  3PTF C;  3WHK A;  3C8Y A;  2WX1 A;  4HPL B;  4QH6 A;  3B0A A;  2DLB A;  2SEB D;  3DHG C;  2MBH A;  3TPZ A;  2C60 A;  2MJ5 B;  1R4M B;  3FUW A;  1F0Z A;  4YTM B;  3AUL A;  3MHS D;  4AG5 A;  2AL3 A;  4W9C A;  4M8N A;  1I35 A;  1LTM A;  4FJY A;  4LJ7 A;  1TS3 A;  4DV6 M;  3CH3 X;  2UUB M;  1V33 A;  4M0W A;  1SGH A;  1YN4 A;  5CHF A;  3DPD A;  3F92 A;  3K1J A;  2KYW A;  2NBV B;  2PE9 A;  2JYT A;  1L1T A;  4G54 A;  4NSR A;  2ZM6 M;  1UBQ A;  1P3Q Q;  3QYB A;  1AU3 A;  1ENF A;  1YX6 B;  4KLN A;  1C77 A;  5JZE B;  3KWB X;  1KSF X;  3W0F A;  3WCQ A;  1FEH A;  1GPX A;  1ET6 A;  3VTW A;  3D32 A;  3I57 A;  4KZC A;  3F75 A;  2G4D B;  4YT0 B;  3KS8 A;  2GHU A;  3DBH I;  2D7G A;  3AOG A;  2KK8 A;  4Q2J A;  3IFU A;  1C1K A;  3GP1 A;  3C3E A;  1MG4 A;  5AEK B;  4OZA A;  1N61 A;  3NHE B;  2PIA A;  4RY2 A;  4AI6 A;  4IBD A;  2KRU A;  2KN4 A;  4DV2 M;  2IYD B;  3AEB B;  1WIV A;  3D8L A;  4C7Z A;  4BKS D;  1YK8 A;  3IT4 B;  3HHY A;  2JZ3 B;  1GVN A;  5FKA C;  3DVG Y;  4WWM A;  3A42 A;  3NBI A;  4A8X C;  4GIV A;  1Z2M A;  1D0L A;  1XXH E;  2CR5 A;  2INP E;  2LGD A;  2KTR B;  2LI5 A;  5EZQ A;  4X57 B;  1K50 A;  3AE3 B;  2LHC A;  3DCG A;  3ZYY X;  5HHD G;  2C0Y A;  1JR3 E;  4BOP A;  2LHE A;  3I9V 1;  2BYE A;  1ZMU A;  3FRI A;  3H8C A;  3VTV A;  3BY4 B;  3ZJU A;  1JWU D;  2JXN A;  3HZJ A;  4LNO A;  3AKZ A;  4RKU F;  3L29 A;  1E5W A;  3U6O A;  2JX5 A;  2QMT A;  4B0E A;  1GOZ A;  1AUA A;  3FAH A;  3JVZ X;  1UNS A;  4BS5 A;  3R2I A;  2D3C A;  3SD5 A;  2KTR A;  1KLV A;  4B6W A;  4DWF A;  1HE8 A;  3APF A;  2PMV A;  2R9O A;  2LVP C;  3PHW A;  3DBL B;  4TQ1 A;  3SMS A;  2Z4R A;  3E56 A;  1KM7 A;  3NY5 A;  4QAY A;  5EF4 A;  1GO5 A;  3T15 A;  2DJG B;  3C9P A;  2LVO C;  3MHZ A;  1K3X A;  2J0J A;  2KAN A;  2BTE A;  3BY4 A;  1WJU A;  4RF1 A;  3PHU A;  5LXI B;  1NLJ A;  1ZXI A;  1CMX B;  2XSZ A;  3LCU A;  3U6Q A;  2F5N A;  2O6V D;  5LLI A;  4QBB A;  1Q10 A;  1XC8 A;  2KC1 A;  3C3D A;  1SJH D;  4RGN A;  2VQE M;  4Q7J A;  2V9H A;  4I6P A;  2INN E;  1WGD A;  2JU6 X;  3DHI C;  3AM9 A;  4O1N A;  3EUB 2;  1V80 A;  2D7H A;  1FXT B;  4N59 A;  1S4V A;  3JAM S;  5BYQ A;  2AS8 A;  2WS3 B;  1YMH E;  4LCB A;  4BZA A;  3B21 A;  3GLH A;  2EMS A;  1AYF A;  1B1Z A;  2ZJD A;  4PCZ A;  2RR9 A;  1WX9 A;  3LFY A;  1WE6 A;  1DV0 A;  5DPT A;  1D4B A;  3CTW B;  1WJ6 A;  2HWJ A;  3H8B A;  4B0M A;  2G8E A;  3PXG A;  3TQS A;  2VRR B;  2YEP F;  2DCD A;  1NB3 A;  3DF0 A;  1JQ4 A;  5EP3 A;  1I4W A;  3DBR B;  2CJN A;  5L83 A;  5E6O A;  4PP1 A;  1NQC A;  4YHH M;  3U61 A;  3DOA A;  4Q8G A;  1MVK A;  3MJ5 A;  3W1S A;  1XCT L;  2N35 A;  2KD0 A;  4LF7 M;  1FRD A;  4DMX A;  1SB3 C;  2JUO A;  4W5C A;  3VKG A;  4I04 A;  2JTC A;  5CX3 A;  2DBY A;  1XCQ L;  3QX1 A;  2TSS A;  5D6J B;  3IT6 B;  4KIK A;  1T6O A;  1RYJ A;  1WZ0 A;  4CYE A;  2F5P A;  4BB9 A;  4K7U A;  2QCZ A;  1ZDX A;  4LNN A;  1GL6 A;  2KO3 A;  2LRU A;  2WQY B;  2F1G A;  3OJ3 A;  1E7V A;  3APC A;  3P4S B;  1ZMW A;  2KZU A;  3HVZ A;  5MPO A;  1DGJ A;  2L52 A;  3H7P B;  4FW9 A;  1MG8 A;  3WXG A;  2CV0 A;  2DVW B;  2RRU A;  2DWN A;  1U9W A;  3NZ3 A;  1IP9 A;  2JT4 B;  4RM9 A;  4CZW A;  2XFT A;  2B3A A;  4BAX A;  1MHX A;  2CP8 A;  4BKG A;  4DXA B;  1A5R A;  1P0R A;  3PRZ A;  2BS2 B;  2I2Y A;  4LNF A;  5CHV C;  4JN6 A;  2L2D A;  3HX3 A;  2DC8 A;  2N9K A;  3OAW A;  2MBQ A;  3H7D A;  2WXP A;  3RMK C;  4DV5 M;  1LGR A;  1IN8 A;  1SBB B;  1T0S C;  2KX0 A;  2GQF A;  4UN2 B;  1EF5 A;  1WX7 A;  2BVC A;  2DHY A;  4ZRI A;  1NO1 A;  2E01 A;  2JWS A;  2BNK A;  2RDB C;  2XZF A;  2MJ3 A;  2N7E A;  4WWO A;  1T3Q A;  1NY5 A;  1PJJ A;  3WAP A;  1E8X A;  4M8M A;  4ZDV A;  2GLS A;  4BVU C;  2HJ8 A;  2PNS A;  2N1V A;  4HJG E;  1PE6 A;  1IBM M;  3VUX A;  4OU7 A;  1TKG A;  2Z59 B;  2C96 A;  4AXM A;  1FD6 A;  1R5L A;  1TLO A;  3NZU A;  2NPT B;  2K6B A;  4ZTB A;  1F1H A;  3KYD D;  2KTF A;  3U30 A;  1XNR M;  2NBU A;  3HJS A;  1HNW M;  5DYG A;  3BOS A;  5EE3 A;  2M56 B;  2QC8 A;  5EXP A;  3JR5 A;  3RNB C;  4LF8 M;  2OHF A;  1R6B X;  2PEA A;  2P86 A;  1WGG A;  3ZNG C;  1IYF A;  4YYQ A;  5EXT A;  1JRP A;  3ZNI D;  4D8B A;  5G5H A;  2MRP A;  2AEH A;  2WSC F;  4QNR A;  1RM6 C;  2XFS A;  4K0K M;  2MW5 A;  4Y28 F;  2VZK B;  3OVX A;  3RVV A;  3CBK A;  4GB9 A;  4FJZ A;  1FXA A;  2IGD A;  4NXN M;  3PRP B;  4W9L A;  2A4Z A;  1KRH A;  2UXB M;  2SAK A;  6PAD A;  1XMO M;  2FID A;  3PSE B;  1NHG C;  2DYM A;  3DA1 A;  2PAD A;  2MBO A;  3GS2 A;  3C0R A;  3KUZ A;  2CV1 A;  2K8H A;  3U6P A;  4GKJ M;  2CWB A;  4AW4 A;  4G6Z A;  4NRW A;  4REZ A;  1C1Y B;  2BTW B;  2XF3 A;  3QAQ A;  1SEB D;  5IRE B;  1S1Q B;  3L26 A;  3W5U B;  1SXJ B;  3PVS A;  2WGS A;  3H6S A;  4ITQ A;  4ANU A;  2L32 A;  2W55 A;  2EKF A;  2MWS B;  1L1Z A;  3IMA A;  1YK7 A;  4PP2 E;  5E6N A;  5JXV A;  2DZL A;  2RGF A;  3N20 C;  4CIZ A;  4OZB A;  4H2A A;  3PT2 A;  3AEC B;  2GI9 A;  4IBJ A;  1G71 A;  3ZIM A;  3I63 C;  3KLS X;  4RFB A;  2QP9 X;  2LVP A;  1JML A;  2ZEQ A;  2J0M A;  3PV1 A;  5AZG A;  4YYV A;  2LVO A;  3RVW A;  4MEL A;  2VHS A;  4IJF A;  4XGI A;  3TUO A;  3S3Q A;  1TY2 A;  4XBO A;  5IN7 A;  3KWL A;  1H8C A;  2UYZ B;  4C56 C;  3KDS E;  1OTR B;  3FE3 A;  3URY A;  2AYN A;  5EE0 A;  2Z0E B;  3VUW A;  2QEN A;  2Z3X A;  4FJC A;  4PS8 A;  1N62 A;  3R8F A;  2IJ0 A;  5GXG B;  5IOI A;  5FTJ A;  1MX0 A;  1L2N A;  1DF0 A;  2OZ2 A;  5AUI A;  2R9F A;  3L10 B;  1UGM A;  2NTS A;  2WDR B;  4WAA A;  1G3I A;  1N60 A;  3VKH A;  2HCB A;  4KSL C;  1XT9 B;  1WI0 A;  3RPF C;  3WA0 A;  3I04 M;  1L0V B;  3THG A;  3FKY A;  3QK0 A;  2XU1 A;  7PCK A;  2WXH A;  3RZF A;  3UQA A;  2Y20 A;  3P63 A;  2R0I A;  4IWO A;  4QHT A;  2KWV B;  1I4R A;  3KSJ A;  2XK5 B;  3U52 E;  1QQR A;  4NNJ B;  3I4V A;  2E02 A;  2C99 A;  1FM0 D;  1OTR A;  2J7N A;  2WSF F;  3B74 A;  1AEC A;  1Z5B A;  2J53 A;  1OFH A;  3IAM 1;  4HLE A;  3MC9 A;  1LQB A;  3PZ7 A;  3W30 A;  2VZK D;  3J9C A;  3N3K A;  1WE7 A;  1WXQ A;  4LJ4 A;  3VTU A;  2YJ8 A;  4MZS A;  4FXC A;  4MZO A;  4WP2 A;  2IO1 B;  2X8X X;  2QNJ A;  1XLP A;  3PHX A;  1J7C A;  3HGI A;  2JQG R;  2QZ4 A;  1XLO A;  1K51 A;  4IG7 B;  4DK5 A;  1PM5 A;  1R2Z A;  2D11 A;  2JVC A;  4EZL A;  2JZP A;  4JI6 M;  3Q8F A;  2FH0 A;  1GAQ B;  3O1G A;  1FNU A;  1HTO A;  3NVZ A;  2K0B X;  4X6H A;  1L0Y B;  1TH4 A;  1SXJ D;  4JX1 C;  3IG3 A;  3IEJ A;  1O0E A;  2KWC A;  2HHN A;  4D80 A;  2ACZ B;  2YJB A;  2FT2 A;  1TDZ A;  2XEP A;  2KW0 A;  2M8S A;  4DR6 M;  2FTD A;  2WZJ A;  3ETR A;  4NC6 A;  1PJI A;  2K3U A;  1KFU L;  4GEW A;  1G59 A;  4IBK A;  2Y0Q A;  5EQT A;  2LGX A;  4K3C A;  5IKC M;  1QZM A;  1C7Y A;  2M19 A;  2ACT A;  4I6N B;  4AP4 C;  3J7B A;  3OLM D;  1UWM A;  1PRB A;  4M9S A;  3P4R B;  1EO6 A;  2K6Q A;  5CHV A;  2LWP A;  3QWZ B;  3AEF B;  4LJ6 A;  1P7E A;  2QIL A;  3SFE B;  3EFU A;  2X4A A;  4GXB A;  4WUR A;  2H5X A;  4I07 A;  1Q3B A;  1NL6 A;  2FCS A;  4F2L A;  4KX6 B;  3K9P B;  1XQQ A;  1J7K A;  4OVZ A;  2XZU A;  1J5E M;  4GKK M;  4WQM A;  3AH7 A;  3BZD B;  3IFW B;  4MT5 A;  1I42 A;  3HHM A;  3M95 A;  3PLV A;  4IJE A;  1GLO A;  3L17 A;  3P2B A;  4YTN B;  3HWS A;  4QOS A;  1UF0 A;  4L4U A;  1IFY A;  4XUI A;  2KMM A;  2X49 A;  2N0S B;  4HRS A;  2JRI B;  3UJN A;  2KFK A;  1ROE A;  3W9C B;  2V1Y A;  3AU5 A;  5IP4 D;  3PGE A;  1G41 A;  2JZZ A;  3K8Z A;  4I5S A;  3QQ8 B;  1TF0 B;  1I4X A;  3U6D A;  3H1U A;  1AIP C;  1EWP A;  1NSF A;  1IBK M;  4N9F 4;  2N9L A;  2MQJ A;  1Y8G A;  1KFV A;  2WLB A;  2K6D B;  3PFI A;  3W68 A;  3RD2 A;  2W9N A;  4MM3 A;  2R62 A;  4BKT A;  4AQ7 A;  3BBZ A;  2MRO B;  1ZQ9 A;  1P9D U;  3CGW A;  2PVO D;  4LJO B;  1WFY A;  4M00 A;  3V60 A;  1SIJ A;  2JY8 A;  4EZJ A;  1C4P A;  4PK1 A;  3TEZ A;  1YVB A;  5LXH A;  3PRM B;  4DQO C;  3RFZ B;  2WXL A;  3DWM A;  4BOS C;  4DHJ B;  3TL4 X;  1E7U A;  1BY8 A;  1XO3 A;  2WDT B;  4L8R C;  2LUE A;  1PGX A;  2DHZ A;  2WXI A;  3OVZ A;  2BYT A;  1SG9 A;  5K16 A;  2KNB A;  4X6J A;  4D8E A;  3LMM A;  2WU2 B;  1AYU A;  3J7A S;  4LJP B;  3RNG C;  1JQJ C;  4XWT A;  3ZUA A;  2QQ8 A;  4W9I A;  2FS1 A;  5BMG A;  2ZPN A;  3V6E B;  3IOQ A;  3UK6 A;  2QJL A;  3QCA A;  2HD5 B;  2M1M A;  4RGO S;  3RE8 A;  1TZ1 A;  1UM8 A;  3QC8 B;  2QDF A;  1X37 A;  2XLJ A;  4W9J A;  1TU6 A;  3WAN A;  1TDH A;  4XWW A;  1L7Y A;  2L00 B;  3IVF A;  2KT7 A;  1XXH A;  2Y6E A;  3R2T A;  3ERV A;  3PRE A;  3R9X B;  5DPS A;  3DBH B;  3LVV A;  1D5M C;  3PO0 A;  1BXT A;  2XBB C;  4TV3 A;  2FAZ A;  3NG0 A;  5JHB A;  2YJC A;  4I6L B;  4GDL B;  1JR3 A;  2QHO B;  3LDZ E;  3CF0 A;  4YWG G;  4IBE A;  3RNC C;  1DOY A;  3U2S C;  2GBJ A;  4TUW A;  1J7A A;  3GLI E;  3Q14 C;  1NB5 A;  4AZF A;  2APL A;  7CAT A;  1IGC A;  1PAD A;  3HJ8 A;  3PS6 A;  1Q02 A;  1Y08 A;  1PDX A;  2NQ8 C;  2KMA A;  2ZVO A;  1I4H A;  1QOB A;  3OWE B;  2L1A A;  2QPA A;  1ET9 A;  3AED B;  4AUQ C;  1XXG A;  3MTN B;  2F5Q A;  2CHQ A;  1ZP0 B;  4JE3 B;  1F2A A;  5EE1 A;  2BKF A;  2JUJ A;  3ZJT A;  1K8R B;  3NS8 A;  4FWG A;  1IPG A;  2O25 A;  1TZO A;  4GDL A;  2J42 A;  1Q3C A;  3GB1 A;  3LVW A;  1BVS A;  1VEJ A;  2LAS A;  4FJV B;  3OF8 A;  4K3B A;  3PNY A;  2LEK A;  3GPX A;  3SC3 A;  1TL9 A;  2KJR A;  3QJ3 A;  2MBB B;  3U6S A;  3WAL A;  1Q6K A;  1PGY A;  1PUT A;  1MN3 A;  2FUH B;  4NL4 H;  2QSD A;  2JQF R;  2LFI A;  3T38 A;  4MH8 A;  1ATK A;  1MU5 A;  1E32 A;  3EGR A;  4Z8X A;  3AE1 B;  5D94 A;  3ABV B;  3BK1 A;  4X64 M;  4M01 A;  1YJ1 A;  5HI1 A;  5I4D A;  3U7Z A;  1D0M A;  2LHG A;  4M0W B;  1VCB A;  4LGY A;  1F2B A;  4FHK A;  2DX5 B;  4MH0 E;  3J81 S;  3AN1 A;  1XNQ M;  2GBR A;  1IM2 A;  2FUD A;  2NQD B;  1FFV A;  3LXF A;  2IO0 B;  2Z7J A;  5JI3 E;  1CJE A;  2GB1 A;  1QUT A;  4E71 A;  2C5R A;  4KDI C;  1AWD A;  2PE6 B;  3U8Z A;  4B7F A;  1G6J A;  4LJ8 A;  1NNU C;  3ZUN A;  3WAO A;  3J80 S;  1JWS D;  4KO8 A;  2JF5 A;  3CF6 E;  2E00 A;  1HZ6 A;  2G6D A;  3CH2 X;  5LMU M;  2FFJ A;  4LF9 M;  1CJL A;  1XEE A;  5C23 A;  2Q2E B;  4LK0 M;  3AXC A;  4EIW A;  2YLM A;  3NRZ A;  2JQR B;  2M4N A;  2AUZ A;  3U6C A;  3V6C A;  2EKK A;  4OVU A;  4PD2 A;  3J2P B;  4MSM B;  1OEY J;  4MJS B;  4K7C A;  3W0L B;  3Q8X A;  3ZQJ A;  2HWK A;  4RH6 A;  3U5Z B;  1N77 A;  2PW9 A;  5JH3 A;  4NXM M;  4MAC A;  3SYL A;  4ASW C;  1T43 A;  2VDB B;  4P16 A;  1TBE A;  1VLB A;  1VEG A;  1KHP A;  4DR2 M;  1NVM A;  1VRA B;  3V76 A;  3SAW A;  1JRU A;  2V4L A;  3FTD A;  1V81 A;  5E6P A;  2DAG A;  4DXF A;  1WMH A;  4ARC A;  2JA2 A;  4NSO B;  2O01 F;  3W2D A;  5LMN M;  2D5G A;  2KN5 A;  4HL4 A;  2YVC A;  1QF6 A;  2AL6 A;  3HK0 A;  4IUM A;  3K9O A;  2DYO A;  4NPN A;  4RMA A;  3U6E A;  4MJS A;  2GFO A;  4CDE B;  1FMA D;  2JWU A;  3U5Z A;  1YQB A;  2BWF A;  1VSN A;  1ZXH A;  2GBM A;  4CGY B;  3HRD D;  3R7R A;  1ICF A;  2KDM A;  2DWQ A;  3N30 A;  2MLB A;  3RNA C;  1I94 M;  2FYE A;  4D2K A;  4P1B C;  3B9P A;  1R4G A;  1Q5W B;  2MJE A;  5JA7 A;  1WR1 A;  4I05 A;  1QIL A;  3HWN A;  3JSV A;  3GLG E;  3Q8C A;  3VDP A;  1UZX B;  1AU4 A;  2MR9 A;  3Q2A C;  4XC2 A;  3T3N A;  4II7 A;  4RNA A;  2IND C;  1DGF A;  3H9D A;  3PHW B;  4L23 A;  5FTM A;  4IC7 B;  4ZRQ A;  4LZZ A;  1YN3 A;  4ARI A;  2BWE A;  4B3R M;  1AYW A;  3AOE C;  4HRO A;  4B3M M;  3SAS A;  1R4N I;  3KYC D;  4IKG A;  3GLF E;  1N6Z A;  1WF9 A;  4BOS A;  3B79 A;  2H1R A;  4HVB A;  4P1C C;  1XLN A;  3IUT A;  3HU2 A;  3QA8 A;  2OJW A;  2R9C A;  4GMQ A;  3Q3O C;  5H37 D;  1IN4 A;  1YNT E;  2AU1 A;  2DCB A;  4G3X B;  2ONQ A;  3BIN A;  1T0Q C;  2LNH C;  4LFA M;  1U9X A;  4QOZ C;  3ML9 A;  2ZTC A;  3DOW A;  3GLH B;  5FTN A;  1HQY E;  4IBC A;  1VZ8 A;  2MJD A;  1KOT A;  2DNF A;  3I06 A;  3GOE A;  4GSW A;  5G55 A;  2R9M A;  2Z8L A;  5CTR C;  2A5U A;  2L7H A;  2E6X A;  3BPM A;  4JI4 M;  4A3O A;  1E8Y A;  2ASQ A;  3ALB A;  2BS4 B;  2WXM A;  1K52 A;  4JL9 A;  1WX8 A;  1GB4 A;  2I1J A;  4WWN A;  2H89 B;  2DYB A;  2AWT A;  2BJV A;  2L0T A;  2J7O A;  2EKE C;  1Y8R C;  3UIN B;  1NYQ A;  3PNR A;  1D0K A;  4WJP A;  3KP1 E;  3DVN U;  5DPR A;  4W5W A;  4B95 A;  3KW9 A;  4OEM A;  4LZJ A;  2KC2 A;  3U61 B;  2M5Z A;  1MHH E;  4F1S A;  3L0W B;  4RGT A;  3RYT A;  4BBN F;  1BT0 A;  1WJN A;  4ZRJ A;  5ITX E;  3MK6 A;  3QJZ A;  2LJ5 A;  3R7Q A;  1PJQ A;  3KWV A;  1U5I A;  4BOQ A;  2CRU A;  3L27 A;  1IGD A;  1WGY A;  1PGB A;  5BMH A;  3VQI A;  4KIK B;  1UWX A;  1Y56 A;  1IXZ A;  1HT2 E;  3A4R A;  4JI5 M;  4KGR A;  5CVM A;  4NRV A;  1DYQ A;  1IXS B;  2IBI B;  5H8Y E;  2F7D A;  2WXO A;  3O13 A;  4RF0 A;  1BQI A;  4J6I A;  3HKP A;  4HJK A;  3E46 A;  1IY2 A;  3VFK A;  1HQC A;  1FJG M;  3KVF B;  4GDK A;  4G11 A;  1E0Z A;  4ICU A;  3IG5 A;  4B7G A;  4NY0 A;  1R7R A;  4GIT A;  4G3O A;  1PXV A;  2REX A;  4JIO U;  4TUU A;  1C76 A;  3SHG B;  2ZAN A;  1WR6 E;  2XSZ D;  2FNA A;  1HXY D;  3W31 A;  3SBJ A;  2ICI A;  2LXC A;  4EE2 A;  2IBI A;  1IXS A;  1WZ3 A;  3HIZ A;  1K82 A;  1DGG A;  2NTT A;  4ZHP A;  5EE9 A;  4IM3 A;  2JY6 A;  3ZO5 B;  3EHV A;  1TR8 A;  3EEC A;  2RD0 A;  3B9J A;  4UDU C;  3AE6 B;  1SNK A;  1VDD A;  1ZUD 2;  3EIH A;  4XX5 A;  3P5W A;  1ZDV A;  4KGS A;  1V1O A;  2LRW A;  3IHP C;  5KHQ A;  3TEY A;  1EWY C;  3OJ4 B;  4LGM A;  5ITU A;  4LFB M;  3I3T B;  2MA9 B;  2D7E A;  2LJI A;  4ACF A;  4CHT B;  3AU4 A;  1WGL A;  4AJW A;  2EUC A;  2I7P A;  2WXN A;  3IG8 A;  1DO2 A;  4LRT A;  4GHA A;  2PJH A;  1YSY A;  3ZW3 A;  1M94 A;  5KQ8 A;  3UGJ A;  1V49 A;  1YQ3 B;  1SF0 A;  3GO8 A;  2CFO A;  4DV4 M;  3GRU A;  2C7H A;  3BOW A;  3P5U A;  2QCU A;  2CHG A;  2LVQ A;  3EC8 A;  3ZNZ B;  1QDQ A;  2K39 A;  3I01 M;  2RGH A;  4A3P A;  3VH3 B;  4E74 A;  4IWP A;  4K7W A;  1EUV B;  3A9K B;  1K53 A;  3H8H A;  2JRH A;  2NVU I;  2E03 A;  3Q3F A;  3SU8 X;  3I3T A;  2EA0 A;  1VZ7 A;  3RZW C;  4LRS A;  3BBA A;  3B7Q A;  4MGY E;  4NOO B;  2AX5 A;  5EJC A;  1QKZ A;  1QOG A;  2Z0D B;  5ITY A;  1Z5C A;  2RPQ A; 
#chains in the Genus database with same CATH homology
 1FRR A;  4GH9 A;  4OHJ A;  3FUX A;  2CE7 A;  3K92 A;  3SFD B;  3GQ3 A;  4DV7 M;  2W3R A;  2BJW A;  4AKH A;  3TEX A;  1KYI A;  1N5X A;  1EE8 A;  2HHH M;  4FVM A;  1DOI A;  3T1Y M;  4L15 A;  3R8B A;  2G1E A;  3AE7 B;  3VLF B;  2J52 A;  1ZAE A;  3HHZ A;  1KF6 B;  4FWH A;  3RGP A;  3AOE A;  1XMQ M;  3IAS 1;  3BK2 A;  2KXE A;  4L16 A;  3TSS A;  4KGT A;  3UMM A;  1Z6T A;  1T6B X;  1VZ6 A;  4GLS C;  2X38 A;  4GHL A;  2VII A;  1G4A E;  2W3S A;  3HU3 A;  1L0X B;  1N33 M;  1UUP A;  4C80 A;  2G5G X;  2V6Z M;  1NJF A;  3AEG B;  4JPS A;  5BPV A;  1T5X D;  4B7H A;  2W82 A;  2ON8 A;  2R65 A;  1HNZ M;  1IBL M;  4DXG A;  2JYE A;  3SFZ A;  3MHV C;  1FCC C;  4IBI A;  2M0A A;  1ZE3 D;  1PFD A;  1QOF A;  3C58 A;  3IXS A;  4I81 A;  1TS5 A;  1CK1 A;  4RCO A;  1YN5 A;  1JW9 D;  1KLG D;  2WP9 B;  1LO5 D;  3FD9 A;  4DR5 M;  2JSV X;  4ZRP A;  3QWL A;  4AKI A;  4D82 A;  3VRB B;  4XE0 A;  2HL7 A;  1TGU A;  2WXF A;  2BB5 A;  1IXR C;  3SMP A;  2OED A;  4BOZ A;  3GLI A;  1YUB A;  5FTL A;  3SHF A;  1L6U A;  2KRK A;  2V1U A;  2IGG A;  3NWL A;  1CQV A;  2AQ3 B;  2K22 A;  1W5S A;  3GQ5 A;  1KFY B;  3AV8 A;  1DGB A;  2WXQ A;  3LYY A;  2BS3 B;  4OVZ B;  3E9S A;  3GPU A;  3OQC A;  2PTL A;  2WNM A;  1K3W A;  3B2F A;  1NNJ A;  1TH3 A;  1YJJ A;  4PT5 A;  2F5O A;  1QAQ A;  3MP9 A;  1PYW D;  4JI8 M;  1DKI A;  4X65 M;  5C2T B;  3KOX E;  5LNK 1;  4HLQ A;  2AGA A;  4A90 A;  3FC4 A;  5EXX A;  3FTF A;  1V97 A;  4KHP M;  1YJI A;  4A9A A;  4LF5 M;  4DV0 M;  1QAO A;  2R4J A;  1QQW A;  4MM3 B;  2XH9 A;  2R4E A;  3AL0 C;  2KWD A;  2OPF A;  3SAR A;  2FOI C;  1TKY A;  2UUC M;  4BOU A;  2DXI A;  1J09 A;  1NJG A;  3SAT A;  4L2Y A;  2OQ4 A;  3Q8B A;  1D2N A;  1CZP A;  3HU1 A;  3P4P B;  1AN8 A;  4G4N A;  2RGO A;  2BU3 A;  2R46 A;  1NI3 A;  3BB7 A;  3BVG A;  3V05 A;  3NUH B;  5FK9 C;  4OZC A;  1XXH B;  2G8L A;  4LJ5 A;  2QBY A;  1Z5A A;  1C9F A;  1L4D B;  1I4G A;  3W5V B;  1DGH A;  3P42 A;  4I8O A;  4RKX A;  1SSN A;  3KVW A;  2GRI A;  3L28 A;  3GP7 A;  1FNN A;  2B76 B;  1SXJ E;  1HEZ E;  3Q69 A;  4YY3 M;  1N36 M;  3ZCB B;  2QEJ C;  2RDH A;  2WXJ A;  1STE A;  4IBB A;  5KO3 A;  5A2Q S;  1WRI A;  2R18 A;  1XLQ A;  3DZD A;  1XF5 L;  8CAT A;  1FCL A;  2Z4S A;  2ZAO A;  1DO0 A;  3ZNH A;  5C3J B;  1MI0 A;  4BLC A;  1GB1 A;  3E4R A;  3GLF A;  1BML C;  5EP4 A;  2UUA M;  3ZQ4 A;  2RMM A;  1D5Z C;  3MP2 A;  4YSX B;  5EXS A;  2LHD A;  3SR6 A;  3EIE A;  2NMQ A;  1JCK B;  2IGH A;  3J27 B;  2F5S A;  4JV5 M;  4MGH A;  1RWS A;  2CU3 A;  3BYY B;  4FWD A;  3Q8A A;  1L2D A;  5HFY A;  3ZH9 B;  4G4Q A;  2K0P A;  2JXT A;  1KH0 A;  3FIL B;  4CIS A;  3U6L A;  3FUV A;  1NYR A;  2IDY A;  4HKZ E;  4ZHO A;  1ACC A;  4R3D A;  5KPZ A;  2V0G A;  5ITX A;  1JR3 D;  5F3W A;  4GC9 A;  4IIW A;  2WXK A;  3AE4 B;  2Y0T A;  2YR0 A;  3ILK A;  1AW7 A;  5DYI A;  4DV1 M;  4M9Z A;  3WHL A;  3U4E G;  1TS2 A;  2WXG A;  1XWI A;  1C4A A;  5BYR A;  1F77 A;  3KQ4 A;  3FIL A;  3LQQ A;  2YEP B;  1V1P A;  3GPY A;  4D8I A;  4N6E B;  1G8P A;  2L09 A;  4B3S M;  5KQD A;  1BUI C;  4B08 A;  4JWU C;  4G4R A;  2XNA C;  4PDI A;  2K5P A;  3O65 A;  3KOY E;  1FNW A;  4KOD A;  5EP1 A;  2K9X A;  4YSY B;  3NS1 A;  1NEN B;  2X8A A;  1IN5 A;  1ZOY B;  4MB7 A;  1Q39 A;  4CQN A;  2C98 A;  2WDV B;  2Y5C A;  3VK7 A;  1J7B A;  3AJI B;  1N5W A;  1IN7 A;  5ITT A;  4JI0 M;  4KKJ A;  3DFZ A;  2WDQ B;  2FE8 A;  4ZOH C;  1IY0 A;  2I7N A;  3FYC A;  2CUZ A;  2O5R A;  2L7I A;  5KPR A;  5HG2 A;  2PKO A;  3HJQ A;  3I4Y A;  2R61 A;  3MTV A;  4JYA M;  4DR1 M;  3U6M A;  4LG2 A;  2FBW B;  2LH0 A;  5JZE A;  3BII D;  2J4X A;  1L2B A;  1ESF A;  4DR4 M;  2LUM A;  5FTK A;  4USA A;  1OQR A;  2DZO B;  3FTE A;  3LB8 C;  4LF6 M;  2KZS A;  5KPT A;  1R7S A;  1TH2 A;  3MFG A;  2BT6 A;  2UXC M;  3D8B A;  5JI2 E;  3AE8 B;  1Z59 A;  2IPK D;  1FO4 A;  3T1H M;  3OTO M;  2L83 A;  1QOA A;  3VDU A;  1GLN A;  1SXJ C;  2Q5W D;  4WAF A;  1TYG B;  4XDC A;  1TKE A;  3EA6 A;  4LTU A;  2LMC A;  2P5T A;  4GDK B;  3I51 A;  5C18 A;  1D6E C;  3KOZ E;  4JI2 M;  3FTC A;  1QT9 A;  2CEA A;  4J3O D;  3AV0 A;  1IY1 A;  4US9 A;  4FCV A;  1WSP A;  2KA6 B;  1TY0 A;  5H92 C;  1B9R A;  2YQZ A;  4LY6 A;  4JI1 M;  1P7F A;  5DNY A;  4IDI A;  1HT1 E;  3TEW A;  1YQ4 B;  3Q8E A;  3BVZ A;  3M7G A;  4HEA 1;  2G9H D;  4US8 A;  1E7P B;  1FNV A;  3UI3 A;  4PDG A;  4DV3 M;  4HKQ A;  1QAM A;  3AE2 B;  1W5T A;  5FR3 A;  3VK8 A;  1VR9 A;  3FUU A;  4AG6 A;  4MI7 A;  4LF4 M;  1F2R C;  3GRY A;  4TQ0 A;  3KS4 A;  4QNM A;  1WWT A;  2HTM E;  4FCT A;  5BR8 M;  3CWI A;  1S3S A;  3H4M A;  1L6V A;  4RGM A;  5D7G A;  3TWL A;  2AQ2 B;  2Z84 A;  2MH7 A;  4GIP A;  4D81 A;  2AQ1 B;  2W54 A;  3KXE C;  1UGJ A;  1IQP A;  1NY6 A;  5GKN A;  1OJL A;  3N9Y C;  2XGN A;  3VR9 B;  4NAM A;  2LWX A;  2Y5P A;  3L2A A;  1GL7 A;  4L78 A;  1FIQ A;  4KKI A;  1ORY B;  2RDG A;  2UZJ A;  4IOI E;  2BW2 A;  5E26 A;  1HA5 A;  3FYD A;  3RGS A;  3CF2 A;  4ZYS A;  1JRO A;  2E3T A;  2V3P A;  2I38 A;  2DWL A;  1SXT A;  3U60 B;  2N7J A;  2FUG 1;  3GPP A;  5TSS A;  3TWM A;  1E10 A;  3A46 A;  4JWS C;  4YXD B;  3NVV A;  1TJE A;  1OFI A;  3SAU A;  1M4V A;  2KQ4 X;  3ZGZ A;  1EU3 A;  1EWC A;  1HQR D;  2HDE A;  5AUK A;  3U60 A;  4DUZ M;  3B2G A;  1SE4 A;  4A5U A;  1YZB A;  4Z6Y A;  3QAU A;  1NEK B;  4C7Y A;  1L2C A;  5D3D A;  1V8C A;  3AEA B;  5FSW A;  5ITR A;  3T3O A;  4A55 A;  3TWK A;  2L6O A;  1TS4 A;  3KOW E;  3PRP A;  3GRR A;  2YFQ A;  5E6J A;  3PSE A;  3BYT B;  4BBA A;  1N32 M;  4X62 M;  4AS1 A;  1JWM D;  4JXJ A;  3RFW A;  1IBX B;  3GLI B;  3DWG C;  2BTW A;  2DWZ B;  1FFU A;  3TMP A;  1SXJ A;  4WW0 A;  4IP3 A;  3HUI A;  3PNV A;  4WH4 A;  3KFU G;  1KTK A;  2BB6 A;  2WXR A;  4LJA A;  1H6U A;  1C78 A;  2EO2 A;  1R2Y A;  3BWU D;  3NVY A;  4DR7 M;  4X66 M;  2KEB A;  3SYK A;  4R7G A;  3MC0 B;  1E9R A;  4MGK E;  3UZU A;  1IBX A;  3HVD A;  3AFH A;  1WYG A;  4N58 A;  4TSS A;  1MPE A;  3AE5 B;  3PZ8 A;  2J7Q C;  4FD2 A;  1QAN A;  2DWM A;  2E5L M;  5IT9 S;  1C4C A;  2Y3A A;  5BYS A;  2AHM A;  2LGI A;  2ZW0 A;  4LLG M;  1N34 M;  4LFC M;  3FUT A;  3M6A A;  1HNX M;  4JI3 M;  1SJE D;  1EU4 A;  5IZ7 D;  3AB5 A;  5EZS A;  1OFF A;  1XHB A;  1E9S A;  1L5P A;  1VJK A;  2C9O A;  1GKI A;  2CV2 A;  1FXI A;  3TE6 A;  1OQQ A;  4P6V F;  4A3V B;  3NVW A;  2Y21 A;  4HXD B;  2ZBK B;  3VR8 B;  1IUE A;  1UKF A;  1WGK A;  3LQR A;  3RNV A;  2F4V M;  4NJC A;  1SE3 A;  1ZPS A;  2YNM D;  1I4P A;  3SAV A;  2XN9 C;  1E6E B;  1NVI D;  4XDD A;  3HHW A;  5BMI A;  1Z5C A;  1A70 A;  4A6Q A;  5T8I A;  2KAJ A;  4ITK A;  2RPV A;  1E9M A;  2M60 A;  1HZ5 A;  2MEK A;  2LXE A;  2ZW1 A;  2QBY B;  2DOS A;  4M9X A;  1NHW C;  1DGH B;  3KSX A;  3KP0 E;  2KAC A;  1KLU D;  4M0D A;  4OX9 M;  2V1C A;  2ZAM A;  3P4Q B;  3M0E A;  3VRA B;  2WU5 B;  4G4O A;  2UU9 M;  3GLG B;  3A98 B;  2EEL A;  2PVG C;  1PGA A;  3L4P A;  4AKG A;  4OW0 A;  3VFD A;  1EM7 A;  1N63 A;  1LV7 A;  1RFK A;  1QLB B;  1IN6 A;  1F2R I;  1QYR A;  2JRI A;  1JWA D;  3HHX A;  2BBC A;  4GC5 A;  4FCW A;  3CIR B;  1T3T A;  2HKJ A;  3GLF B;  4YTP B;  2CHV A;  4IBG A;  4AQY M;  3BVM A;  5G5G A;  1E94 E;  3GLG A;  4B3T M;  4MGI E;  1DOX A;  5IWA M;  3GRV A;  1SE2 A;  1JAL A;  4LJ9 A;  2K47 A;  3AEE B;  5D3I B;  5ITQ A;  4TMA B;  3ZJV A;  3PRM A;  4JI7 M;  2UXD M;  1PVJ A;  3GQ4 A;  3JR4 A;  4L1B A;  2V3N A;  4DR3 M;  2RKO A;  4I4L A;  4MGZ E;  3AMZ A;  4WIP A;  2A5Y B;  4ZPX A;  1VDV A;  4S12 A;  1N78 A;  3A45 A;  4DUY M;  1JWB D;  1I7H A;  2ERC A;  3KW6 A;  4IBF A;  2C9C A;  4YSZ B;  1HR0 M;  3AE9 B;  3V3X A;  2DHR A;  1L4Z B;  4XZX A;  2DZN B;  3FKE A;  3K2L A;  5EP2 A;  3SEB A;  1V1P B;  4NZL B;  3L25 A;  4GUA A;  3P1M A;  2CJO A;  4NAW B;  2VQF M;  2H88 B;  1L8Q A;  1D5X C;  1C79 A;  2J7Q A;  4GRI A;  5C1B A;  2EKI A;  3ZC7 B;  4QHS A;  1I4Q A;  3TRK A;  2QIE B;  2R45 A;  1QVR A;  5FLX S;  5ITY A;  1N75 A;  2V4I B;  1YE9 A;  3WHK A;  3C8Y A;  2DLB A;  2SEB D;  3TPZ A;  3FUW A;  1F0Z A;  4YTM B;  4AG5 A;  4LJ7 A;  1TS3 A;  4DV6 M;  2UUB M;  4M0W A;  1YN4 A;  3K1J A;  2JYT A;  1L1T A;  4NSR A;  2ZM6 M;  1ENF A;  4KLN A;  1C77 A;  1KSF X;  3W0F A;  3WCQ A;  1FEH A;  1GPX A;  1ET6 A;  3I57 A;  4YT0 B;  3KS8 A;  3IFU A;  2D7G A;  3AOG A;  4Q2J A;  1C1K A;  3GP1 A;  4OZA A;  1N61 A;  4AI6 A;  4IBD A;  2KRU A;  2KN4 A;  4DV2 M;  3AEB B;  3D8L A;  4C7Z A;  3IT4 B;  3HHY A;  1GVN A;  5FKA C;  4WWM A;  3A42 A;  3NBI A;  4A8X C;  2INP E;  5EZQ A;  1K50 A;  3AE3 B;  3ZYY X;  5HHD G;  4BOP A;  2LHE A;  3I9V 1;  3ZJU A;  1JWU D;  3AKZ A;  3L29 A;  3U6O A;  2JX5 A;  2QMT A;  4B0E A;  1GOZ A;  3FAH A;  1UNS A;  3R2I A;  2PMV A;  3PHW A;  4TQ1 A;  3SMS A;  2Z4R A;  3E56 A;  3T15 A;  3MHZ A;  1K3X A;  2BTE A;  3BY4 A;  4RF1 A;  3PHU A;  1ZXI A;  2XSZ A;  3U6Q A;  2F5N A;  1Q10 A;  1XC8 A;  1SJH D;  4RGN A;  2VQE M;  2INN E;  2JU6 X;  3AM9 A;  4O1N A;  3EUB 2;  2D7H A;  4N59 A;  3JAM S;  5BYQ A;  2WS3 B;  1YMH E;  4LCB A;  3B21 A;  3GLH A;  1AYF A;  1B1Z A;  4PCZ A;  1D4B A;  3CTW B;  4B0M A;  3PXG A;  3TQS A;  2YEP F;  1JQ4 A;  5EP3 A;  1I4W A;  2CJN A;  4YHH M;  3U61 A;  3DOA A;  1MVK A;  3MJ5 A;  3W1S A;  1XCT L;  4LF7 M;  1FRD A;  1SB3 C;  3VKG A;  2JTC A;  2DBY A;  1XCQ L;  2TSS A;  3IT6 B;  1RYJ A;  2F5P A;  4BB9 A;  1ZDX A;  1GL6 A;  2WQY B;  3P4S B;  2KZU A;  3HVZ A;  5MPO A;  1DGJ A;  2L52 A;  4FW9 A;  2CV0 A;  2DVW B;  2DWN A;  3NZ3 A;  2XFT A;  1MHX A;  2BS2 B;  2I2Y A;  4JN6 A;  2N9K A;  2WXP A;  4DV5 M;  1IN8 A;  1SBB B;  2BNK A;  2XZF A;  2MJ3 A;  1T3Q A;  1NY5 A;  1PJJ A;  4HJG E;  1IBM M;  4OU7 A;  1TKG A;  2C96 A;  1FD6 A;  4ZTB A;  1XNR M;  3HJS A;  1HNW M;  5DYG A;  3BOS A;  5EE3 A;  2M56 B;  5EXP A;  3JR5 A;  4LF8 M;  2OHF A;  1R6B X;  5EXT A;  1JRP A;  4D8B A;  5G5H A;  4QNR A;  1RM6 C;  2XFS A;  4K0K M;  2VZK B;  1FXA A;  2IGD A;  4NXN M;  1KRH A;  2UXB M;  2SAK A;  1XMO M;  1NHG C;  2DYM A;  3DA1 A;  3GS2 A;  3C0R A;  2CV1 A;  3U6P A;  4GKJ M;  4AW4 A;  4G6Z A;  4NRW A;  4REZ A;  2BTW B;  2XF3 A;  1SEB D;  5IRE B;  3L26 A;  3W5U B;  1SXJ B;  3PVS A;  4ITQ A;  2L32 A;  2W55 A;  1L1Z A;  5JXV A;  4OZB A;  4H2A A;  3PT2 A;  3AEC B;  2GI9 A;  4IBJ A;  4RFB A;  3KLS X;  2QP9 X;  1JML A;  4IJF A;  4XGI A;  3TUO A;  1TY2 A;  4XBO A;  3KWL A;  4C56 C;  3KDS E;  3URY A;  5EE0 A;  2QEN A;  2Z3X A;  1N62 A;  3R8F A;  2IJ0 A;  5GXG B;  5FTJ A;  1MX0 A;  5AUI A;  2NTS A;  2WDR B;  1G3I A;  1N60 A;  3VKH A;  2HCB A;  3RPF C;  1L0V B;  3THG A;  2WXH A;  2Y20 A;  3P63 A;  4QHT A;  3KSJ A;  1I4R A;  3U52 E;  1QQR A;  3I4V A;  2C99 A;  1FM0 D;  2J7N A;  1Z5B A;  3IAM 1;  2J53 A;  1OFH A;  3W30 A;  3PZ7 A;  2VZK D;  3J9C A;  1WXQ A;  4LJ4 A;  4FXC A;  3PHX A;  1XLP A;  1J7C A;  3HGI A;  2QZ4 A;  1XLO A;  1K51 A;  1PM5 A;  1R2Z A;  2JZP A;  4JI6 M;  3Q8F A;  1GAQ B;  1FNU A;  3NVZ A;  1L0Y B;  1TH4 A;  1SXJ D;  4JX1 C;  4D80 A;  2ACZ B;  1TDZ A;  2XEP A;  2KW0 A;  4DR6 M;  3ETR A;  1PJI A;  2K3U A;  1G59 A;  4IBK A;  2Y0Q A;  5EQT A;  1QZM A;  2M19 A;  3J7B A;  1UWM A;  3P4R B;  4M9S A;  3AEF B;  4LJ6 A;  1P7E A;  2QIL A;  3SFE B;  2X4A A;  4WUR A;  1Q3B A;  4KX6 B;  1J7K A;  4OVZ A;  2XZU A;  1J5E M;  4GKK M;  4WQM A;  3AH7 A;  3BZD B;  4MT5 A;  4IJE A;  4YTN B;  3HWS A;  4QOS A;  4L4U A;  2KMM A;  2X49 A;  2N0S B;  4HRS A;  3UJN A;  1ROE A;  3W9C B;  1G41 A;  3K8Z A;  4I5S A;  1I4X A;  3U6D A;  1NSF A;  1IBK M;  2N9L A;  1KFV A;  2WLB A;  3PFI A;  4AQ7 A;  2R62 A;  1ZQ9 A;  2PVO D;  1SIJ A;  1C4P A;  3TEZ A;  4DQO C;  3RFZ B;  2WXL A;  3DWM A;  3TL4 X;  1XO3 A;  4L8R C;  1PGX A;  2WXI A;  2BYT A;  4D8E A;  3LMM A;  2WU2 B;  3J7A S;  1JQJ C;  4XWT A;  5BMG A;  3UK6 A;  2QJL A;  4RGO S;  3RE8 A;  1UM8 A;  1X37 A;  2XLJ A;  1TDH A;  4XWW A;  1XXH A;  3R2T A;  3R9X B;  3LVV A;  1D5M C;  3PO0 A;  1BXT A;  4GDL B;  1JR3 A;  3CF0 A;  4YWG G;  4IBE A;  1DOY A;  3U2S C;  4TUW A;  1J7A A;  4AZF A;  7CAT A;  1IGC A;  3HJ8 A;  1PDX A;  2NQ8 C;  3OWE B;  1I4H A;  1QOB A;  2L1A A;  2QPA A;  1ET9 A;  3AED B;  1XXG A;  2F5Q A;  2CHQ A;  1ZP0 B;  4JE3 B;  5EE1 A;  3ZJT A;  4FWG A;  1TZO A;  2J42 A;  1Q3C A;  3GB1 A;  3LVW A;  3PNY A;  2LEK A;  3GPX A;  3SC3 A;  3U6S A;  1PUT A;  4NL4 H;  2QSD A;  2LFI A;  3T38 A;  4MH8 A;  1MU5 A;  1E32 A;  3EGR A;  4Z8X A;  3AE1 B;  3ABV B;  3BK1 A;  4X64 M;  5HI1 A;  5I4D A;  3U7Z A;  4LGY A;  4MH0 E;  3J81 S;  3AN1 A;  1XNQ M;  1IM2 A;  1FFV A;  3LXF A;  2Z7J A;  5JI3 E;  1CJE A;  2GB1 A;  2C5R A;  1AWD A;  4B7F A;  4LJ8 A;  1NNU C;  3J80 S;  1JWS D;  4KO8 A;  3CF6 E;  1HZ6 A;  5LMU M;  2FFJ A;  4LF9 M;  1XEE A;  2Q2E B;  4LK0 M;  4EIW A;  3NRZ A;  2JQR B;  3U6C A;  4PD2 A;  3J2P B;  3W0L B;  3Q8X A;  2HWK A;  4RH6 A;  3U5Z B;  1N77 A;  2PW9 A;  4NXM M;  4MAC A;  3SYL A;  4P16 A;  1VLB A;  4DR2 M;  1NVM A;  1VRA B;  3SAW A;  3FTD A;  4DXF A;  4ARC A;  2JA2 A;  4NSO B;  3W2D A;  5LMN M;  2D5G A;  4HL4 A;  1QF6 A;  4IUM A;  2DYO A;  3U6E A;  1FMA D;  2JWU A;  3U5Z A;  1ZXH A;  4CGY B;  3HRD D;  2KDM A;  2DWQ A;  1I94 M;  4D2K A;  3B9P A;  2MJE A;  1QIL A;  3Q8C A;  3VDP A;  3T3N A;  4II7 A;  4RNA A;  1DGF A;  4L23 A;  5FTM A;  4ZRQ A;  4LZZ A;  1YN3 A;  4ARI A;  4B3R M;  3AOE C;  4HRO A;  4B3M M;  3SAS A;  4IKG A;  4BOS A;  2H1R A;  1XLN A;  3HU2 A;  4GMQ A;  5H37 D;  1IN4 A;  1YNT E;  2ONQ A;  2LNH C;  4LFA M;  4QOZ C;  3GLH B;  5FTN A;  1HQY E;  4IBC A;  1VZ8 A;  2MJD A;  2Z8L A;  2L7H A;  2E6X A;  4JI4 M;  2BS4 B;  2WXM A;  1K52 A;  1GB4 A;  2H89 B;  2BJV A;  2J7O A;  1NYQ A;  3KP1 E;  4W5W A;  4LZJ A;  3U61 B;  2M5Z A;  1MHH E;  4RGT A;  5ITX E;  3MK6 A;  3KWV A;  4BOQ A;  3L27 A;  1IGD A;  1PGB A;  5BMH A;  3VQI A;  1UWX A;  1Y56 A;  1IXZ A;  1HT2 E;  4JI5 M;  4KGR A;  4NRV A;  1DYQ A;  1IXS B;  5H8Y E;  2WXO A;  3O13 A;  4RF0 A;  3HKP A;  1IY2 A;  1HQC A;  1FJG M;  1E0Z A;  3IG5 A;  4B7G A;  1R7R A;  4GIT A;  1C76 A;  3SHG B;  2ZAN A;  2XSZ D;  2FNA A;  1HXY D;  3W31 A;  3SBJ A;  2ICI A;  4EE2 A;  1K82 A;  1DGG A;  2NTT A;  4ZHP A;  5EE9 A;  3B9J A;  4UDU C;  3AE6 B;  1VDD A;  1ZUD 2;  3EIH A;  1ZDV A;  4KGS A;  1V1O A;  3TEY A;  1EWY C;  4LGM A;  5ITU A;  4LFB M;  2D7E A;  2LJI A;  4CHT B;  2EUC A;  2I7P A;  2WXN A;  3IG8 A;  1DO2 A;  4LRT A;  4GHA A;  1YSY A;  5KQ8 A;  3UGJ A;  1YQ3 B;  1SF0 A;  3GO8 A;  2CFO A;  4DV4 M;  3GRU A;  2QCU A;  2CHG A;  2RGH A;  1K53 A;  3H8H A;  2EA0 A;  1VZ7 A;  4LRS A;  3BBA A;  4MGY E;  2AX5 A;  4NOO B;  5EJC A;  1QKZ A;  1QOG A;  2PLP A;  2PIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...