4R3DA

Crystal structure of mers coronavirus papain like protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
324
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Middle East Respiratory Syndrome Coronavirus Papain-like Protease and Its Complex with an Inhibitor
rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
molecule keywords Non-structural protein 3
total genus 82
structure length 319
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08715 Viral_protease Papain like viral protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4r3dA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4r3dA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4r3dA03
5KO3A 4OVZB 4RF1A 3E9SA 4P16A 4OVZA 4PT5A 4RF0A 2FE8A 4R3DA 3MJ5A 3MP2A 4RNAA 4WURA 4M0WA 4MM3B 4REZA 5E6JA 4OW0A
chains in the Genus database with same CATH superfamily
1ZE3D 1L2CA 1TS4A 4DV5M 2K8CA 2IGGA 3EIEA 3DVNU 2WDVB 2C5LC 2JZZA 3PZ7A 1NV9A 2MH7A 2N9KA 2JYEA 2ZAMA 3I04M 2BTWB 2XEWA 1GNUA 1EM7A 1KFUL 3DHGC 1MPEA 2YVCA 3HVDA 1VQ1A 1YD8U 1R4GA 4W9HA 2KACA 5C2TB 1BGOA 1TBEA 1QOBA 2YLMA 2WSFF 3BOSA 1E8XA 4NQLB 3AEGB 4XGIA 5AZGA 2KRUA 4A9AA 2W3RA 2QJLA 1XNRM 3AU5A 4MGHA 2LRUA 4MJSB 1XF5L 4TUUA 1XB2B 3DOAA 1VZ8A 4W5CA 4LNIA 4IJFA 1G3IA 2V3SA 1ZP0B 2I1JA 2O2VA 2BWBA 1DF0A 3KWBX 2KN5A 1UUPA 4GIVA 2NVUI 4AZFA 2KJ6A 3DHIC 1ZDXA 4LCDE 4M0WB 1PPNA 1ZV1A 1OQYA 2IO2B 2VF8A 1OTRB 3LB8C 4TQ0A 1E7VA 1N61A 2JY8A 1Z5CA 4JV5M 2ZEQA 5EE1A 3VUYA 2ZPNA 2VIIA 5IZ7D 1L2BA 4I4LA 4LRTA 1FNWA 1JROA 1V49A 2KTFA 3PLVA 2LHGA 5PADA 3KW6A 3BWUD 4CISA 3VTVA 4ZHPA 4FJYA 4GDKA 3FTEA 1YQ3B 4AG5A 4F1SA 4HCPB 1ORYB 1NSFA 2IPKD 3UF8A 2LVNC 5IWAM 3PLUA 4LNKA 1XCQL 4JI4M 3HHIA 1MFWA 3IVFA 3PNVA 3DVNV 3P5UA 1J7BA 3HHXA 4R7GA 4ACFA 3KYDD 1D6EC 3ZKJC 1EWMA 3DCGA 2KA6B 3I4VA 4PS8A 3FUXA 3TWMA 4AXMA 1DOIA 1NI3A 1RFKA 2G8EA 4NZLB 1E9MA 1NV8A 2Y21A 4LK0M 4DR6M 2K5PA 4HKQA 2BS4B 4BAXA 4LCBA 4YV8A 2MJ3A 2V0GA 2KAJA 4ZRPA 2PW9A 1K3WA 2DZMA 4GU2A 2FCSA 5FK9C 3WA0A 1B1ZA 1QVRA 2YQZA 1I4HA 1IBMM 1GLNA 1P7FA 3KVFB 4P7IA 5L8RF 2MWSB 2WXNA 5EXSA 2GFOA 3KW5B 1K3XA 1WXAA 2K9DA 1NHWC 1X9YA 2L6OA 3N30A 1UKFA 2VQFM 3BPMA 4IG7B 4G4NA 2Y6EA 1F52A 1R6BX 1CJEA 1K52A 3GLHA 3IHPC 2FS1A 4Q8HA 2JA2A 3FTDA 3HVZA 1S4VA 2NQIA 2L05A 2LGIA 5AEKB 1DYQA 2YEPB 2N9EB 3K8UA 4LJAA 3C3DA 1Z59A 2NMQA 3PRZA 5G5HA 3SYLA 4YSXB 2W82A 4WWPA 2ZM6M 2CP8A 4RFBA 4DK5A 1ZQ9A 1WXMA 4JWUC 3H7DA 2OOBB 2N35A 5AUIA 1NPZA 2AIMA 2G3QB 3RI7C 1AYUA 4W9FA 3U6EA 3ZLZA 1EFUB 1SXJD 1IN7A 2GI9A 3QWZB 3TIXA 2CR5A 2IGHA 5JI3E 4XDDA 3KLSX 4LRSA 2KEBA 2HCBA 1I4XA 3VAWA 2AYOA 2GBMA 3L10B 1PUTA 3WANA 3PFIA 2DZZA 3J2PB 2KO3A 2QMTA 3D6SA 2UU9M 2TSSA 4QBBA 1SXJE 3E1ZB 5EQTA 1HXYD 3RVVA 4WWNA 1C7YA 1PPDA 3SASA 2D3CA 2L7IA 4OVZA 1FXAA 4IBEA 1YN4A 4B9KA 1J09A 4WURA 3ZUAA 1HNZM 3JR4A 1KFXL 2WXMA 3H8BA 2JUJA 3U61A 2L7HA 1M94A 3UIPB 2K0PA 1FXTB 2C98A 2DZIA 1WWTA 2MHJA 5LMUM 2JUOA 4I6LB 1F4IA 4CYEA 4M01A 2HH5A 2LUEA 2BQQA 4IJEA 4HKZE 4WWMA 1TKGA 3PREA 3QAQA 2NPTB 2JY6B 4B95A 4XBOA 2WSCF 2LWXA 3KFQA 1C4CA 1EWLA 1AWDA 1KFVA 4IBCA 5TR5A 1D5ZC 4LY6A 2E00A 3U4EG 2CHZA 1CTEA 2W9NA 1H8CA 2AVWA 3T8MA 2W54A 1E90A 5AZHA 2DAEA 4C00A 1ZCMA 1OJLA 5F02A 3Q3MC 3SHFA 4B7HA 2KHHA 1AIPC 2QP9X 2KDLA 3AE8B 2Z84A 3C58A 5KPZA 4WQMA 2MBEA 3ZQJA 2FFJA 2YEPF 3NS1A 4YYUA 2JWSA 5EP2A 4NAWB 2RKOA 1IBKM 3BY4A 4BOZA 3RGSA 1UF0A 2JX5A 2G8LA 4PYUA 3M0EA 4EIWA 4YY3M 5IREB 3Q3OC 1NB5A 2RGHA 3V62A 3ZH9B 3GZNB 1KLGD 4CJ6A 2KNBA 1DO0A 3AJIB 1IYFA 4FCVA 1BUIC 3LXSA 2KDIA 5H37D 4EE2A 2KRKA 4X65M 4JI2M 4YYVA 1WJUA 1NNJA 3IAM1 1AIMA 4ANUA 3OF9A 2I1KA 2V3NA 3KQ4A 2DCDA 3GLFA 5FPWA 4IWOA 4C56C 5A24A 3IECA 3P2BA 5C23A 4CDCB 3MHVC 4KLNA 1AU3A 2K6QA 3MC8A 3SARA 3U52E 3EA6A 2DC7A 1KOTA 2H88B 1LQBA 2INDC 4US9A 4ZDVA 2RDHA 2UU7A 5ITYA 3CF2A 3KP1E 2K39A 1WGHA 4LJ7A 2BTWA 2KJHB 1L6VA 1STEA 5FTKA 5DPWA 4EEWA 1VJKA 1YJJA 5ITTA 3W68A 3I9V1 4IUMA 2OQ4A 2DAGA 2BWES 1JWMD 5K16A 2JTCA 4QNRA 1YSYA 4YT0B 3QYBA 2W3SA 2KK8A 4N79A 1HZ5A 3W67A 4BOUA 3X23A 3ZNHB 3ZTDA 5IT9S 3M95A 4II2B 4DV0M 4II3B 2CHGA 4WAAA 1QT9A 3GLIA 2AX5A 2B3AA 4RGNA 1C4AA 2R6FA 2J0JA 2JF5A 5IN7A 2AUZA 1JWSD 2JZ3B 4IM3A 2KXJA 2J52A 2DOSA 1VDLA 3A9JA 4ZYNA 1AARA 4AQYM 2GBKA 2KD0A 2NS5A 3N20C 4LDTD 5BYRA 2LVOC 2H89B 4FHJA 2CUZA 3DPDA 3GQ5A 2J53A 1TH4A 1A6RA 4G11A 5BYQA 4PK1A 2B76B 1YALA 2IBIB 1E8ZA 2WXLA 2MA9B 5J18A 4JI0M 5DPTA 4BOZB 1E10A 3TMPA 1FFVA 2DHYA 5E26A 4OZAA 4BS5A 2WX1A 4CDDB 5IOIA 2HTME 4YTMB 1MIRA 3KUDB 1NVMA 3KFUG 2XK5A 1GL6A 3AH7A 2LD9A 1ZDVA 4NJ7A 4ZPXA 2D2QA 1U9WA 2Y0QA 3U6MA 2WXOA 3V6CA 4HVBA 2X8AA 1MHXA 1QILA 3IG5A 3H6SA 4Z8XA 4QH6A 1WZ3A 3ZUNA 1WRDB 4URKA 1DOXA 5EGWA 1SF0A 4FULA 2HHHM 2WXGA 1SEBD 3LJ3A 4P1CC 1W5TA 3K24A 1IGDA 3RUIB 3C0RA 1J7CA 1XXHE 1WFYA 3P4QB 4AS1A 1TLOA 4IC7B 4KHPM 3R8BA 5EF4A 2IPPB 2C5RA 3FUWA 3O1GA 1F77A 4HEOA 3HHZA 2BKFA 2AS8A 3GLGE 3LMMA 3M63B 4NXMM 1S1QB 2OULA 3Q8GA 2KX0A 4G4QA 2HDEA 3BVMA 4F2LA 4FJVB 1IY0A 3I06A 3DWMA 4J3OD 4K3CA 2GLSA 2BKRB 4TQ1A 2ZAOA 4RGOS 2CU1A 3DBHB 4TMAB 3FRHA 1WXVA 2XN9C 4I07A 2CFOA 1ZUD2 3CIRB 1ATKA 4X64M 3SATA 4L23A 1TGZB 4RGMA 4W5BA 1HT2E 3T6PA 1L4DB 1WR1B 3A98B 3VUWA 2JVCA 3W1SA 1ZAEA 3PS6A 2DAKA 2DAMA 2K8BA 4W5WA 3OG5A 3VRBB 2KANA 1FCLA 1UELA 4OVVA 1X1MA 2DNAA 1OAOC 1QDQA 3GOEA 1FRDA 1VJVA 4IOIE 3SAVA 2N7DA 3PDFA 5AUKA 1BY8A 3W9CB 4BLCA 1Q02A 2FUHB 2IJ0A 4K3BA 3TSSA 1NB3A 2XBBC 3FUTA 4FD2A 1WR1A 2BJVA 3RNFC 1YUBA 2NTSA 2JZ0A 1QKZA 4AJWA 2V1YA 5JH5C 2EKEC 3WAPA 2EA0A 4FJCA 3BWKA 3H4MA 2DCAA 4IBKA 2N9PC 1QAMA 2R62A 4B0MA 5HFYA 2BYTA 4X6IA 2O5RA 3K9MA 4N59A 1DV0A 4PP1A 4DV4M 1F0ZA 1IQPA 4YYWA 2DZYA 4Q7JA 3U60A 3A9KA 4DBGA 3SYKA 3AULA 1FM0D 1GG3A 4N9F4 2D3BA 2EKIA 3VTUA 3L26A 3P5VA 2LWPA 1TU6A 2INNE 4PI3A 1QZEA 1JR3E 2LGXA 1LTMA 1GC7A 3N1ZC 4BBNC 2WXRA 3ERVA 3TWKA 3VR8B 1RRBA 2LVPC 3IBEA 3S3QA 4FWHA 3C9PA 1P1AA 3VRAB 3U6SA 2ONQA 4HDQA 3DWGC 5CX3A 3ZW3A 1WGRA 1TZ1A 3U5ZA 2VF7A 2NCNA 2VZKB 5JZEB 2KDBA 4X57B 2WXHA 1QANA 3Q8CA 1XWIA 2HWJA 3K92A 1MJDA 3RE8A 2PIAA 4LF5M 4A3VB 3U61B 4WIPA 4LF9M 3PXGA 3V61A 1KRHA 4MEMA 4NSRA 4LJ5A 3I4YA 4IBIA 2JQGR 3HM6X 1SB3C 4I81A 5C1BA 5IP4D 3J81S 2XZFA 1R4MB 1ZW7A 3UQAA 2DZOB 1LM8B 4QOSA 2KNVA 3FTCA 3AOGA 3NVVA 4JWSC 2LGDA 2G5GX 4K7CA 1K51A 4GRIA 2YJ9A 3B7ZA 3B2GA 3IT6B 4K7UA 1R4NI 5T8IA 4K81A 5H92C 2FIFA 3ZNID 1ZMVA 3PRPA 3HWNA 2NQAA 3TEWA 4ANXA 4ICUA 3WHKA 4TKNA 1S3SA 3QAUA 3PRMB 2K3UA 2KJRA 4N6EB 1ZXHA 3VKGA 3ZQ4A 1Y4HA 1NO1A 3TPZA 4BSQA 1N36M 3PV1A 1PGXA 2HXZA 3U2SC 3AN1A 2JRIA 2CB5A 5DYIA 5FSWA 3QA8A 4FIPA 5CHTA 1MS6A 2LGYA 1TZOA 4S0RA 1YLAA 1WM3A 1WJ7A 3KWLA 3B2FA 3BYYB 5D3DA 1EE8A 2ZTDA 4NJCA 1JQ4A 3KSXA 1XKGA 4BFRA 2WXPA 4IBFA 4PDGA 1L1TA 3VDUA 1RYJA 3L16A 5CVOB 4JN6A 2K6DB 1C1KA 3DBSA 3L25A 3GQ3A 1AYFA 4LF4M 3P1MA 3OAWA 3VVWB 1IWDA 1Q6KA 3MHHA 2PADA 4GDLA 4HK2A 3T1HM 3AE2B 1WYGA 3N4CA 4GC9A 4QHTA 2LBCA 1V1PA 5JH3A 3I01M 1FCCC 3TNXA 1G8PA 1UBIA 1D4BA 2WU2B 3UZUA 2DENA 1J0GA 4WJOA 3MJWA 4FBJB 1NY6A 1VSNA 3AKZA 4GMVA 4AKHA 1YIWA 3U7DA 3W1YA 2DWZB 2L00B 5E6JA 3QT4A 1GAQB 2BWEA 2I7NA 3UGBB 2F1GA 3KP0E 4BZAA 1JRUA 2M1MA 3QK0A 1XLPA 2O6VB 1PQSA 2LVQA 3WIMA 4KT0F 3AU4A 2KYWA 1IY2A 2Z8YM 4GC5A 2DWMA 1WMHB 2LHEA 2XGNA 2XFSA 4X66M 1IXSB 1V6EA 5IKCM 4B3SM 3NZUA 3PRPB 1WRIA 2KWDA 3I57A 2QNJA 4IBJA 1WIAA 4I6PA 4YYQA 3F75A 3SHQA 2GBRA 2EJSA 1GLOA 5GXGB 1BT0A 1TKYA 2RR9A 1MJGM 3E4RA 3GP7A 1XLOA 1EU4A 5D2MB 3TL4X 2K22A 2MJEA 2VQEM 2XK5B 1HNXM 5LXHA 4G4OA 1C77A 2XEPA 3GLHB 3JSVB 2N7JA 1V5OA 2K8HA 3TMPB 1D5MC 4ZRIA 2R44A 2C96A 3GP1A 4LF6M 4DHZB 1V2YA 3D8BA 1OTRA 4NAWA 4DXAB 3UJNA 1GO5A 3U8EA 2LTUA 2FCNA 3A1QA 2R4JA 3FAHA 4L4UA 2UUCM 4KVGB 1QOGA 3WAMA 4XGAB 3NHEA 3GRVA 2K6BA 4NRWA 2CJOA 3TUOA 4DXFA 4BS6A 4LLGM 1N34M 3JYUA 3L13A 3R9XB 4PDIA 4A3PA 3KDSE 2HD5B 1E9RA 4NSOB 2EELA 2RPQA 1NYQA 4KIKA 2P5TA 3EGRA 2NQ8C 5LLIA 1L0YB 1HA5A 2MP2A 1QXPA 2LVAA 4M9XA 4DV3M 2AUXA 2BB6A 2CIOA 2GMIC 1V97A 3KX1A 5ITXE 1FFUA 1OEYJ 1GMYA 4P6GA 3MHZA 2MX2A 1EIJA 2KWVB 4DMXA 3LFYA 1SSNA 2WXKA 3K2LA 3ABVB 1EWOA 2ZANA 4IBDA 1DGFA 2XH9A 1WGNA 1LXDA 2VH2A 1C76A 4L78A 2M8SA 1ME3A 2L09A 4BVUC 1JWUD 2JT4B 3L0WB 4MGZE 3H89A 3I3TA 2INPE 3KOZE 1XCTL 4MH0E 5KQ8A 3DBRB 3OJ4B 3C3EA 3T3OA 2J7QC 2LXEA 1HTOA 4BOPA 5EE9A 3EC8A 3CF0A 1N62A 2WNMA 3K9PB 3P4PB 2QBYA 1MVKA 1R4NB 3ZNHA 1KLUD 1TS3A 3OISA 3QC8B 2Y20A 2KDMA 5DFLA 1XXHA 4XWWA 2KMCA 1NQCA 3SEBA 3HJSA 3A9JB 2Y5BA 4IP3A 4D2KA 3V3XA 1QAOA 2AHMA 5HG2A 2ZVNA 1L7YA 4XX5A 3V60A 4D81A 4BB9A 1SJHD 1Y8RC 4WQOB 1C1YB 4FN2A 1ROEA 4LNOA 2BU3A 3QQ8B 3EIHA 2QSFX 2MJDA 2J7OA 2DZNB 2G3QA 2YFQA 1SXJC 1Q0WB 1QYRA 4I8OA 4P17A 3J80S 4ZUXU 3VDZA 1DEUA 4L6V6 4WJQA 4FK5A 1SIJA 2WYQA 5EXTA 4K7SA 4QRGA 2XU4A 1JW9D 3GPYA 2CHQA 1E7PB 2BS3B 1WHCA 3O0UA 4NQKE 4A6QA 4CIZA 1TTEA 2B1NA 3FE3A 1GJSA 4MZOA 2F5SA 1BXTA 1K3BB 2QC8A 3CSTA 5LXIB 1PRBA 1X37A 3WXEA 2KTRB 3DBRI 2FNAA 2MBHA 2LVPA 3GLIE 3Q14C 2PJHA 3URYA 3SU8X 3PSEA 4HL4A 4CHKA 2HJ8A 1N78A 2GBJA 3IFUA 1WYWB 3DVGX 1RU3A 2FH0A 1QDRA 4YYSA 3ZIMA 4DQOC 2ARYA 3K9OA 4GEWA 2UYZB 3W31A 3KOXE 3RVWA 3X0WA 5CVMA 1FIQA 1FO4A 1CJLA 4GB9A 3FRIA 3R66C 3SAWA 2KTRA 2JY7A 4JI7M 3D32A 2LVQD 2WWZA 3BK2A 3QYEA 2LJ5A 4DWFA 3GB1A 4ANVA 4EZJA 4NY0A 3L2AA 3OTOM 3KUZA 4ZRJA 1YVBA 1QLBB 3EHVA 4M9ZA 4AG6A 2KQSA 4PT5A 1AU0A 1BP4A 5FTLA 2JRIB 2EMTA 3VFDA 1GCBA 4GHAA 4H2AA 2PLPA 2YR0A 1PGAA 1JQJC 3H7PA 3MC0B 2LEKA 4I04A 2P86A 2LVOA 3LYYA 4JX1C 1RLFA 4GHLA 1I4QA 2UXCM 1T0QC 2L83A 1HE8A 4JLCA 2D3AA 2GOWA 2JWUA 3KYCD 2C99A 3B9PA 2D3GA 1W5SA 1C79A 1XHBA 1Z5AA 3TEZA 2MEKA 4HWYA 2DWLA 3H9DA 3S3RA 4L15A 3UIOB 1F2RC 5I4DA 3T9LA 4BBNF 3QARA 3B0AA 4L2YA 2FIDA 1WXQA 1NDDA 4Q2JA 1MI0A 1AN8A 2FOIC 5ITXA 4N8WA 3PT2B 3H7PB 4OU7A 3PHXB 4XYCA 3I63C 2DENB 4ZRKA 3LCVB 4YTPB 3RNAC 4MDKE 1FD6A 1HQYE 3L29A 3B79A 3IG3A 3HWSA 2AWTA 2BYEA 1ME4A 4EZLA 1UGMA 3RNVA 4KDLB 3BYTB 1WY8A 3JAMS 1N77A 3RT3B 4K1RB 2RRUA 2MJ5B 2UWQA 3LXFA 3W5VB 3FYDA 2PKOA 3FILA 2KXEA 3NUHB 4OX9M 2X4AA 1XNQM 4XE0A 2NQGA 4A90A 1D3ZA 2PEAA 2DCCA 3O65B 4PS7A 4HLEA 4RY2A 2I7PA 2M5ZA 3B89A 3J9CA 1POPA 4JI1M 1T3QA 1E94E 3W2DA 1NJFA 3FUVA 4GITA 5D94A 3F5VA 2XSZD 1P3QU 2L3ZA 2NTTA 1DO2A 2Z3XA 2BYFA 4REZA 1GABA 5CVNB 3MP9A 2LZ6A 1TGUA 2LH0A 1XEEA 1DKIA 1WIVA 2JNHA 2DX5B 5EE0A 5ITRA 2CHWA 1E9SA 3B74A 1CQVA 1J5EM 4JIOU 1HEZE 2MRPA 4YXDB 1IFYA 3U8ZA 2LXCA 3MTNA 3GLHE 2KFKA 1Q1OA 4TUWA 3A1QB 1I4GA 4ASWC 4DR7M 4DMYA 1IGCA 1EF5A 2G4DB 1WJNA 3KH0A 3DBLI 1KHPA 2WZJA 3PVSA 3LVWA 2C9WB 2OHFA 1JRPA 1DGHB 2AU1A 2C60A 4CHTB 1QZMA 3B7QA 2KC1A 5BMHA 1GECE 3FUUA 4QAYA 5L95C 4DR5M 2GQFA 1SBBB 4ZRQA 1MG8A 3UGJA 3S2AA 4DHJD 1C9FA 4PP2E 5C1ZA 2KNAA 2BT6A 3W30A 3HKPA 4FLHA 2DI0A 3NOBA 3CMMB 4LF8M 3FD9A 4WWOA 4KO8A 4JI8M 4E3CA 3KS8A 2DAJA 4DV6M 2M17A 3HIZA 5IO9A 1QF6A 1DGJA 1YX6B 3ETRA 2Z59B 4N4ZA 3B08A 1SJED 3GE3C 3OF8A 4BKSA 1TJEA 4A3OA 3H8CA 2MP2B 1V1PB 5C3JB 2G9HD 1D0KA 4MELA 1NYRA 2DC8A 2L8JA 2E03A 4MACA 5G2NA 2ZCCA 4YWGG 3TQSA 3R2TA 3B9JA 3IOQA 2B3TA 1V9JA 2QPAA 2CV1A 1FEHA 4QOZC 4B7FA 1NENB 3C8YA 1A70A 1QOAA 4GLSC 3QJ3A 4X6HA 3PHWB 2E5LM 2WU5B 1PIPA 1TDHA 5EXXA 5FTNA 1MEMA 1I35A 2R61A 4DR3M 3FTFA 2OOBA 2I38A 3IT4B 3CH3X 4FW9A 2ZW1A 4NL4H 3DA1A 3C0RB 2FCQA 3AB5A 4BOSA 1Q39A 1L5PA 3GRYA 1P0RA 1HT1E 1ICFA 2ZPYA 3JVZX 3RPFC 3TEYA 4A20A 2KW0A 4OVZB 3GQ4A 1D5XC 4E74A 1SXJA 1NBFC 2P0RA 3H4JA 4DR1M 1CQDA 4FCWA 1MN3A 1NLJA 3MHSA 2D5GA 2FAZA 1WF9A 3OWEB 1GJTA 4D8IA 2IZVB 3UI3A 1MHHE 1YJIA 2QDFA 1NL6A 3ZVVA 3ZCBB 3AFHA 5FKAC 2LFIA 3UQBA 2LHCA 3JW0X 2GHUA 4LTUA 1U4AA 2A4ZA 3KSEA 2KQ7A 4LJ6A 2KZSA 2XU3A 2ZNVB 2QCZA 1OQQA 4R71A 3R7QA 1U9VA 2BF8B 2MCNB 3DVGY 4NC6A 1IBXB 2F5QA 1YQ4B 2H1RA 3M99A 1OEYA 1UH6A 1QOFA 4D80A 3W5UB 4JXJA 2JXTA 5JI2E 5D3IB 3AEEB 2DAIA 3GRUA 3A45A 3HHAA 3AV8A 1WGDA 5DYGA 3PT2A 1YNTE 2CHVA 2JQRB 4KIKB 3AXCA 4MM3A 2IYDB 1PCIA 2HD5A 4NJ6A 4F7ZA 1OKSA 6PADA 3RFZB 1UGJA 1CZPA 2L0FA 2KDFB 1IM2A 1CPJA 3OVZA 1ZPSA 2W55A 3HU1A 4BKSD 3ZJTA 1WGYA 2J7NA 2R65A 1UWXA 1JALA 3NVWA 1V81A 3FKYA 2DC6A 2FQ9A 3NVYA 2JWZA 4CDEB 1MHWA 4Z6YA 3FILB 1KLVA 3MORA 2IY0B 3GRRA 2L0TA 3BVGA 4CZWA 2CU3A 3PW3A 4CDFB 2JXNA 2BDZA 4ARCA 1ISNA 3BK1A 2MBQA 1QQWA 3U6QA 1TY0A 3OVXA 3P5XA 4UDUC 4A55A 3K1JA 2R2QA 1F2CA 2CS4A 2OP3A 1OAIA 3L28A 2WXQA 3TEXA 4KGRA 3MJ5A 3GLFE 1WE7A 1ZOYB 3APFA 3N3KA 4DHZE 3HJQA 2G45B 1GPXA 2KNZA 1MU5A 4PS3A 4KZCA 2D7GA 3GLGB 4DUYM 2APLA 1L6UA 3H8HA 3ZDMC 3KXEC 4WJNA 1MG4A 4UN2B 4FVMA 1E7UA 5J94A 3OLMD 3SHGB 2CRUA 4BBAA 4GN1A 3WAOA 1SGHA 1TR8A 4FXCA 1ZMUA 3NZ3A 1ET9A 4GKKM 4JGHB 3VXWA 2JP7A 1WX9A 1XQQA 2KVZA 3VQIA 3GPPA 3DZDA 4AOFA 4BPVA 2BGFA 1OFHA 2L52A 2RMMA 1QMYA 4QRXA 1D0LA 3V6EB 2NBWB 5BO4B 4JI6M 2RD0A 4AWJA 2MW5A 1PE6A 4M00A 4A5UA 3CTWB 1U9XA 3LQRA 2Z0EB 3VHTC 3LQQA 4YHHM 2LNHC 4HXDA 4MGYE 4BOSC 4GOCA 3MTVA 3QJZA 1V34A 3EUB2 3U6LA 2Y0TA 3HU2A 3Q3JA 2NQDB 1NY5A 2D07B 4AP4C 1V1OA 1SNKA 2ZCBA 2J5YA 2BVCA 1SIFA 5E6NA 2WQYB 1SE9A 3HZJA 2AYOB 5G5GA 5D6JB 4B6WA 3AE5B 2RGFA 4LG2A 1YQBA 4RM8A 2BJWA 3L17A 1KXRA 3ZRFA 2XF3A 1WE6A 2ERCA 4GMQA 2OJRA 2Z8LA 1A5TA 3DFZA 1OFFA 2K9XA 1L0VB 1U5IA 3ALBA 3R2IA 5EDSA 2IDYA 5GKNA 2VHFA 1L1ZA 2FYEA 4B08A 5KHQA 4W9EA 1E8WA 3N1YC 9PAPA 5C18A 1XO3A 3E21A 3LW5F 1WSPA 2JRHA 1G59A 2L7RA 3WXFA 4GIPA 4O1NA 4XZ4A 3KW9A 4R3DA 2QHOA 2M4NA 2ZZPB 3QHTA 1GUAB 3VDPA 4ITQA 1FMAD 1L2NA 2FRQA 4HRSA 1RAXA 3MHSD 1PJIA 3VFKA 4JPSA 4KZ0A 2JXXA 1NNUC 1GKIA 5EP4A 3ZJVA 3B1LX 4RKUF 3U7ZA 2CHXA 2KKCA 5CTRC 1ZIVA 3L54A 1WJ6A 3NHEB 2NBUA 4Y28F 1VDDA 1XLQA 2FNJB 2KX3A 3ONSA 4US8A 5KPRA 4AKGA 4GXBA 3E56A 2FUG1 4W9LA 3ILKA 1T6OA 1K50A 2WS3B 4LDTB 1SG9A 4DR4M 1Q5WB 4XDCA 2V1UA 4HXDB 1VZ7A 4KDIC 4N58A 5BMGA 4AI6A 1VEJA 4NAMA 4LZZA 1TKEA 5CHVC 3HGIA 1TH2A 3KKUA 2BB5A 2N4FA 4IM2A 2J0KA 2QILA 3N1XC 2N7EA 4HPLB 4MGIE 3KOWE 2K25A 2PBHA 3NBIA 2X38A 1HJPA 2WXFA 1CVZA 1HQRD 2C7HA 3BZDB 3M6AA 4OEMA 4NNJB 1WJ4A 2J0MA 3RGPA 1DGBA 4IUMB 4J6IA 1KF6B 2ACTA 1E6EB 2MSED 3USVA 4XR7A 3UMMA 3BXWA 1IN8A 4WAFA 1TF0B 2BYVE 1IUEA 3ZNZB 3BB7A 4GH9A 2LASA 1UNSA 1E32A 2LHDA 3MC9A 2L76A 3PHWA 3IEJA 3SMPA 4FJZA 2QENA 1N63A 3WCQA 1P3QQ 3GE8C 5A2QS 4OZBA 3BC3A 4I5SA 4ZHOA 2KFJA 3UK6A 3HHWA 1YMHE 3E9SA 1F9JA 2PMVA 3DF0A 4DUZM 1KYIA 1K82A 2KT7A 2ZVOA 1ESFA 1Z5BA 1XD3B 1PXVA 3VH3B 1HQCA 2MH8A 2FCMA 1I42A 2QBYB 1J8CA 4P16A 4W4UA 2Z4SA 1TS2A 3BVZA 2V9HA 4M0WA 2QHOB 4NXNM 1WXSA 3AOEC 4XC2A 4M9SA 2F5OA 5DPRA 2JY5A 1GL7A 2CJNA 1UD7A 4C4VA 4G4RA 2HAKA 3AEBB 1EU3A 2R9FA 1FNNA 4EKUA 4RH6A 2PNSA 4IDIA 4K7WA 3AECB 4W9DA 5ITUA 2RDGA 3IV2A 4LZJA 4W9IA 1V8CA 1EWPA 3J27B 5D7GA 2KC2A 4RKXA 2NBVB 4JYAM 4JI5M 4G6ZA 3CWIA 4MSMB 1MX0A 1AU4A 1VEKA 3ECIA 3N3GA 4RF1A 1WGKA 2DVWB 2G7YA 1ENFA 2FE8A 1RFAA 5JXVA 2SAKA 1ZGUB 1PM5A 4G0NB 2A5YB 1R7SA 2MLBA 1HZ6A 1H6UA 2JQFR 2KQ4X 4MZSA 1XMOM 3LCUA 1XMQM 1G41A 4LJ9A 2G4SA 1PGBA 3C9EA 3SDLC 2N1VA 3PVLA 3AE7B 1VZ6A 2YNMD 2F5NA 2PPHA 5G55A 2R18A 2O6XA 2KWUB 3V6EA 2JZ1A 1LGRA 2XLJA 3B7NA 2MQJA 2WDRB 1Z5SB 4WJPA 1K53A 1C78A 1T43A 4L16A 1U9QX 3B21A 3F92A 1UZXB 3EFUA 4MH8A 5J2RA 1PPOA 3Q8AA 4ZOHC 4BQVA 3ML8A 2XZUA 1IXSA 1F2RI 3KS4A 3BBAA 1NJGA 1IBXA 4AJYB 5LMNM 1D2NA 4ZYSA 1UFZA 3T15A 2J7QA 1L0XB 2AL6A 4IW0A 2DLBA 4USAA 8CATA 2WXJA 1EF1A 3VTWA 1SP4B 2KZUA 4YL8A 3GLFB 3L08A 5CHFA 1QQRA 3SFZA 1GJZA 2PVOD 4K0KM 4ANWA 2ZTCA 2MR9A 2SEBD 3KOYE 1J7AA 1LFDA 2KLCA 2REXA 3IAS1 4CO7A 1Z6TA 3NRZA 4AUQC 1B9RA 1N5WA 2O2VB 3P4RB 7CATA 1L2DA 3RN9C 1MDWA 3CBJA 5BPVA 5BYSA 2FTDA 2L4EA 3APCA 1SXJB 3THGA 2CWBA 2O25A 3HU3A 4FWGA 4MJSA 1F2AA 2V4LA 3K9PA 2P7UA 4BOQA 2A5UA 4IWQA 2IBIA 4XWTA 3SC3A 3RVXA 2QIEB 4XUIA 2KLGA 4D8EA 2XFTA 2Z4RA 4LFAM 3PHXA 3NG0A 2YJ2A 5J17A 5E6OA 1VG5A 4W9JA 2YJCA 4ARIA 2HJ1A 5FLXS 2DBYA 3AM9A 3R8FA 2LJIA 1PJQA 1GOZA 4KKJA 3IG8A 4G54A 3NZSA 2RPVA 1KH0A 2LRWA 3MTNB 4S12A 2F7DA 4WA6A 1QAQA 4X62M 3AE6B 5EZSA 3DBLB 1JB0F 2K0BX 2QZ4A 5FTJA 3RZWC 4YSZB 3HM3A 5IAAC 1CSBB 1I4WA 2AQ1B 4DV2M 2XU5A 2C9OA 4FCTA 3DQVA 2JZPA 4JE3B 2WGSA 1TY2A 1H4RA 3RD2A 3OQCA 5FR3A 2CV0A 2D10A 2R9CA 5FTMA 2AQ2B 1GB1A 2AYNA 4DBGB 3U60B 1I4RA 3A9KB 2R6NA 2MBOA 2UXBM 5IA7A 1Y08A 5F3WA 3H1UA 1HUCB 1CUKA 2C0YA 3IUTA 2R9MA 4MI7A 1QOLA 3Q69A 5KPTA 1V5TA 1ET6A 2LMCA 3P4SB 4EFOA 1HTQA 1SE2A 4G3XB 3RFWA 1FH0A 1T0YA 1NI2A 4I6NB 2XSZA 1RWSA 4JQWC 3BCNA 2DZLA 4OVUA 4W9KA 3BOWA 3T1YM 4PADA 2OOAA 4DXGA 3HY5A 2GB1A 3ZRCA 2WXIA 3MMPA 2ATOA 1IN6A 4NOOB 2Z0DB 4M8MA 1S3SG 3I51A 3SR6A 2HL7A 1N5XA 2CKHB 2ZJDA 4GGQA 4HPMB 3TCAA 2HWKA 3PRMA 1PJSA 2J4XA 3AMZA 1N75A 2LGSA 2M56B 4KKIA 3KWVA 2VZKD 2PREA 2XU1A 4WP2A 2FBWB 5TSSA 5HHDG 4KSLC 5HKHA 2H5XA 1Q10A 5EP3A 4XZXA 4W9GA 2ZNVC 3V6CB 1YE9A 4NRVA 3Q6BA 3GS2A 3PPAA 2CV2A 4ITKA 5MPOA 8PCHA 4DV1M 3KVWA 3AE4B 4E71A 3A42A 1JMLA 2DCBA 4OHJA 4EUTA 1ZKHA 4PD2A 3AV0A 2GRIA 2E6XA 1V33A 2DYMA 3QSDA 3T38A 5H8YE 2G8JA 1YK7A 1N33M 3GZNI 4II7A 1ZXIA 3V05A 1Y56A 4RMAA 2DAFA 3Q8EA 1E8YA 5FR6A 2ZBKB 1KM7A 2E3TA 2DWQA 4ICVA 4GSWA 3SD5A 1Q3BA 2ASQA 3O65A 2F5PA 3RNCC 3HHMA 3APDA 1UBQA 1R2ZA 1T5XD 2IO1B 3KUCB 3M3JA 3RCZA 4DDGD 1T3TA 3O13A 1KFYB 5KHOA 1DOYA 5ITQA 3VK7A 3ZYYX 2JYTA 3Q8BA 5JZEA 4XK8F 1ACCA 2D7EA 3R3MA 4FA6A 3FC4A 1I7HA 3QX1A 4KODA 1WH3A 4CGYB 4IM0A 3PHUA 3VUXA 1AYWA 1ITOA 3AOEA 1GC6A 2Y3AA 4BKTA 2BWFA 1I94M 1WGLA 2INCC 3DHHC 2FUDA 2B1MA 1KHQA 5EE3A 4QRVA 1IXZA 1F2BA 2WDTB 2LXAA 1IPGA 2JU6X 3V76A 3AEDB 1UM8A 2JY6A 1BVSA 3L4PA 2AQ3B 4IBBA 1FJGM 1T0SC 2KMAA 2O6VA 2I2YA 2RDBC 2WP9B 3Q8XA 1YOVB 4LF7M 2QEJC 4HJGE 3ZJUA 3IHPA 3PGEA 1JQPA 5CHVA 3PZ8A 4TV3A 3BPFA 1WMHA 3QIJA 2BS2B 3ZGZA 1YK8A 3AEFB 2C9CA 3RNBC 1XXHB 1FNUA 1BQIA 1T0RC 4A8XC 3MFGA 2KWCA 2R46A 1CMXB 2FRAA 3IFWB 3ZDTA 4DDID 4DHJB 1AW7A 4GKJM 2YJBA 1EF7A 3M7GA 4JI3M 4AKIA 5JA7A 2BDLA 1TH3A 3TBLD 1YJ1A 4G50A 2DJGB 2Z7JA 1WR6E 4B3MM 1WX7A 2OO9A 2VDBB 3AI8A 2VHSA 3JSVA 1R5LA 4B3TM 1QDTA 1N60A 1R4MI 1SE4A 2V3PA 4AW4A 4OELA 2R9NA 2KDEB 2R4EA 4MB7A 1I4PA 3A4SC 1V80A 1R2YA 1G71A 2X8XX 4G3OA 3GPUA 1VLBA 3E46A 4MM3B 1KJTA 1CB5A 1M6DA 4OW0A 2OEDA 4KSKC 4QHSA 3KSJA 4PYZA 4W9CA 2K47A 1L8QA 2DKLA 4C7ZA 1T6BX 1SE3A 4KV2A 3R7RA 4EZKA 3Q3FA 1STFE 1KTKA 2DYBA 4GUAA 2DZKA 2PE9A 3VK8A 3PTFC 4P6VF 2L4FA 5KQDA 2BTEA 5DPSA 2KZRA 3DBHI 1VRAB 1EWYC 3ZO5B 4YVAA 1OFIA 4TSSA 4P6EA 4FADA 1O0EA 3DDCB 2QCUA 3AI5A 3L27A 1XT9B 3HUIA 1AECA 2V1CA 4B0EA 5JHBA 1KSFX 2MBBB 3P5WA 4HJKA 3IXSA 2WBFX 3NJTA 1TT5B 3BBZA 4LJ8A 5L83A 2E02A 4LGYA 3SFEB 1LO5D 3BIID 2NR2A 3U6PA 1YT7A 1QUSA 1TS5A 2Q5WD 4KGTA 1AUAA 2N0SB 1XC8A 1MEGA 4RGTA 2DC9A 3TE6A 1N32M 3ZC7B 2CE7A 3GLIB 4IIWA 5CHWA 3FKEA 3VLFB 5BMIA 1WZ0A 5KO3A 1VEGA 4X6JA 1WI0A 2IY1B 3CBKA 1VR9A 1JWBD 4RF0A 3H6NA 3MK6A 3W0LB 2C7MB 4GDLB 4HCNB 4M8NA 2VH1A 2OJWA 4C4VB 1QUTA 1IY1A 4L8RC 1IN4A 2J7QB 1EUVB 4ANRA 1E0ZA 3GPXA 2D7HA 4IKGA 2VRRB 3GO8A 3PBHA 2AGAA 1G6JA 3N32A 2M0XA 2DNFA 2QSDA 3VH4B 2ICIA 3GCBA 1P98A 1OQRA 3M62B 1TDZA 4D8BA 1PGYA 1YZBA 3FYCA 3T3NA 2PE6B 2OZ2A 1JCKB 3U6OA 2UXDM 2LUMA 3HK0A 4WH4A 1IP9A 3BY4B 1CK1A 5LNK1 3PSEB 2DYOA 3WXGA 1IN5A 1Z2MA 3RYTA 4LJ4A 4B3RM 4BKGA 3SAUA 3QCAA 4LGMA 3LDZE 2E01A 4M0DA 2RSUA 4HWIB 1PVJA 2M19A 4IWPA 2FT2A 2IO0B 4AXLA 1WM2A 2EO2A 2QQ8A 3RZFA 4AQ7A 3CH2X 2EKFA 3BINA 3NS8A 2L2DA 1OGWA 3D8LA 2JPHA 1K8RB 4C80A 3EECA 3AE3B 1FXIA 4ZTBA 2DHRA 2D11A 1F1HA 3VR9B 1FPYA 1L4ZB 5EJCA 2O01F 3SMSA 1SXTA 2GNOA 2N9LA 7PCKA 1RM6C 2KN4A 2EMSA 1N6ZA 2PTLA 1YN5A 1TYGB 1PDXA 3CF6E 3HHYA 3TWLA 1HNWM 4YYRA 4JL9A 1XXGA 2AL3A 2XNAC 3U5ZB 2DWNA 1WX8A 1C3TA 3HD3A 1GVNA 3J7BA 1NVID 1YX5B 1V92A 4HROA 3TRKA 2L1AA 1TTNA 5EP1A 2KOXA 3NWLA 3LVVA 3SFDB 3AE9B 1IXRC 4FHKA 3QWLA 1CS8A 3P42A 4PCZA 3KWZA 2AEHA 4GDKB 3U6CA 1J7KA 1JR3D 4C7YA 1G4AE 2Q2EB 5DNYA 4YSYB 5HI1A 1XLNA 4IBGA 1F29A 3CGWA 5E6PA 4LJPB 3RULA 4LNNA 3ENEA 3WALA 3HX3A 4HLQA 2L32A 1GB4A 3PZDA 4LFBM 1PYWD 3PNRA 2GBNA 4MT5A 4WW0A 2F4VM 1NHGC 2R45A 3VKHA 2IGDA 2M0AA 2PVGC 1M4VA 2ON8A 2BW2A 4HEA1 2UUAM 5AZFA 2ACZB 3Q8FA 1ZMWA 4LNFA 3C19A 2WHIA 3U6DA 3Q3NC 1THEA 3JR5A 4F1IA 3Q2AC 1Q3CA 4DV7M 3HRDD 1D0MA 1EWCA 3WHLA 3IMAA 5GMVA 3I3TB 4I05A 1LV7A 5EXPA 1VDVA 3I5JC 2LI5A 2WX0A 3ML9A 3H7SA 4YTNB 1PJJA 1PADA 4D82A 2UUBM 2R9OA 4MSXA 3HJ8A 3K9OB 2IO3B 4B7GA 2HTHA 1DGGA 2EKKA 1J19A 4LFCM 1YN3A 5DCNA 1AYVA 1IBLM 3NBXX 3P63A 3AEAB 2RGOA 2ZW0A 2FO5A 3ZXVA 4HDOA 3RMKC 2BBCA 3ZTCA 4Q8GA 4QNMA 1BMLC 1VCBA 2WLBA 3EFCA 2DZJA 1VD2A 1P9DU 3ZNGC 3SBJA 2BPSA 2O6VD 3K8ZA 4M02A 4KLBA 2N9XA 1EO6A 3NVZA 4NPNA 1FRRA 3MP2A 1E5WA 2Y5CA 3GLGA 2H7JA 2X49A 3DOWA 2KHWB 3OJ3A 3W0FA 4KGSA 2HE7A 2BNKA 2CEAA 3N3KB 4P1BC 3TJPA 2V4IB 3A4RA 4CQNA 2DHZA 4KX6B 1JR3A 2N1WA 1C4PA 5BR8M 2C7NB 2Y5PA 4RCOA 5JHAA 2HHNA 4HPPA 2R2OA 2NPTA 4OZCA 2MGWA 1PJTA 1Y8GA 3CSFA 4F8CB 2KMMA 4S17A 4DR2M 3ZXRA 2OPFA 2R0IA 2WSEF 3PNYA 3AE1B 2EUCA 1A5RA 4LJOB 1P7EA 2Y5BB 3AL0C 2KVRA 3PO0A 1HR0M 3A33B 2HKJA 2G1EA 2J42A 2V6ZM 4EOYA 5EZQA 3U30A 1PPPA 2KFKB 4L1BA 2M60A 1FNVA 4RNAA 1WGGA 1UWMA 3W1SC 4MGKE 2YJ8A 4MSQB 4RM9A 1AU2A 1TL9A 3NY5A 4FWDA 2MROB 1NEKB 2JSVX 3RNEC 2WDQB 1PBHA 1DGHA 1PFDA 3UINB 3TL5A 3RNGC 3A46A 1TIFA 1R7RA 3N9YC 3J7AS 1CV8A 2G6DA 1V86A 1OIZA 2DJFB 2K1FA 2DXIA 1OIPA 1JWAD 2UZJA
chains in the Genus database with same CATH topology
1ZE3D 1L2CA 1TS4A 4DV5M 2IGGA 3EIEA 2WDVB 3PZ7A 2MH7A 2N9KA 2JYEA 2ZAMA 2BTWB 1EM7A 3HVDA 1MPEA 2KACA 5C2TB 1QOBA 3BOSA 3AEGB 4XGIA 2KRUA 4A9AA 2W3RA 2QJLA 1XNRM 4MGHA 1XF5L 3DOAA 1VZ8A 4IJFA 1G3IA 1ZP0B 1UUPA 4AZFA 1ZDXA 3LB8C 4TQ0A 1N61A 4JV5M 1Z5CA 5EE1A 2VIIA 5IZ7D 1L2BA 4I4LA 4LRTA 1FNWA 1JROA 3KW6A 3BWUD 4CISA 4ZHPA 3FTEA 1YQ3B 4AG5A 1ORYB 1NSFA 2IPKD 5IWAM 1XCQL 4JI4M 3PNVA 1J7BA 3HHXA 4R7GA 1D6EC 2KA6B 3I4VA 3FUXA 3TWMA 1DOIA 1NI3A 1RFKA 4NZLB 1E9MA 2Y21A 4LK0M 4DR6M 2K5PA 4HKQA 2BS4B 4LCBA 2MJ3A 2V0GA 2KAJA 4ZRPA 2PW9A 1K3WA 5FK9C 1B1ZA 1QVRA 2YQZA 1I4HA 1IBMM 1GLNA 1P7FA 2WXNA 5EXSA 1K3XA 1NHWC 2L6OA 1UKFA 2VQFM 4G4NA 1R6BX 1CJEA 1K52A 3GLHA 2JA2A 3FTDA 3HVZA 2LGIA 1DYQA 2YEPB 4LJAA 1Z59A 2NMQA 5G5HA 3SYLA 4YSXB 2W82A 2ZM6M 4RFBA 1ZQ9A 4JWUC 5AUIA 3U6EA 1SXJD 1IN7A 2GI9A 2IGHA 5JI3E 4XDDA 3KLSX 4LRSA 2KEBA 2HCBA 1I4XA 1PUTA 3PFIA 3J2PB 2QMTA 2UU9M 2TSSA 1SXJE 5EQTA 1HXYD 3SASA 2L7IA 4OVZA 1FXAA 4IBEA 1YN4A 1J09A 4WURA 1HNZM 3JR4A 2WXMA 3U61A 2L7HA 2K0PA 2C98A 1WWTA 5LMUM 4IJEA 4HKZE 4WWMA 1TKGA 4XBOA 2LWXA 1C4CA 1AWDA 1KFVA 4IBCA 1D5ZC 4LY6A 3U4EG 2W54A 1OJLA 3SHFA 4B7HA 2Z84A 2QP9X 3AE8B 3C58A 5KPZA 4WQMA 2FFJA 2YEPF 3NS1A 5EP2A 4NAWB 2RKOA 1IBKM 3BY4A 4BOZA 3RGSA 2JX5A 2G8LA 3M0EA 4EIWA 4YY3M 5IREB 2RGHA 3ZH9B 1KLGD 1DO0A 3AJIB 4FCVA 1BUIC 5H37D 4EE2A 2KRKA 4X65M 4JI2M 1NNJA 3IAM1 2V3NA 3KQ4A 3GLFA 4C56C 3MHVC 4KLNA 3SARA 3U52E 3EA6A 2H88B 4US9A 2RDHA 5ITYA 3CF2A 3KP1E 2BTWA 4LJ7A 1L6VA 1STEA 5FTKA 1VJKA 1YJJA 5ITTA 3I9V1 4IUMA 2OQ4A 1JWMD 2JTCA 4QNRA 1YSYA 4YT0B 2W3SA 1HZ5A 4BOUA 5IT9S 4DV0M 2CHGA 1QT9A 3GLIA 2AX5A 4RGNA 1C4AA 1JWSD 2DOSA 2J52A 4AQYM 5BYRA 2H89B 2CUZA 3GQ5A 2J53A 1TH4A 5BYQA 2B76B 2WXLA 1E10A 4JI0M 3TMPA 1FFVA 5E26A 4OZAA 2HTME 4YTMB 1NVMA 3KFUG 1GL6A 3AH7A 1ZDVA 4ZPXA 2Y0QA 3U6MA 2WXOA 2X8AA 1MHXA 1QILA 3IG5A 4Z8XA 1DOXA 1SF0A 2HHHM 2WXGA 1SEBD 1W5TA 1IGDA 3C0RA 1J7CA 3P4QB 4AS1A 4KHPM 3R8BA 2C5RA 3FUWA 1F77A 3HHZA 3LMMA 4NXMM 4G4QA 2HDEA 3BVMA 1IY0A 3DWMA 4J3OD 4TQ1A 2ZAOA 4RGOS 4TMAB 2XN9C 2CFOA 1ZUD2 3CIRB 4X64M 3SATA 4L23A 4RGMA 1HT2E 1L4DB 3A98B 3W1SA 1ZAEA 4W5WA 3VRBB 1FCLA 1FRDA 4IOIE 3SAVA 5AUKA 3W9CB 4BLCA 2IJ0A 3TSSA 3FUTA 4FD2A 2BJVA 1YUBA 2NTSA 1QKZA 2EA0A 3H4MA 4IBKA 1QAMA 2R62A 4B0MA 5HFYA 2BYTA 2O5RA 4N59A 4DV4M 1F0ZA 1IQPA 3U60A 3SYKA 1FM0D 2EKIA 3L26A 2INNE 2WXRA 3TWKA 3VR8B 4FWHA 3VRAB 3U6SA 2ONQA 3DWGC 3U5ZA 2VZKB 2WXHA 1QANA 3Q8CA 1XWIA 3K92A 3RE8A 2PIAA 4LF5M 4A3VB 3U61B 4WIPA 4LF9M 3PXGA 1KRHA 4NSRA 4LJ5A 3I4YA 4IBIA 1SB3C 4I81A 5C1BA 3J81S 2XZFA 2DZOB 4QOSA 3FTCA 3AOGA 3NVVA 4JWSC 2G5GX 1K51A 4GRIA 3B2GA 3IT6B 5T8IA 5H92C 3PRPA 3TEWA 3WHKA 1S3SA 3QAUA 4N6EB 2K3UA 1ZXHA 3VKGA 3ZQ4A 3TPZA 1N36M 1PGXA 3U2SC 3AN1A 2JRIA 5DYIA 5FSWA 1TZOA 3KWLA 3B2FA 3BYYB 5D3DA 1EE8A 4NJCA 1JQ4A 3KSXA 2WXPA 4IBFA 4PDGA 1L1TA 3VDUA 1RYJA 4JN6A 3P1MA 1C1KA 3L25A 3GQ3A 1AYFA 4LF4M 3T1HM 3AE2B 1WYGA 4GC9A 4QHTA 1V1PA 1FCCC 1G8PA 1D4BA 2WU2B 3UZUA 1NY6A 3AKZA 4AKHA 2DWZB 5E6JA 1GAQB 2I7NA 3KP0E 1XLPA 1IY2A 2DWMA 4GC5A 2LHEA 2XGNA 2XFSA 4X66M 1IXSB 4B3SM 1WRIA 2KWDA 3I57A 4IBJA 5GXGB 1TKYA 3E4RA 3GP7A 1XLOA 1EU4A 3TL4X 2K22A 2MJEA 2VQEM 1HNXM 4G4OA 1C77A 2XEPA 3GLHB 2N7JA 1D5MC 3GP1A 2C96A 4LF6M 3D8BA 3UJNA 2R4JA 3FAHA 4L4UA 2UUCM 1QOGA 3GRVA 4NRWA 2CJOA 4DXFA 3TUOA 4LLGM 1N34M 3R9XB 4PDIA 3KDSE 1E9RA 4NSOB 2EELA 1NYQA 2P5TA 3EGRA 2NQ8C 1L0YB 1HA5A 4M9XA 4DV3M 2BB6A 1V97A 5ITXE 1FFUA 3MHZA 1SSNA 2WXKA 3K2LA 3ABVB 2ZANA 4IBDA 1DGFA 2XH9A 1C76A 4L78A 2L09A 1JWUD 4MGZE 2INPE 3KOZE 1XCTL 4MH0E 5KQ8A 3T3OA 2J7QC 2LXEA 4BOPA 5EE9A 3CF0A 1N62A 2WNMA 3P4PB 2QBYA 1MVKA 3ZNHA 1KLUD 1TS3A 2Y20A 2KDMA 1XXHA 4XWWA 3SEBA 3HJSA 4IP3A 4D2KA 3V3XA 1QAOA 2AHMA 5HG2A 4D81A 4BB9A 1SJHD 1ROEA 2BU3A 3EIHA 2MJDA 2J7OA 2DZNB 2YFQA 1SXJC 1QYRA 4I8OA 3J80S 1SIJA 5EXTA 1JW9D 3GPYA 2CHQA 1E7PB 2BS3B 4A6QA 2F5SA 1BXTA 1X37A 2FNAA 3URYA 3PSEA 4HL4A 1N78A 3IFUA 4DQOC 3W31A 3KOXE 1FIQA 1FO4A 3SAWA 4JI7M 3BK2A 3GB1A 3L2AA 3OTOM 1QLBB 4M9ZA 4AG6A 4PT5A 5FTLA 3VFDA 4GHAA 4H2AA 2PLPA 2YR0A 1PGAA 1JQJC 3MC0B 2LEKA 3LYYA 4JX1C 4GHLA 1I4QA 2UXCM 2L83A 2JWUA 3B9PA 2C99A 1W5SA 1C79A 1XHBA 1Z5AA 3TEZA 2MEKA 2DWLA 4L15A 1F2RC 5I4DA 4L2YA 1WXQA 4Q2JA 1MI0A 1AN8A 2FOIC 5ITXA 4OU7A 4YTPB 1FD6A 1HQYE 3L29A 3HWSA 3RNVA 3BYTB 3JAMS 1N77A 3LXFA 3W5VB 3FYDA 2PKOA 3FILA 2KXEA 3NUHB 4OX9M 2X4AA 1XNQM 4XE0A 4A90A 2I7PA 2M5ZA 3J9CA 4JI1M 1T3QA 1E94E 3W2DA 1NJFA 3FUVA 4GITA 2XSZD 2NTTA 1DO2A 2Z3XA 4REZA 3MP9A 1TGUA 2LH0A 1XEEA 1DKIA 5EE0A 5ITRA 1E9SA 1CQVA 1J5EM 1HEZE 4YXDB 4TUWA 1I4GA 4DR7M 1IGCA 3PVSA 3LVWA 2OHFA 1JRPA 1DGHB 4CHTB 1QZMA 5BMHA 3FUUA 4DR5M 1SBBB 4ZRQA 3UGJA 1C9FA 2BT6A 3W30A 3HKPA 4LF8M 3FD9A 4KO8A 4JI8M 3KS8A 4DV6M 1QF6A 1DGJA 3ETRA 1SJED 1TJEA 1V1PB 5C3JB 2G9HD 1NYRA 4MACA 4YWGG 3TQSA 3R2TA 3B9JA 2QPAA 2CV1A 4QOZC 1FEHA 4B7FA 1NENB 3C8YA 1A70A 1QOAA 4GLSC 2E5LM 2WU5B 1TDHA 5EXXA 5FTNA 2R61A 4DR3M 3FTFA 2I38A 3IT4B 4FW9A 2ZW1A 4NL4H 3DA1A 3AB5A 4BOSA 1Q39A 1L5PA 3GRYA 1HT1E 3RPFC 3TEYA 2KW0A 4OVZB 3GQ4A 1D5XC 1SXJA 4DR1M 4FCWA 2D5GA 3OWEB 4D8IA 3UI3A 1MHHE 1YJIA 3ZCBB 3AFHA 5FKAC 2LFIA 4LTUA 4LJ6A 2KZSA 1OQQA 1IBXB 2F5QA 1YQ4B 2H1RA 3W5UB 1QOFA 4D80A 4JXJA 2JXTA 5JI2E 5D3IB 3AEEB 3GRUA 3A45A 3AV8A 5DYGA 3PT2A 1YNTE 2CHVA 2JQRB 3RFZB 1UGJA 1CZPA 1IM2A 1ZPSA 2W55A 3HU1A 3ZJTA 2J7NA 2R65A 1UWXA 1JALA 3NVWA 3NVYA 4Z6YA 3FILB 3GRRA 3BVGA 2CU3A 4ARCA 3BK1A 1QQWA 3U6QA 1TY0A 4UDUC 4A55A 3K1JA 3L28A 2WXQA 3TEXA 4KGRA 3MJ5A 1ZOYB 3HJQA 1GPXA 1MU5A 2D7GA 3GLGB 4DUYM 1L6UA 3H8HA 3KXEC 4FVMA 3SHGB 4BBAA 4FXCA 3NZ3A 1ET9A 4GKKM 3VQIA 3GPPA 3DZDA 1OFHA 2L52A 2RMMA 4JI6M 4A5UA 3CTWB 3LQRA 3LQQA 4YHHM 2LNHC 4MGYE 3MTVA 3EUB2 3U6LA 2Y0TA 3HU2A 1NY5A 1V1OA 2WQYB 5G5GA 3AE5B 4LG2A 2BJWA 2XF3A 2ERCA 4GMQA 2Z8LA 3DFZA 1OFFA 2K9XA 1L0VB 3R2IA 2IDYA 5GKNA 1L1ZA 4B08A 5C18A 1XO3A 1WSPA 1G59A 4GIPA 4O1NA 4R3DA 3VDPA 4ITQA 1FMAD 4HRSA 1PJIA 4JPSA 1NNUC 1GKIA 5EP4A 3ZJVA 3U7ZA 1VDDA 1XLQA 4US8A 5KPRA 4AKGA 3E56A 2FUG1 3ILKA 1K50A 2WS3B 4DR4M 4XDCA 4HXDB 2V1UA 1VZ7A 4N58A 5BMGA 4AI6A 4NAMA 4LZZA 1TKEA 3HGIA 1TH2A 2BB5A 2QILA 4MGIE 3KOWE 3NBIA 2X38A 2WXFA 1HQRD 3BZDB 3M6AA 3RGPA 1DGBA 1KF6B 1E6EB 3UMMA 1IN8A 4WAFA 1IUEA 3BB7A 4GH9A 1UNSA 1E32A 2LHDA 3PHWA 3SMPA 2QENA 1N63A 3WCQA 5A2QS 4OZBA 4I5SA 4ZHOA 3UK6A 3HHWA 1YMHE 3E9SA 2PMVA 4DUZM 1KYIA 1K82A 1ESFA 1Z5BA 1HQCA 2QBYB 4P16A 2Z4SA 1TS2A 3BVZA 4M0WA 4NXNM 3AOEC 4M9SA 2F5OA 1GL7A 2CJNA 4G4RA 3AEBB 1EU3A 1FNNA 4RH6A 4IDIA 3AECB 5ITUA 2RDGA 4LZJA 1V8CA 3J27B 5D7GA 4RKXA 4JYAM 4JI5M 4G6ZA 3CWIA 1MX0A 4RF1A 1WGKA 2DVWB 1ENFA 2FE8A 5JXVA 2SAKA 1PM5A 2A5YB 1R7SA 1HZ6A 1H6UA 2KQ4X 1XMOM 1XMQM 1G41A 4LJ9A 1PGBA 3AE7B 1VZ6A 2YNMD 2F5NA 2R18A 2XLJA 2WDRB 1K53A 1C78A 4L16A 3B21A 4MH8A 3Q8AA 4ZOHC 2XZUA 1F2RI 3KS4A 3BBAA 1NJGA 1IBXA 5LMNM 1D2NA 4ZYSA 3T15A 2J7QA 1L0XB 2DLBA 4USAA 8CATA 2WXJA 2KZUA 3GLFB 1QQRA 3SFZA 2PVOD 4K0KM 2SEBD 3KOYE 1J7AA 3IAS1 1Z6TA 3NRZA 1B9RA 1N5WA 3P4RB 7CATA 1L2DA 5BPVA 5BYSA 1SXJB 3THGA 3HU3A 4FWGA 4BOQA 4XWTA 3SC3A 2QIEB 4D8EA 2XFTA 2Z4RA 4LFAM 3PHXA 4ARIA 5FLXS 2DBYA 3AM9A 3R8FA 2LJIA 1GOZA 4KKJA 3IG8A 2RPVA 1KH0A 4S12A 1QAQA 4X62M 3AE6B 5EZSA 2QZ4A 5FTJA 4YSZB 1I4WA 2AQ1B 4DV2M 2C9OA 4FCTA 2JZPA 4JE3B 1TY2A 3OQCA 5FR3A 2CV0A 5FTMA 2AQ2B 1GB1A 3U60B 1I4RA 2UXBM 5F3WA 4MI7A 3Q69A 5KPTA 3P4SB 1ET6A 2LMCA 1SE2A 3RFWA 2XSZA 1RWSA 3T1YM 4DXGA 2GB1A 2WXIA 1IN6A 4NOOB 3I51A 3SR6A 2HL7A 1N5XA 2HWKA 3PRMA 2J4XA 3AMZA 1N75A 2M56B 4KKIA 3KWVA 2VZKD 2FBWB 5TSSA 5HHDG 1Q10A 5EP3A 4XZXA 1YE9A 4NRVA 3GS2A 2CV2A 4ITKA 5MPOA 4DV1M 3KVWA 3AE4B 3A42A 1JMLA 4OHJA 4PD2A 3AV0A 2GRIA 2E6XA 2DYMA 3T38A 5H8YE 1N33M 4II7A 1ZXIA 3V05A 1Y56A 3Q8EA 2ZBKB 2E3TA 2DWQA 1Q3BA 3O65A 2F5PA 1R2ZA 1T5XD 1T3TA 3O13A 1KFYB 1DOYA 5ITQA 3VK7A 3ZYYX 2JYTA 3Q8BA 5JZEA 1ACCA 2D7EA 3FC4A 1I7HA 4KODA 4CGYB 3PHUA 3AOEA 2Y3AA 1I94M 5EE3A 1IXZA 2JU6X 3AEDB 1UM8A 3L4PA 2AQ3B 4IBBA 1FJGM 2I2YA 2WP9B 3Q8XA 4LF7M 2QEJC 4HJGE 3ZJUA 3PZ8A 2BS2B 3ZGZA 3AEFB 2C9CA 1XXHB 1FNUA 4A8XC 3MFGA 2R46A 1AW7A 4GKJM 3M7GA 4JI3M 4AKIA 1TH3A 2Z7JA 4B3MM 4B3TM 1N60A 1SE4A 2V3PA 4AW4A 2R4EA 4MB7A 1I4PA 1R2YA 3GPUA 1VLBA 4MM3B 4OW0A 2OEDA 4QHSA 3KSJA 2K47A 1L8QA 4C7ZA 1T6BX 1SE3A 4GUAA 1KTKA 3VK8A 4P6VF 2BTEA 5KQDA 1VRAB 1EWYC 1OFIA 4TSSA 2QCUA 3L27A 3HUIA 2V1CA 4B0EA 1KSFX 3IXSA 4LJ8A 4LGYA 3SFEB 1LO5D 3BIID 3U6PA 1TS5A 4KGTA 2Q5WD 2N0SB 1XC8A 4RGTA 3TE6A 1N32M 3ZC7B 2CE7A 3GLIB 4IIWA 3FKEA 3VLFB 5BMIA 5KO3A 1VR9A 1JWBD 4RF0A 3MK6A 3W0LB 4GDLB 1IY1A 4L8RC 1IN4A 1E0ZA 3GPXA 2D7HA 4IKGA 3GO8A 2AGAA 2QSDA 2ICIA 1OQRA 4D8BA 1TDZA 1YZBA 3FYCA 3T3NA 1JCKB 3U6OA 4WH4A 2UXDM 2LUMA 1CK1A 5LNK1 2DYOA 1IN5A 4LJ4A 4B3RM 3SAUA 4LGMA 4M0DA 1PVJA 2M19A 2EO2A 4AQ7A 3D8LA 4C80A 3AE3B 1FXIA 4ZTBA 2DHRA 3VR9B 1L4ZB 5EJCA 3SMSA 1SXTA 2N9LA 1RM6C 2KN4A 2PTLA 1YN5A 1TYGB 1PDXA 3CF6E 3HHYA 3TWLA 1HNWM 1XXGA 2XNAC 3U5ZB 2DWNA 1GVNA 3J7BA 1NVID 3TRKA 4HROA 2L1AA 5EP1A 3NWLA 3LVVA 3SFDB 3AE9B 1IXRC 3QWLA 3P42A 4PCZA 4GDKB 3U6CA 1J7KA 1JR3D 4C7YA 1G4AE 2Q2EB 5DNYA 4YSYB 5HI1A 1XLNA 4IBGA 4HLQA 2L32A 1GB4A 4LFBM 1PYWD 4MT5A 4WW0A 2F4VM 2R45A 1NHGC 3VKHA 2IGDA 2M0AA 2PVGC 1M4VA 2ON8A 2BW2A 4HEA1 2UUAM 2ACZB 3Q8FA 3U6DA 3JR5A 1Q3CA 4DV7M 3HRDD 1EWCA 3WHLA 1LV7A 5EXPA 1VDVA 4YTNB 1PJJA 4D82A 2UUBM 3HJ8A 4B7GA 1DGGA 4LFCM 1YN3A 1IBLM 3P63A 3AEAB 2RGOA 2ZW0A 2BBCA 4QNMA 1BMLC 2WLBA 3SBJA 3K8ZA 3NVZA 1FRRA 3MP2A 2Y5CA 3GLGA 2X49A 3W0FA 4KGSA 2BNKA 2CEAA 2V4IB 4CQNA 4KX6B 1JR3A 4RCOA 1C4PA 5BR8M 2Y5PA 4OZCA 2KMMA 4DR2M 2OPFA 3PNYA 3AE1B 2EUCA 1P7EA 3AL0C 3PO0A 1HR0M 2HKJA 2G1EA 2J42A 2V6ZM 5EZQA 4L1BA 2M60A 1FNVA 4RNAA 1UWMA 4MGKE 4FWDA 1NEKB 2JSVX 2WDQB 1DGHA 1PFDA 3A46A 1R7RA 3N9YC 3J7AS 2DXIA 1JWAD 2UZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KO3 A;  4OVZ B;  4RF1 A;  3E9S A;  4P16 A;  4OVZ A;  4PT5 A;  4RF0 A;  2FE8 A;  4R3D A;  3MJ5 A;  3MP2 A;  4RNA A;  4WUR A;  4M0W A;  4MM3 B;  4REZ A;  5E6J A;  4OW0 A; 
#chains in the Genus database with same CATH topology
 1ZE3 D;  1L2C A;  1TS4 A;  4DV5 M;  2K8C A;  2IGG A;  3EIE A;  3DVN U;  2WDV B;  2C5L C;  2JZZ A;  3PZ7 A;  1NV9 A;  2MH7 A;  2N9K A;  2JYE A;  2ZAM A;  3I04 M;  2BTW B;  2XEW A;  1GNU A;  1EM7 A;  1KFU L;  3DHG C;  1MPE A;  2YVC A;  3HVD A;  1VQ1 A;  1YD8 U;  1R4G A;  4W9H A;  2KAC A;  5C2T B;  1BGO A;  1TBE A;  1QOB A;  2YLM A;  2WSF F;  3BOS A;  1E8X A;  4NQL B;  3AEG B;  4XGI A;  5AZG A;  2KRU A;  4A9A A;  2W3R A;  2QJL A;  1XNR M;  3AU5 A;  4MGH A;  2LRU A;  4MJS B;  1XF5 L;  4TUU A;  1XB2 B;  3DOA A;  1VZ8 A;  4W5C A;  4LNI A;  4IJF A;  1G3I A;  2V3S A;  1ZP0 B;  2I1J A;  2O2V A;  2BWB A;  1DF0 A;  3KWB X;  2KN5 A;  1UUP A;  4GIV A;  2NVU I;  4AZF A;  2KJ6 A;  3DHI C;  1ZDX A;  4LCD E;  4M0W B;  1PPN A;  1ZV1 A;  1OQY A;  2IO2 B;  2VF8 A;  1OTR B;  3LB8 C;  4TQ0 A;  1E7V A;  1N61 A;  2JY8 A;  1Z5C A;  4JV5 M;  2ZEQ A;  5EE1 A;  3VUY A;  2ZPN A;  2VII A;  5IZ7 D;  1L2B A;  4I4L A;  4LRT A;  1FNW A;  1JRO A;  1V49 A;  2KTF A;  3PLV A;  2LHG A;  5PAD A;  3KW6 A;  3BWU D;  4CIS A;  3VTV A;  4ZHP A;  4FJY A;  4GDK A;  3FTE A;  1YQ3 B;  4AG5 A;  4F1S A;  4HCP B;  1ORY B;  1NSF A;  2IPK D;  3UF8 A;  2LVN C;  5IWA M;  3PLU A;  4LNK A;  1XCQ L;  4JI4 M;  3HHI A;  1MFW A;  3IVF A;  3PNV A;  3DVN V;  3P5U A;  1J7B A;  3HHX A;  4R7G A;  4ACF A;  3KYD D;  1D6E C;  3ZKJ C;  1EWM A;  3DCG A;  2KA6 B;  3I4V A;  4PS8 A;  3FUX A;  3TWM A;  4AXM A;  1DOI A;  1NI3 A;  1RFK A;  2G8E A;  4NZL B;  1E9M A;  1NV8 A;  2Y21 A;  4LK0 M;  4DR6 M;  2K5P A;  4HKQ A;  2BS4 B;  4BAX A;  4LCB A;  4YV8 A;  2MJ3 A;  2V0G A;  2KAJ A;  4ZRP A;  2PW9 A;  1K3W A;  2DZM A;  4GU2 A;  2FCS A;  5FK9 C;  3WA0 A;  1B1Z A;  1QVR A;  2YQZ A;  1I4H A;  1IBM M;  1GLN A;  1P7F A;  3KVF B;  4P7I A;  5L8R F;  2MWS B;  2WXN A;  5EXS A;  2GFO A;  3KW5 B;  1K3X A;  1WXA A;  2K9D A;  1NHW C;  1X9Y A;  2L6O A;  3N30 A;  1UKF A;  2VQF M;  3BPM A;  4IG7 B;  4G4N A;  2Y6E A;  1F52 A;  1R6B X;  1CJE A;  1K52 A;  3GLH A;  3IHP C;  2FS1 A;  4Q8H A;  2JA2 A;  3FTD A;  3HVZ A;  1S4V A;  2NQI A;  2L05 A;  2LGI A;  5AEK B;  1DYQ A;  2YEP B;  2N9E B;  3K8U A;  4LJA A;  3C3D A;  1Z59 A;  2NMQ A;  3PRZ A;  5G5H A;  3SYL A;  4YSX B;  2W82 A;  4WWP A;  2ZM6 M;  2CP8 A;  4RFB A;  4DK5 A;  1ZQ9 A;  1WXM A;  4JWU C;  3H7D A;  2OOB B;  2N35 A;  5AUI A;  1NPZ A;  2AIM A;  2G3Q B;  3RI7 C;  1AYU A;  4W9F A;  3U6E A;  3ZLZ A;  1EFU B;  1SXJ D;  1IN7 A;  2GI9 A;  3QWZ B;  3TIX A;  2CR5 A;  2IGH A;  5JI3 E;  4XDD A;  3KLS X;  4LRS A;  2KEB A;  2HCB A;  1I4X A;  3VAW A;  2AYO A;  2GBM A;  3L10 B;  1PUT A;  3WAN A;  3PFI A;  2DZZ A;  3J2P B;  2KO3 A;  2QMT A;  3D6S A;  2UU9 M;  2TSS A;  4QBB A;  1SXJ E;  3E1Z B;  5EQT A;  1HXY D;  3RVV A;  4WWN A;  1C7Y A;  1PPD A;  3SAS A;  2D3C A;  2L7I A;  4OVZ A;  1FXA A;  4IBE A;  1YN4 A;  4B9K A;  1J09 A;  4WUR A;  3ZUA A;  1HNZ M;  3JR4 A;  1KFX L;  2WXM A;  3H8B A;  2JUJ A;  3U61 A;  2L7H A;  1M94 A;  3UIP B;  2K0P A;  1FXT B;  2C98 A;  2DZI A;  1WWT A;  2MHJ A;  5LMU M;  2JUO A;  4I6L B;  1F4I A;  4CYE A;  4M01 A;  2HH5 A;  2LUE A;  2BQQ A;  4IJE A;  4HKZ E;  4WWM A;  1TKG A;  3PRE A;  3QAQ A;  2NPT B;  2JY6 B;  4B95 A;  4XBO A;  2WSC F;  2LWX A;  3KFQ A;  1C4C A;  1EWL A;  1AWD A;  1KFV A;  4IBC A;  5TR5 A;  1D5Z C;  4LY6 A;  2E00 A;  3U4E G;  2CHZ A;  1CTE A;  2W9N A;  1H8C A;  2AVW A;  3T8M A;  2W54 A;  1E90 A;  5AZH A;  2DAE A;  4C00 A;  1ZCM A;  1OJL A;  5F02 A;  3Q3M C;  3SHF A;  4B7H A;  2KHH A;  1AIP C;  2QP9 X;  2KDL A;  3AE8 B;  2Z84 A;  3C58 A;  5KPZ A;  4WQM A;  2MBE A;  3ZQJ A;  2FFJ A;  2YEP F;  3NS1 A;  4YYU A;  2JWS A;  5EP2 A;  4NAW B;  2RKO A;  1IBK M;  3BY4 A;  4BOZ A;  3RGS A;  1UF0 A;  2JX5 A;  2G8L A;  4PYU A;  3M0E A;  4EIW A;  4YY3 M;  5IRE B;  3Q3O C;  1NB5 A;  2RGH A;  3V62 A;  3ZH9 B;  3GZN B;  1KLG D;  4CJ6 A;  2KNB A;  1DO0 A;  3AJI B;  1IYF A;  4FCV A;  1BUI C;  3LXS A;  2KDI A;  5H37 D;  4EE2 A;  2KRK A;  4X65 M;  4JI2 M;  4YYV A;  1WJU A;  1NNJ A;  3IAM 1;  1AIM A;  4ANU A;  3OF9 A;  2I1K A;  2V3N A;  3KQ4 A;  2DCD A;  3GLF A;  5FPW A;  4IWO A;  4C56 C;  5A24 A;  3IEC A;  3P2B A;  5C23 A;  4CDC B;  3MHV C;  4KLN A;  1AU3 A;  2K6Q A;  3MC8 A;  3SAR A;  3U52 E;  3EA6 A;  2DC7 A;  1KOT A;  2H88 B;  1LQB A;  2IND C;  4US9 A;  4ZDV A;  2RDH A;  2UU7 A;  5ITY A;  3CF2 A;  3KP1 E;  2K39 A;  1WGH A;  4LJ7 A;  2BTW A;  2KJH B;  1L6V A;  1STE A;  5FTK A;  5DPW A;  4EEW A;  1VJK A;  1YJJ A;  5ITT A;  3W68 A;  3I9V 1;  4IUM A;  2OQ4 A;  2DAG A;  2BWE S;  1JWM D;  5K16 A;  2JTC A;  4QNR A;  1YSY A;  4YT0 B;  3QYB A;  2W3S A;  2KK8 A;  4N79 A;  1HZ5 A;  3W67 A;  4BOU A;  3X23 A;  3ZNH B;  3ZTD A;  5IT9 S;  3M95 A;  4II2 B;  4DV0 M;  4II3 B;  2CHG A;  4WAA A;  1QT9 A;  3GLI A;  2AX5 A;  2B3A A;  4RGN A;  1C4A A;  2R6F A;  2J0J A;  2JF5 A;  5IN7 A;  2AUZ A;  1JWS D;  2JZ3 B;  4IM3 A;  2KXJ A;  2J52 A;  2DOS A;  1VDL A;  3A9J A;  4ZYN A;  1AAR A;  4AQY M;  2GBK A;  2KD0 A;  2NS5 A;  3N20 C;  4LDT D;  5BYR A;  2LVO C;  2H89 B;  4FHJ A;  2CUZ A;  3DPD A;  3GQ5 A;  2J53 A;  1TH4 A;  1A6R A;  4G11 A;  5BYQ A;  4PK1 A;  2B76 B;  1YAL A;  2IBI B;  1E8Z A;  2WXL A;  2MA9 B;  5J18 A;  4JI0 M;  5DPT A;  4BOZ B;  1E10 A;  3TMP A;  1FFV A;  2DHY A;  5E26 A;  4OZA A;  4BS5 A;  2WX1 A;  4CDD B;  5IOI A;  2HTM E;  4YTM B;  1MIR A;  3KUD B;  1NVM A;  3KFU G;  2XK5 A;  1GL6 A;  3AH7 A;  2LD9 A;  1ZDV A;  4NJ7 A;  4ZPX A;  2D2Q A;  1U9W A;  2Y0Q A;  3U6M A;  2WXO A;  3V6C A;  4HVB A;  2X8A A;  1MHX A;  1QIL A;  3IG5 A;  3H6S A;  4Z8X A;  4QH6 A;  1WZ3 A;  3ZUN A;  1WRD B;  4URK A;  1DOX A;  5EGW A;  1SF0 A;  4FUL A;  2HHH M;  2WXG A;  1SEB D;  3LJ3 A;  4P1C C;  1W5T A;  3K24 A;  1IGD A;  3RUI B;  3C0R A;  1J7C A;  1XXH E;  1WFY A;  3P4Q B;  4AS1 A;  1TLO A;  4IC7 B;  4KHP M;  3R8B A;  5EF4 A;  2IPP B;  2C5R A;  3FUW A;  3O1G A;  1F77 A;  4HEO A;  3HHZ A;  2BKF A;  2AS8 A;  3GLG E;  3LMM A;  3M63 B;  4NXM M;  1S1Q B;  2OUL A;  3Q8G A;  2KX0 A;  4G4Q A;  2HDE A;  3BVM A;  4F2L A;  4FJV B;  1IY0 A;  3I06 A;  3DWM A;  4J3O D;  4K3C A;  2GLS A;  2BKR B;  4TQ1 A;  2ZAO A;  4RGO S;  2CU1 A;  3DBH B;  4TMA B;  3FRH A;  1WXV A;  2XN9 C;  4I07 A;  2CFO A;  1ZUD 2;  3CIR B;  1ATK A;  4X64 M;  3SAT A;  4L23 A;  1TGZ B;  4RGM A;  4W5B A;  1HT2 E;  3T6P A;  1L4D B;  1WR1 B;  3A98 B;  3VUW A;  2JVC A;  3W1S A;  1ZAE A;  3PS6 A;  2DAK A;  2DAM A;  2K8B A;  4W5W A;  3OG5 A;  3VRB B;  2KAN A;  1FCL A;  1UEL A;  4OVV A;  1X1M A;  2DNA A;  1OAO C;  1QDQ A;  3GOE A;  1FRD A;  1VJV A;  4IOI E;  3SAV A;  2N7D A;  3PDF A;  5AUK A;  1BY8 A;  3W9C B;  4BLC A;  1Q02 A;  2FUH B;  2IJ0 A;  4K3B A;  3TSS A;  1NB3 A;  2XBB C;  3FUT A;  4FD2 A;  1WR1 A;  2BJV A;  3RNF C;  1YUB A;  2NTS A;  2JZ0 A;  1QKZ A;  4AJW A;  2V1Y A;  5JH5 C;  2EKE C;  3WAP A;  2EA0 A;  4FJC A;  3BWK A;  3H4M A;  2DCA A;  4IBK A;  2N9P C;  1QAM A;  2R62 A;  4B0M A;  5HFY A;  2BYT A;  4X6I A;  2O5R A;  3K9M A;  4N59 A;  1DV0 A;  4PP1 A;  4DV4 M;  1F0Z A;  1IQP A;  4YYW A;  2DZY A;  4Q7J A;  3U60 A;  3A9K A;  4DBG A;  3SYK A;  3AUL A;  1FM0 D;  1GG3 A;  4N9F 4;  2D3B A;  2EKI A;  3VTU A;  3L26 A;  3P5V A;  2LWP A;  1TU6 A;  2INN E;  4PI3 A;  1QZE A;  1JR3 E;  2LGX A;  1LTM A;  1GC7 A;  3N1Z C;  4BBN C;  2WXR A;  3ERV A;  3TWK A;  3VR8 B;  1RRB A;  2LVP C;  3IBE A;  3S3Q A;  4FWH A;  3C9P A;  1P1A A;  3VRA B;  3U6S A;  2ONQ A;  4HDQ A;  3DWG C;  5CX3 A;  3ZW3 A;  1WGR A;  1TZ1 A;  3U5Z A;  2VF7 A;  2NCN A;  2VZK B;  5JZE B;  2KDB A;  4X57 B;  2WXH A;  1QAN A;  3Q8C A;  1XWI A;  2HWJ A;  3K92 A;  1MJD A;  3RE8 A;  2PIA A;  4LF5 M;  4A3V B;  3U61 B;  4WIP A;  4LF9 M;  3PXG A;  3V61 A;  1KRH A;  4MEM A;  4NSR A;  4LJ5 A;  3I4Y A;  4IBI A;  2JQG R;  3HM6 X;  1SB3 C;  4I81 A;  5C1B A;  5IP4 D;  3J81 S;  2XZF A;  1R4M B;  1ZW7 A;  3UQA A;  2DZO B;  1LM8 B;  4QOS A;  2KNV A;  3FTC A;  3AOG A;  3NVV A;  4JWS C;  2LGD A;  2G5G X;  4K7C A;  1K51 A;  4GRI A;  2YJ9 A;  3B7Z A;  3B2G A;  3IT6 B;  4K7U A;  1R4N I;  5T8I A;  4K81 A;  5H92 C;  2FIF A;  3ZNI D;  1ZMV A;  3PRP A;  3HWN A;  2NQA A;  3TEW A;  4ANX A;  4ICU A;  3WHK A;  4TKN A;  1S3S A;  3QAU A;  3PRM B;  2K3U A;  2KJR A;  4N6E B;  1ZXH A;  3VKG A;  3ZQ4 A;  1Y4H A;  1NO1 A;  3TPZ A;  4BSQ A;  1N36 M;  3PV1 A;  1PGX A;  2HXZ A;  3U2S C;  3AN1 A;  2JRI A;  2CB5 A;  5DYI A;  5FSW A;  3QA8 A;  4FIP A;  5CHT A;  1MS6 A;  2LGY A;  1TZO A;  4S0R A;  1YLA A;  1WM3 A;  1WJ7 A;  3KWL A;  3B2F A;  3BYY B;  5D3D A;  1EE8 A;  2ZTD A;  4NJC A;  1JQ4 A;  3KSX A;  1XKG A;  4BFR A;  2WXP A;  4IBF A;  4PDG A;  1L1T A;  3VDU A;  1RYJ A;  3L16 A;  5CVO B;  4JN6 A;  2K6D B;  1C1K A;  3DBS A;  3L25 A;  3GQ3 A;  1AYF A;  4LF4 M;  3P1M A;  3OAW A;  3VVW B;  1IWD A;  1Q6K A;  3MHH A;  2PAD A;  4GDL A;  4HK2 A;  3T1H M;  3AE2 B;  1WYG A;  3N4C A;  4GC9 A;  4QHT A;  2LBC A;  1V1P A;  5JH3 A;  3I01 M;  1FCC C;  3TNX A;  1G8P A;  1UBI A;  1D4B A;  2WU2 B;  3UZU A;  2DEN A;  1J0G A;  4WJO A;  3MJW A;  4FBJ B;  1NY6 A;  1VSN A;  3AKZ A;  4GMV A;  4AKH A;  1YIW A;  3U7D A;  3W1Y A;  2DWZ B;  2L00 B;  5E6J A;  3QT4 A;  1GAQ B;  2BWE A;  2I7N A;  3UGB B;  2F1G A;  3KP0 E;  4BZA A;  1JRU A;  2M1M A;  3QK0 A;  1XLP A;  2O6V B;  1PQS A;  2LVQ A;  3WIM A;  4KT0 F;  3AU4 A;  2KYW A;  1IY2 A;  2Z8Y M;  4GC5 A;  2DWM A;  1WMH B;  2LHE A;  2XGN A;  2XFS A;  4X66 M;  1IXS B;  1V6E A;  5IKC M;  4B3S M;  3NZU A;  3PRP B;  1WRI A;  2KWD A;  3I57 A;  2QNJ A;  4IBJ A;  1WIA A;  4I6P A;  4YYQ A;  3F75 A;  3SHQ A;  2GBR A;  2EJS A;  1GLO A;  5GXG B;  1BT0 A;  1TKY A;  2RR9 A;  1MJG M;  3E4R A;  3GP7 A;  1XLO A;  1EU4 A;  5D2M B;  3TL4 X;  2K22 A;  2MJE A;  2VQE M;  2XK5 B;  1HNX M;  5LXH A;  4G4O A;  1C77 A;  2XEP A;  3GLH B;  3JSV B;  2N7J A;  1V5O A;  2K8H A;  3TMP B;  1D5M C;  4ZRI A;  2R44 A;  2C96 A;  3GP1 A;  4LF6 M;  4DHZ B;  1V2Y A;  3D8B A;  1OTR A;  4NAW A;  4DXA B;  3UJN A;  1GO5 A;  3U8E A;  2LTU A;  2FCN A;  3A1Q A;  2R4J A;  3FAH A;  4L4U A;  2UUC M;  4KVG B;  1QOG A;  3WAM A;  4XGA B;  3NHE A;  3GRV A;  2K6B A;  4NRW A;  2CJO A;  3TUO A;  4DXF A;  4BS6 A;  4LLG M;  1N34 M;  3JYU A;  3L13 A;  3R9X B;  4PDI A;  4A3P A;  3KDS E;  2HD5 B;  1E9R A;  4NSO B;  2EEL A;  2RPQ A;  1NYQ A;  4KIK A;  2P5T A;  3EGR A;  2NQ8 C;  5LLI A;  1L0Y B;  1HA5 A;  2MP2 A;  1QXP A;  2LVA A;  4M9X A;  4DV3 M;  2AUX A;  2BB6 A;  2CIO A;  2GMI C;  1V97 A;  3KX1 A;  5ITX E;  1FFU A;  1OEY J;  1GMY A;  4P6G A;  3MHZ A;  2MX2 A;  1EIJ A;  2KWV B;  4DMX A;  3LFY A;  1SSN A;  2WXK A;  3K2L A;  3ABV B;  1EWO A;  2ZAN A;  4IBD A;  1DGF A;  2XH9 A;  1WGN A;  1LXD A;  2VH2 A;  1C76 A;  4L78 A;  2M8S A;  1ME3 A;  2L09 A;  4BVU C;  1JWU D;  2JT4 B;  3L0W B;  4MGZ E;  3H89 A;  3I3T A;  2INP E;  3KOZ E;  1XCT L;  4MH0 E;  5KQ8 A;  3DBR B;  3OJ4 B;  3C3E A;  3T3O A;  2J7Q C;  2LXE A;  1HTO A;  4BOP A;  5EE9 A;  3EC8 A;  3CF0 A;  1N62 A;  2WNM A;  3K9P B;  3P4P B;  2QBY A;  1MVK A;  1R4N B;  3ZNH A;  1KLU D;  1TS3 A;  3OIS A;  3QC8 B;  2Y20 A;  2KDM A;  5DFL A;  1XXH A;  4XWW A;  2KMC A;  1NQC A;  3SEB A;  3HJS A;  3A9J B;  2Y5B A;  4IP3 A;  4D2K A;  3V3X A;  1QAO A;  2AHM A;  5HG2 A;  2ZVN A;  1L7Y A;  4XX5 A;  3V60 A;  4D81 A;  4BB9 A;  1SJH D;  1Y8R C;  4WQO B;  1C1Y B;  4FN2 A;  1ROE A;  4LNO A;  2BU3 A;  3QQ8 B;  3EIH A;  2QSF X;  2MJD A;  2J7O A;  2DZN B;  2G3Q A;  2YFQ A;  1SXJ C;  1Q0W B;  1QYR A;  4I8O A;  4P17 A;  3J80 S;  4ZUX U;  3VDZ A;  1DEU A;  4L6V 6;  4WJQ A;  4FK5 A;  1SIJ A;  2WYQ A;  5EXT A;  4K7S A;  4QRG A;  2XU4 A;  1JW9 D;  3GPY A;  2CHQ A;  1E7P B;  2BS3 B;  1WHC A;  3O0U A;  4NQK E;  4A6Q A;  4CIZ A;  1TTE A;  2B1N A;  3FE3 A;  1GJS A;  4MZO A;  2F5S A;  1BXT A;  1K3B B;  2QC8 A;  3CST A;  5LXI B;  1PRB A;  1X37 A;  3WXE A;  2KTR B;  3DBR I;  2FNA A;  2MBH A;  2LVP A;  3GLI E;  3Q14 C;  2PJH A;  3URY A;  3SU8 X;  3PSE A;  4HL4 A;  4CHK A;  2HJ8 A;  1N78 A;  2GBJ A;  3IFU A;  1WYW B;  3DVG X;  1RU3 A;  2FH0 A;  1QDR A;  4YYS A;  3ZIM A;  4DQO C;  2ARY A;  3K9O A;  4GEW A;  2UYZ B;  3W31 A;  3KOX E;  3RVW A;  3X0W A;  5CVM A;  1FIQ A;  1FO4 A;  1CJL A;  4GB9 A;  3FRI A;  3R66 C;  3SAW A;  2KTR A;  2JY7 A;  4JI7 M;  3D32 A;  2LVQ D;  2WWZ A;  3BK2 A;  3QYE A;  2LJ5 A;  4DWF A;  3GB1 A;  4ANV A;  4EZJ A;  4NY0 A;  3L2A A;  3OTO M;  3KUZ A;  4ZRJ A;  1YVB A;  1QLB B;  3EHV A;  4M9Z A;  4AG6 A;  2KQS A;  4PT5 A;  1AU0 A;  1BP4 A;  5FTL A;  2JRI B;  2EMT A;  3VFD A;  1GCB A;  4GHA A;  4H2A A;  2PLP A;  2YR0 A;  1PGA A;  1JQJ C;  3H7P A;  3MC0 B;  2LEK A;  4I04 A;  2P86 A;  2LVO A;  3LYY A;  4JX1 C;  1RLF A;  4GHL A;  1I4Q A;  2UXC M;  1T0Q C;  2L83 A;  1HE8 A;  4JLC A;  2D3A A;  2GOW A;  2JWU A;  3KYC D;  2C99 A;  3B9P A;  2D3G A;  1W5S A;  1C79 A;  1XHB A;  1Z5A A;  3TEZ A;  2MEK A;  4HWY A;  2DWL A;  3H9D A;  3S3R A;  4L15 A;  3UIO B;  1F2R C;  5I4D A;  3T9L A;  4BBN F;  3QAR A;  3B0A A;  4L2Y A;  2FID A;  1WXQ A;  1NDD A;  4Q2J A;  1MI0 A;  1AN8 A;  2FOI C;  5ITX A;  4N8W A;  3PT2 B;  3H7P B;  4OU7 A;  3PHX B;  4XYC A;  3I63 C;  2DEN B;  4ZRK A;  3LCV B;  4YTP B;  3RNA C;  4MDK E;  1FD6 A;  1HQY E;  3L29 A;  3B79 A;  3IG3 A;  3HWS A;  2AWT A;  2BYE A;  1ME4 A;  4EZL A;  1UGM A;  3RNV A;  4KDL B;  3BYT B;  1WY8 A;  3JAM S;  1N77 A;  3RT3 B;  4K1R B;  2RRU A;  2MJ5 B;  2UWQ A;  3LXF A;  3W5V B;  3FYD A;  2PKO A;  3FIL A;  2KXE A;  3NUH B;  4OX9 M;  2X4A A;  1XNQ M;  4XE0 A;  2NQG A;  4A90 A;  1D3Z A;  2PEA A;  2DCC A;  3O65 B;  4PS7 A;  4HLE A;  4RY2 A;  2I7P A;  2M5Z A;  3B89 A;  3J9C A;  1POP A;  4JI1 M;  1T3Q A;  1E94 E;  3W2D A;  1NJF A;  3FUV A;  4GIT A;  5D94 A;  3F5V A;  2XSZ D;  1P3Q U;  2L3Z A;  2NTT A;  1DO2 A;  2Z3X A;  2BYF A;  4REZ A;  1GAB A;  5CVN B;  3MP9 A;  2LZ6 A;  1TGU A;  2LH0 A;  1XEE A;  1DKI A;  1WIV A;  2JNH A;  2DX5 B;  5EE0 A;  5ITR A;  2CHW A;  1E9S A;  3B74 A;  1CQV A;  1J5E M;  4JIO U;  1HEZ E;  2MRP A;  4YXD B;  1IFY A;  3U8Z A;  2LXC A;  3MTN A;  3GLH E;  2KFK A;  1Q1O A;  4TUW A;  3A1Q B;  1I4G A;  4ASW C;  4DR7 M;  4DMY A;  1IGC A;  1EF5 A;  2G4D B;  1WJN A;  3KH0 A;  3DBL I;  1KHP A;  2WZJ A;  3PVS A;  3LVW A;  2C9W B;  2OHF A;  1JRP A;  1DGH B;  2AU1 A;  2C60 A;  4CHT B;  1QZM A;  3B7Q A;  2KC1 A;  5BMH A;  1GEC E;  3FUU A;  4QAY A;  5L95 C;  4DR5 M;  2GQF A;  1SBB B;  4ZRQ A;  1MG8 A;  3UGJ A;  3S2A A;  4DHJ D;  1C9F A;  4PP2 E;  5C1Z A;  2KNA A;  2BT6 A;  3W30 A;  3HKP A;  4FLH A;  2DI0 A;  3NOB A;  3CMM B;  4LF8 M;  3FD9 A;  4WWO A;  4KO8 A;  4JI8 M;  4E3C A;  3KS8 A;  2DAJ A;  4DV6 M;  2M17 A;  3HIZ A;  5IO9 A;  1QF6 A;  1DGJ A;  1YX6 B;  3ETR A;  2Z59 B;  4N4Z A;  3B08 A;  1SJE D;  3GE3 C;  3OF8 A;  4BKS A;  1TJE A;  4A3O A;  3H8C A;  2MP2 B;  1V1P B;  5C3J B;  2G9H D;  1D0K A;  4MEL A;  1NYR A;  2DC8 A;  2L8J A;  2E03 A;  4MAC A;  5G2N A;  2ZCC A;  4YWG G;  3TQS A;  3R2T A;  3B9J A;  3IOQ A;  2B3T A;  1V9J A;  2QPA A;  2CV1 A;  1FEH A;  4QOZ C;  4B7F A;  1NEN B;  3C8Y A;  1A70 A;  1QOA A;  4GLS C;  3QJ3 A;  4X6H A;  3PHW B;  2E5L M;  2WU5 B;  1PIP A;  1TDH A;  5EXX A;  5FTN A;  1MEM A;  1I35 A;  2R61 A;  4DR3 M;  3FTF A;  2OOB A;  2I38 A;  3IT4 B;  3CH3 X;  4FW9 A;  2ZW1 A;  4NL4 H;  3DA1 A;  3C0R B;  2FCQ A;  3AB5 A;  4BOS A;  1Q39 A;  1L5P A;  3GRY A;  1P0R A;  1HT1 E;  1ICF A;  2ZPY A;  3JVZ X;  3RPF C;  3TEY A;  4A20 A;  2KW0 A;  4OVZ B;  3GQ4 A;  1D5X C;  4E74 A;  1SXJ A;  1NBF C;  2P0R A;  3H4J A;  4DR1 M;  1CQD A;  4FCW A;  1MN3 A;  1NLJ A;  3MHS A;  2D5G A;  2FAZ A;  1WF9 A;  3OWE B;  1GJT A;  4D8I A;  2IZV B;  3UI3 A;  1MHH E;  1YJI A;  2QDF A;  1NL6 A;  3ZVV A;  3ZCB B;  3AFH A;  5FKA C;  2LFI A;  3UQB A;  2LHC A;  3JW0 X;  2GHU A;  4LTU A;  1U4A A;  2A4Z A;  3KSE A;  2KQ7 A;  4LJ6 A;  2KZS A;  2XU3 A;  2ZNV B;  2QCZ A;  1OQQ A;  4R71 A;  3R7Q A;  1U9V A;  2BF8 B;  2MCN B;  3DVG Y;  4NC6 A;  1IBX B;  2F5Q A;  1YQ4 B;  2H1R A;  3M99 A;  1OEY A;  1UH6 A;  1QOF A;  4D80 A;  3W5U B;  4JXJ A;  2JXT A;  5JI2 E;  5D3I B;  3AEE B;  2DAI A;  3GRU A;  3A45 A;  3HHA A;  3AV8 A;  1WGD A;  5DYG A;  3PT2 A;  1YNT E;  2CHV A;  2JQR B;  4KIK B;  3AXC A;  4MM3 A;  2IYD B;  1PCI A;  2HD5 A;  4NJ6 A;  4F7Z A;  1OKS A;  6PAD A;  3RFZ B;  1UGJ A;  1CZP A;  2L0F A;  2KDF B;  1IM2 A;  1CPJ A;  3OVZ A;  1ZPS A;  2W55 A;  3HU1 A;  4BKS D;  3ZJT A;  1WGY A;  2J7N A;  2R65 A;  1UWX A;  1JAL A;  3NVW A;  1V81 A;  3FKY A;  2DC6 A;  2FQ9 A;  3NVY A;  2JWZ A;  4CDE B;  1MHW A;  4Z6Y A;  3FIL B;  1KLV A;  3MOR A;  2IY0 B;  3GRR A;  2L0T A;  3BVG A;  4CZW A;  2CU3 A;  3PW3 A;  4CDF B;  2JXN A;  2BDZ A;  4ARC A;  1ISN A;  3BK1 A;  2MBQ A;  1QQW A;  3U6Q A;  1TY0 A;  3OVX A;  3P5X A;  4UDU C;  4A55 A;  3K1J A;  2R2Q A;  1F2C A;  2CS4 A;  2OP3 A;  1OAI A;  3L28 A;  2WXQ A;  3TEX A;  4KGR A;  3MJ5 A;  3GLF E;  1WE7 A;  1ZOY B;  3APF A;  3N3K A;  4DHZ E;  3HJQ A;  2G45 B;  1GPX A;  2KNZ A;  1MU5 A;  4PS3 A;  4KZC A;  2D7G A;  3GLG B;  4DUY M;  2APL A;  1L6U A;  3H8H A;  3ZDM C;  3KXE C;  4WJN A;  1MG4 A;  4UN2 B;  4FVM A;  1E7U A;  5J94 A;  3OLM D;  3SHG B;  2CRU A;  4BBA A;  4GN1 A;  3WAO A;  1SGH A;  1TR8 A;  4FXC A;  1ZMU A;  3NZ3 A;  1ET9 A;  4GKK M;  4JGH B;  3VXW A;  2JP7 A;  1WX9 A;  1XQQ A;  2KVZ A;  3VQI A;  3GPP A;  3DZD A;  4AOF A;  4BPV A;  2BGF A;  1OFH A;  2L52 A;  2RMM A;  1QMY A;  4QRX A;  1D0L A;  3V6E B;  2NBW B;  5BO4 B;  4JI6 M;  2RD0 A;  4AWJ A;  2MW5 A;  1PE6 A;  4M00 A;  4A5U A;  3CTW B;  1U9X A;  3LQR A;  2Z0E B;  3VHT C;  3LQQ A;  4YHH M;  2LNH C;  4HXD A;  4MGY E;  4BOS C;  4GOC A;  3MTV A;  3QJZ A;  1V34 A;  3EUB 2;  3U6L A;  2Y0T A;  3HU2 A;  3Q3J A;  2NQD B;  1NY5 A;  2D07 B;  4AP4 C;  1V1O A;  1SNK A;  2ZCB A;  2J5Y A;  2BVC A;  1SIF A;  5E6N A;  2WQY B;  1SE9 A;  3HZJ A;  2AYO B;  5G5G A;  5D6J B;  4B6W A;  3AE5 B;  2RGF A;  4LG2 A;  1YQB A;  4RM8 A;  2BJW A;  3L17 A;  1KXR A;  3ZRF A;  2XF3 A;  1WE6 A;  2ERC A;  4GMQ A;  2OJR A;  2Z8L A;  1A5T A;  3DFZ A;  1OFF A;  2K9X A;  1L0V B;  1U5I A;  3ALB A;  3R2I A;  5EDS A;  2IDY A;  5GKN A;  2VHF A;  1L1Z A;  2FYE A;  4B08 A;  5KHQ A;  4W9E A;  1E8W A;  3N1Y C;  9PAP A;  5C18 A;  1XO3 A;  3E21 A;  3LW5 F;  1WSP A;  2JRH A;  1G59 A;  2L7R A;  3WXF A;  4GIP A;  4O1N A;  4XZ4 A;  3KW9 A;  4R3D A;  2QHO A;  2M4N A;  2ZZP B;  3QHT A;  1GUA B;  3VDP A;  4ITQ A;  1FMA D;  1L2N A;  2FRQ A;  4HRS A;  1RAX A;  3MHS D;  1PJI A;  3VFK A;  4JPS A;  4KZ0 A;  2JXX A;  1NNU C;  1GKI A;  5EP4 A;  3ZJV A;  3B1L X;  4RKU F;  3U7Z A;  2CHX A;  2KKC A;  5CTR C;  1ZIV A;  3L54 A;  1WJ6 A;  3NHE B;  2NBU A;  4Y28 F;  1VDD A;  1XLQ A;  2FNJ B;  2KX3 A;  3ONS A;  4US8 A;  5KPR A;  4AKG A;  4GXB A;  3E56 A;  2FUG 1;  4W9L A;  3ILK A;  1T6O A;  1K50 A;  2WS3 B;  4LDT B;  1SG9 A;  4DR4 M;  1Q5W B;  4XDC A;  2V1U A;  4HXD B;  1VZ7 A;  4KDI C;  4N58 A;  5BMG A;  4AI6 A;  1VEJ A;  4NAM A;  4LZZ A;  1TKE A;  5CHV C;  3HGI A;  1TH2 A;  3KKU A;  2BB5 A;  2N4F A;  4IM2 A;  2J0K A;  2QIL A;  3N1X C;  2N7E A;  4HPL B;  4MGI E;  3KOW E;  2K25 A;  2PBH A;  3NBI A;  2X38 A;  1HJP A;  2WXF A;  1CVZ A;  1HQR D;  2C7H A;  3BZD B;  3M6A A;  4OEM A;  4NNJ B;  1WJ4 A;  2J0M A;  3RGP A;  1DGB A;  4IUM B;  4J6I A;  1KF6 B;  2ACT A;  1E6E B;  2MSE D;  3USV A;  4XR7 A;  3UMM A;  3BXW A;  1IN8 A;  4WAF A;  1TF0 B;  2BYV E;  1IUE A;  3ZNZ B;  3BB7 A;  4GH9 A;  2LAS A;  1UNS A;  1E32 A;  2LHD A;  3MC9 A;  2L76 A;  3PHW A;  3IEJ A;  3SMP A;  4FJZ A;  2QEN A;  1N63 A;  3WCQ A;  1P3Q Q;  3GE8 C;  5A2Q S;  4OZB A;  3BC3 A;  4I5S A;  4ZHO A;  2KFJ A;  3UK6 A;  3HHW A;  1YMH E;  3E9S A;  1F9J A;  2PMV A;  3DF0 A;  4DUZ M;  1KYI A;  1K82 A;  2KT7 A;  2ZVO A;  1ESF A;  1Z5B A;  1XD3 B;  1PXV A;  3VH3 B;  1HQC A;  2MH8 A;  2FCM A;  1I42 A;  2QBY B;  1J8C A;  4P16 A;  4W4U A;  2Z4S A;  1TS2 A;  3BVZ A;  2V9H A;  4M0W A;  2QHO B;  4NXN M;  1WXS A;  3AOE C;  4XC2 A;  4M9S A;  2F5O A;  5DPR A;  2JY5 A;  1GL7 A;  2CJN A;  1UD7 A;  4C4V A;  4G4R A;  2HAK A;  3AEB B;  1EU3 A;  2R9F A;  1FNN A;  4EKU A;  4RH6 A;  2PNS A;  4IDI A;  4K7W A;  3AEC B;  4W9D A;  5ITU A;  2RDG A;  3IV2 A;  4LZJ A;  4W9I A;  1V8C A;  1EWP A;  3J27 B;  5D7G A;  2KC2 A;  4RKX A;  2NBV B;  4JYA M;  4JI5 M;  4G6Z A;  3CWI A;  4MSM B;  1MX0 A;  1AU4 A;  1VEK A;  3ECI A;  3N3G A;  4RF1 A;  1WGK A;  2DVW B;  2G7Y A;  1ENF A;  2FE8 A;  1RFA A;  5JXV A;  2SAK A;  1ZGU B;  1PM5 A;  4G0N B;  2A5Y B;  1R7S A;  2MLB A;  1HZ6 A;  1H6U A;  2JQF R;  2KQ4 X;  4MZS A;  1XMO M;  3LCU A;  1XMQ M;  1G41 A;  4LJ9 A;  2G4S A;  1PGB A;  3C9E A;  3SDL C;  2N1V A;  3PVL A;  3AE7 B;  1VZ6 A;  2YNM D;  2F5N A;  2PPH A;  5G55 A;  2R18 A;  2O6X A;  2KWU B;  3V6E A;  2JZ1 A;  1LGR A;  2XLJ A;  3B7N A;  2MQJ A;  2WDR B;  1Z5S B;  4WJP A;  1K53 A;  1C78 A;  1T43 A;  4L16 A;  1U9Q X;  3B21 A;  3F92 A;  1UZX B;  3EFU A;  4MH8 A;  5J2R A;  1PPO A;  3Q8A A;  4ZOH C;  4BQV A;  3ML8 A;  2XZU A;  1IXS A;  1F2R I;  3KS4 A;  3BBA A;  1NJG A;  1IBX A;  4AJY B;  5LMN M;  1D2N A;  4ZYS A;  1UFZ A;  3T15 A;  2J7Q A;  1L0X B;  2AL6 A;  4IW0 A;  2DLB A;  4USA A;  8CAT A;  2WXJ A;  1EF1 A;  3VTW A;  1SP4 B;  2KZU A;  4YL8 A;  3GLF B;  3L08 A;  5CHF A;  1QQR A;  3SFZ A;  1GJZ A;  2PVO D;  4K0K M;  4ANW A;  2ZTC A;  2MR9 A;  2SEB D;  3KOY E;  1J7A A;  1LFD A;  2KLC A;  2REX A;  3IAS 1;  4CO7 A;  1Z6T A;  3NRZ A;  4AUQ C;  1B9R A;  1N5W A;  2O2V B;  3P4R B;  7CAT A;  1L2D A;  3RN9 C;  1MDW A;  3CBJ A;  5BPV A;  5BYS A;  2FTD A;  2L4E A;  3APC A;  1SXJ B;  3THG A;  2CWB A;  2O25 A;  3HU3 A;  4FWG A;  4MJS A;  1F2A A;  2V4L A;  3K9P A;  2P7U A;  4BOQ A;  2A5U A;  4IWQ A;  2IBI A;  4XWT A;  3SC3 A;  3RVX A;  2QIE B;  4XUI A;  2KLG A;  4D8E A;  2XFT A;  2Z4R A;  4LFA M;  3PHX A;  3NG0 A;  2YJ2 A;  5J17 A;  5E6O A;  1VG5 A;  4W9J A;  2YJC A;  4ARI A;  2HJ1 A;  5FLX S;  2DBY A;  3AM9 A;  3R8F A;  2LJI A;  1PJQ A;  1GOZ A;  4KKJ A;  3IG8 A;  4G54 A;  3NZS A;  2RPV A;  1KH0 A;  2LRW A;  3MTN B;  4S12 A;  2F7D A;  4WA6 A;  1QAQ A;  4X62 M;  3AE6 B;  5EZS A;  3DBL B;  1JB0 F;  2K0B X;  2QZ4 A;  5FTJ A;  3RZW C;  4YSZ B;  3HM3 A;  5IAA C;  1CSB B;  1I4W A;  2AQ1 B;  4DV2 M;  2XU5 A;  2C9O A;  4FCT A;  3DQV A;  2JZP A;  4JE3 B;  2WGS A;  1TY2 A;  1H4R A;  3RD2 A;  3OQC A;  5FR3 A;  2CV0 A;  2D10 A;  2R9C A;  5FTM A;  2AQ2 B;  1GB1 A;  2AYN A;  4DBG B;  3U60 B;  1I4R A;  3A9K B;  2R6N A;  2MBO A;  2UXB M;  5IA7 A;  1Y08 A;  5F3W A;  3H1U A;  1HUC B;  1CUK A;  2C0Y A;  3IUT A;  2R9M A;  4MI7 A;  1QOL A;  3Q69 A;  5KPT A;  1V5T A;  1ET6 A;  2LMC A;  3P4S B;  4EFO A;  1HTQ A;  1SE2 A;  4G3X B;  3RFW A;  1FH0 A;  1T0Y A;  1NI2 A;  4I6N B;  2XSZ A;  1RWS A;  4JQW C;  3BCN A;  2DZL A;  4OVU A;  4W9K A;  3BOW A;  3T1Y M;  4PAD A;  2OOA A;  4DXG A;  3HY5 A;  2GB1 A;  3ZRC A;  2WXI A;  3MMP A;  2ATO A;  1IN6 A;  4NOO B;  2Z0D B;  4M8M A;  1S3S G;  3I51 A;  3SR6 A;  2HL7 A;  1N5X A;  2CKH B;  2ZJD A;  4GGQ A;  4HPM B;  3TCA A;  2HWK A;  3PRM A;  1PJS A;  2J4X A;  3AMZ A;  1N75 A;  2LGS A;  2M56 B;  4KKI A;  3KWV A;  2VZK D;  2PRE A;  2XU1 A;  4WP2 A;  2FBW B;  5TSS A;  5HHD G;  4KSL C;  5HKH A;  2H5X A;  1Q10 A;  5EP3 A;  4XZX A;  4W9G A;  2ZNV C;  3V6C B;  1YE9 A;  4NRV A;  3Q6B A;  3GS2 A;  3PPA A;  2CV2 A;  4ITK A;  5MPO A;  8PCH A;  4DV1 M;  3KVW A;  3AE4 B;  4E71 A;  3A42 A;  1JML A;  2DCB A;  4OHJ A;  4EUT A;  1ZKH A;  4PD2 A;  3AV0 A;  2GRI A;  2E6X A;  1V33 A;  2DYM A;  3QSD A;  3T38 A;  5H8Y E;  2G8J A;  1YK7 A;  1N33 M;  3GZN I;  4II7 A;  1ZXI A;  3V05 A;  1Y56 A;  4RMA A;  2DAF A;  3Q8E A;  1E8Y A;  5FR6 A;  2ZBK B;  1KM7 A;  2E3T A;  2DWQ A;  4ICV A;  4GSW A;  3SD5 A;  1Q3B A;  2ASQ A;  3O65 A;  2F5P A;  3RNC C;  3HHM A;  3APD A;  1UBQ A;  1R2Z A;  1T5X D;  2IO1 B;  3KUC B;  3M3J A;  3RCZ A;  4DDG D;  1T3T A;  3O13 A;  1KFY B;  5KHO A;  1DOY A;  5ITQ A;  3VK7 A;  3ZYY X;  2JYT A;  3Q8B A;  5JZE A;  4XK8 F;  1ACC A;  2D7E A;  3R3M A;  4FA6 A;  3FC4 A;  1I7H A;  3QX1 A;  4KOD A;  1WH3 A;  4CGY B;  4IM0 A;  3PHU A;  3VUX A;  1AYW A;  1ITO A;  3AOE A;  1GC6 A;  2Y3A A;  4BKT A;  2BWF A;  1I94 M;  1WGL A;  2INC C;  3DHH C;  2FUD A;  2B1M A;  1KHQ A;  5EE3 A;  4QRV A;  1IXZ A;  1F2B A;  2WDT B;  2LXA A;  1IPG A;  2JU6 X;  3V76 A;  3AED B;  1UM8 A;  2JY6 A;  1BVS A;  3L4P A;  2AQ3 B;  4IBB A;  1FJG M;  1T0S C;  2KMA A;  2O6V A;  2I2Y A;  2RDB C;  2WP9 B;  3Q8X A;  1YOV B;  4LF7 M;  2QEJ C;  4HJG E;  3ZJU A;  3IHP A;  3PGE A;  1JQP A;  5CHV A;  3PZ8 A;  4TV3 A;  3BPF A;  1WMH A;  3QIJ A;  2BS2 B;  3ZGZ A;  1YK8 A;  3AEF B;  2C9C A;  3RNB C;  1XXH B;  1FNU A;  1BQI A;  1T0R C;  4A8X C;  3MFG A;  2KWC A;  2R46 A;  1CMX B;  2FRA A;  3IFW B;  3ZDT A;  4DDI D;  4DHJ B;  1AW7 A;  4GKJ M;  2YJB A;  1EF7 A;  3M7G A;  4JI3 M;  4AKI A;  5JA7 A;  2BDL A;  1TH3 A;  3TBL D;  1YJ1 A;  4G50 A;  2DJG B;  2Z7J A;  1WR6 E;  4B3M M;  1WX7 A;  2OO9 A;  2VDB B;  3AI8 A;  2VHS A;  3JSV A;  1R5L A;  4B3T M;  1QDT A;  1N60 A;  1R4M I;  1SE4 A;  2V3P A;  4AW4 A;  4OEL A;  2R9N A;  2KDE B;  2R4E A;  4MB7 A;  1I4P A;  3A4S C;  1V80 A;  1R2Y A;  1G71 A;  2X8X X;  4G3O A;  3GPU A;  1VLB A;  3E46 A;  4MM3 B;  1KJT A;  1CB5 A;  1M6D A;  4OW0 A;  2OED A;  4KSK C;  4QHS A;  3KSJ A;  4PYZ A;  4W9C A;  2K47 A;  1L8Q A;  2DKL A;  4C7Z A;  1T6B X;  1SE3 A;  4KV2 A;  3R7R A;  4EZK A;  3Q3F A;  1STF E;  1KTK A;  2DYB A;  4GUA A;  2DZK A;  2PE9 A;  3VK8 A;  3PTF C;  4P6V F;  2L4F A;  5KQD A;  2BTE A;  5DPS A;  2KZR A;  3DBH I;  1VRA B;  1EWY C;  3ZO5 B;  4YVA A;  1OFI A;  4TSS A;  4P6E A;  4FAD A;  1O0E A;  3DDC B;  2QCU A;  3AI5 A;  3L27 A;  1XT9 B;  3HUI A;  1AEC A;  2V1C A;  4B0E A;  5JHB A;  1KSF X;  2MBB B;  3P5W A;  4HJK A;  3IXS A;  2WBF X;  3NJT A;  1TT5 B;  3BBZ A;  4LJ8 A;  5L83 A;  2E02 A;  4LGY A;  3SFE B;  1LO5 D;  3BII D;  2NR2 A;  3U6P A;  1YT7 A;  1QUS A;  1TS5 A;  2Q5W D;  4KGT A;  1AUA A;  2N0S B;  1XC8 A;  1MEG A;  4RGT A;  2DC9 A;  3TE6 A;  1N32 M;  3ZC7 B;  2CE7 A;  3GLI B;  4IIW A;  5CHW A;  3FKE A;  3VLF B;  5BMI A;  1WZ0 A;  5KO3 A;  1VEG A;  4X6J A;  1WI0 A;  2IY1 B;  3CBK A;  1VR9 A;  1JWB D;  4RF0 A;  3H6N A;  3MK6 A;  3W0L B;  2C7M B;  4GDL B;  4HCN B;  4M8N A;  2VH1 A;  2OJW A;  4C4V B;  1QUT A;  1IY1 A;  4L8R C;  1IN4 A;  2J7Q B;  1EUV B;  4ANR A;  1E0Z A;  3GPX A;  2D7H A;  4IKG A;  2VRR B;  3GO8 A;  3PBH A;  2AGA A;  1G6J A;  3N32 A;  2M0X A;  2DNF A;  2QSD A;  3VH4 B;  2ICI A;  3GCB A;  1P98 A;  1OQR A;  3M62 B;  1TDZ A;  4D8B A;  1PGY A;  1YZB A;  3FYC A;  3T3N A;  2PE6 B;  2OZ2 A;  1JCK B;  3U6O A;  2UXD M;  2LUM A;  3HK0 A;  4WH4 A;  1IP9 A;  3BY4 B;  1CK1 A;  5LNK 1;  3PSE B;  2DYO A;  3WXG A;  1IN5 A;  1Z2M A;  3RYT A;  4LJ4 A;  4B3R M;  4BKG A;  3SAU A;  3QCA A;  4LGM A;  3LDZ E;  2E01 A;  4M0D A;  2RSU A;  4HWI B;  1PVJ A;  2M19 A;  4IWP A;  2FT2 A;  2IO0 B;  4AXL A;  1WM2 A;  2EO2 A;  2QQ8 A;  3RZF A;  4AQ7 A;  3CH2 X;  2EKF A;  3BIN A;  3NS8 A;  2L2D A;  1OGW A;  3D8L A;  2JPH A;  1K8R B;  4C80 A;  3EEC A;  3AE3 B;  1FXI A;  4ZTB A;  2DHR A;  2D11 A;  1F1H A;  3VR9 B;  1FPY A;  1L4Z B;  5EJC A;  2O01 F;  3SMS A;  1SXT A;  2GNO A;  2N9L A;  7PCK A;  1RM6 C;  2KN4 A;  2EMS A;  1N6Z A;  2PTL A;  1YN5 A;  1TYG B;  1PDX A;  3CF6 E;  3HHY A;  3TWL A;  1HNW M;  4YYR A;  4JL9 A;  1XXG A;  2AL3 A;  2XNA C;  3U5Z B;  2DWN A;  1WX8 A;  1C3T A;  3HD3 A;  1GVN A;  3J7B A;  1NVI D;  1YX5 B;  1V92 A;  4HRO A;  3TRK A;  2L1A A;  1TTN A;  5EP1 A;  2KOX A;  3NWL A;  3LVV A;  3SFD B;  3AE9 B;  1IXR C;  4FHK A;  3QWL A;  1CS8 A;  3P42 A;  4PCZ A;  3KWZ A;  2AEH A;  4GDK B;  3U6C A;  1J7K A;  1JR3 D;  4C7Y A;  1G4A E;  2Q2E B;  5DNY A;  4YSY B;  5HI1 A;  1XLN A;  4IBG A;  1F29 A;  3CGW A;  5E6P A;  4LJP B;  3RUL A;  4LNN A;  3ENE A;  3WAL A;  3HX3 A;  4HLQ A;  2L32 A;  1GB4 A;  3PZD A;  4LFB M;  1PYW D;  3PNR A;  2GBN A;  4MT5 A;  4WW0 A;  2F4V M;  1NHG C;  2R45 A;  3VKH A;  2IGD A;  2M0A A;  2PVG C;  1M4V A;  2ON8 A;  2BW2 A;  4HEA 1;  2UUA M;  5AZF A;  2ACZ B;  3Q8F A;  1ZMW A;  4LNF A;  3C19 A;  2WHI A;  3U6D A;  3Q3N C;  1THE A;  3JR5 A;  4F1I A;  3Q2A C;  1Q3C A;  4DV7 M;  3HRD D;  1D0M A;  1EWC A;  3WHL A;  3IMA A;  5GMV A;  3I3T B;  4I05 A;  1LV7 A;  5EXP A;  1VDV A;  3I5J C;  2LI5 A;  2WX0 A;  3ML9 A;  3H7S A;  4YTN B;  1PJJ A;  1PAD A;  4D82 A;  2UUB M;  2R9O A;  4MSX A;  3HJ8 A;  3K9O B;  2IO3 B;  4B7G A;  2HTH A;  1DGG A;  2EKK A;  1J19 A;  4LFC M;  1YN3 A;  5DCN A;  1AYV A;  1IBL M;  3NBX X;  3P63 A;  3AEA B;  2RGO A;  2ZW0 A;  2FO5 A;  3ZXV A;  4HDO A;  3RMK C;  2BBC A;  3ZTC A;  4Q8G A;  4QNM A;  1BML C;  1VCB A;  2WLB A;  3EFC A;  2DZJ A;  1VD2 A;  1P9D U;  3ZNG C;  3SBJ A;  2BPS A;  2O6V D;  3K8Z A;  4M02 A;  4KLB A;  2N9X A;  1EO6 A;  3NVZ A;  4NPN A;  1FRR A;  3MP2 A;  1E5W A;  2Y5C A;  3GLG A;  2H7J A;  2X49 A;  3DOW A;  2KHW B;  3OJ3 A;  3W0F A;  4KGS A;  2HE7 A;  2BNK A;  2CEA A;  3N3K B;  4P1B C;  3TJP A;  2V4I B;  3A4R A;  4CQN A;  2DHZ A;  4KX6 B;  1JR3 A;  2N1W A;  1C4P A;  5BR8 M;  2C7N B;  2Y5P A;  4RCO A;  5JHA A;  2HHN A;  4HPP A;  2R2O A;  2NPT A;  4OZC A;  2MGW A;  1PJT A;  1Y8G A;  3CSF A;  4F8C B;  2KMM A;  4S17 A;  4DR2 M;  3ZXR A;  2OPF A;  2R0I A;  2WSE F;  3PNY A;  3AE1 B;  2EUC A;  1A5R A;  4LJO B;  1P7E A;  2Y5B B;  3AL0 C;  2KVR A;  3PO0 A;  1HR0 M;  3A33 B;  2HKJ A;  2G1E A;  2J42 A;  2V6Z M;  4EOY A;  5EZQ A;  3U30 A;  1PPP A;  2KFK B;  4L1B A;  2M60 A;  1FNV A;  4RNA A;  1WGG A;  1UWM A;  3W1S C;  4MGK E;  2YJ8 A;  4MSQ B;  4RM9 A;  1AU2 A;  1TL9 A;  3NY5 A;  4FWD A;  2MRO B;  1NEK B;  2JSV X;  3RNE C;  2WDQ B;  1PBH A;  1DGH A;  1PFD A;  3UIN B;  3TL5 A;  3RNG C;  3A46 A;  1TIF A;  1R7R A;  3N9Y C;  3J7A S;  1CV8 A;  2G6D A;  1V86 A;  1OIZ A;  2DJF B;  2K1F A;  2DXI A;  1OIP A;  1JWA D;  2UZJ A; 
#chains in the Genus database with same CATH homology
 1ZE3 D;  1L2C A;  1TS4 A;  4DV5 M;  2IGG A;  3EIE A;  2WDV B;  3PZ7 A;  2MH7 A;  2N9K A;  2JYE A;  2ZAM A;  2BTW B;  1EM7 A;  3HVD A;  1MPE A;  2KAC A;  5C2T B;  1QOB A;  3BOS A;  3AEG B;  4XGI A;  2KRU A;  4A9A A;  2W3R A;  2QJL A;  1XNR M;  4MGH A;  1XF5 L;  3DOA A;  1VZ8 A;  4IJF A;  1G3I A;  1ZP0 B;  1UUP A;  4AZF A;  1ZDX A;  3LB8 C;  4TQ0 A;  1N61 A;  4JV5 M;  1Z5C A;  5EE1 A;  2VII A;  5IZ7 D;  1L2B A;  4I4L A;  4LRT A;  1FNW A;  1JRO A;  3KW6 A;  3BWU D;  4CIS A;  4ZHP A;  3FTE A;  1YQ3 B;  4AG5 A;  1ORY B;  1NSF A;  2IPK D;  5IWA M;  1XCQ L;  4JI4 M;  3PNV A;  1J7B A;  3HHX A;  4R7G A;  1D6E C;  2KA6 B;  3I4V A;  3FUX A;  3TWM A;  1DOI A;  1NI3 A;  1RFK A;  4NZL B;  1E9M A;  2Y21 A;  4LK0 M;  4DR6 M;  2K5P A;  4HKQ A;  2BS4 B;  4LCB A;  2MJ3 A;  2V0G A;  2KAJ A;  4ZRP A;  2PW9 A;  1K3W A;  5FK9 C;  1B1Z A;  1QVR A;  2YQZ A;  1I4H A;  1IBM M;  1GLN A;  1P7F A;  2WXN A;  5EXS A;  1K3X A;  1NHW C;  2L6O A;  1UKF A;  2VQF M;  4G4N A;  1R6B X;  1CJE A;  1K52 A;  3GLH A;  2JA2 A;  3FTD A;  3HVZ A;  2LGI A;  1DYQ A;  2YEP B;  4LJA A;  1Z59 A;  2NMQ A;  5G5H A;  3SYL A;  4YSX B;  2W82 A;  2ZM6 M;  4RFB A;  1ZQ9 A;  4JWU C;  5AUI A;  3U6E A;  1SXJ D;  1IN7 A;  2GI9 A;  2IGH A;  5JI3 E;  4XDD A;  3KLS X;  4LRS A;  2KEB A;  2HCB A;  1I4X A;  1PUT A;  3PFI A;  3J2P B;  2QMT A;  2UU9 M;  2TSS A;  1SXJ E;  5EQT A;  1HXY D;  3SAS A;  2L7I A;  4OVZ A;  1FXA A;  4IBE A;  1YN4 A;  1J09 A;  4WUR A;  1HNZ M;  3JR4 A;  2WXM A;  3U61 A;  2L7H A;  2K0P A;  2C98 A;  1WWT A;  5LMU M;  4IJE A;  4HKZ E;  4WWM A;  1TKG A;  4XBO A;  2LWX A;  1C4C A;  1AWD A;  1KFV A;  4IBC A;  1D5Z C;  4LY6 A;  3U4E G;  2W54 A;  1OJL A;  3SHF A;  4B7H A;  2Z84 A;  2QP9 X;  3AE8 B;  3C58 A;  5KPZ A;  4WQM A;  2FFJ A;  2YEP F;  3NS1 A;  5EP2 A;  4NAW B;  2RKO A;  1IBK M;  3BY4 A;  4BOZ A;  3RGS A;  2JX5 A;  2G8L A;  3M0E A;  4EIW A;  4YY3 M;  5IRE B;  2RGH A;  3ZH9 B;  1KLG D;  1DO0 A;  3AJI B;  4FCV A;  1BUI C;  5H37 D;  4EE2 A;  2KRK A;  4X65 M;  4JI2 M;  1NNJ A;  3IAM 1;  2V3N A;  3KQ4 A;  3GLF A;  4C56 C;  3MHV C;  4KLN A;  3SAR A;  3U52 E;  3EA6 A;  2H88 B;  4US9 A;  2RDH A;  5ITY A;  3CF2 A;  3KP1 E;  2BTW A;  4LJ7 A;  1L6V A;  1STE A;  5FTK A;  1VJK A;  1YJJ A;  5ITT A;  3I9V 1;  4IUM A;  2OQ4 A;  1JWM D;  2JTC A;  4QNR A;  1YSY A;  4YT0 B;  2W3S A;  1HZ5 A;  4BOU A;  5IT9 S;  4DV0 M;  2CHG A;  1QT9 A;  3GLI A;  2AX5 A;  4RGN A;  1C4A A;  1JWS D;  2DOS A;  2J52 A;  4AQY M;  5BYR A;  2H89 B;  2CUZ A;  3GQ5 A;  2J53 A;  1TH4 A;  5BYQ A;  2B76 B;  2WXL A;  1E10 A;  4JI0 M;  3TMP A;  1FFV A;  5E26 A;  4OZA A;  2HTM E;  4YTM B;  1NVM A;  3KFU G;  1GL6 A;  3AH7 A;  1ZDV A;  4ZPX A;  2Y0Q A;  3U6M A;  2WXO A;  2X8A A;  1MHX A;  1QIL A;  3IG5 A;  4Z8X A;  1DOX A;  1SF0 A;  2HHH M;  2WXG A;  1SEB D;  1W5T A;  1IGD A;  3C0R A;  1J7C A;  3P4Q B;  4AS1 A;  4KHP M;  3R8B A;  2C5R A;  3FUW A;  1F77 A;  3HHZ A;  3LMM A;  4NXM M;  4G4Q A;  2HDE A;  3BVM A;  1IY0 A;  3DWM A;  4J3O D;  4TQ1 A;  2ZAO A;  4RGO S;  4TMA B;  2XN9 C;  2CFO A;  1ZUD 2;  3CIR B;  4X64 M;  3SAT A;  4L23 A;  4RGM A;  1HT2 E;  1L4D B;  3A98 B;  3W1S A;  1ZAE A;  4W5W A;  3VRB B;  1FCL A;  1FRD A;  4IOI E;  3SAV A;  5AUK A;  3W9C B;  4BLC A;  2IJ0 A;  3TSS A;  3FUT A;  4FD2 A;  2BJV A;  1YUB A;  2NTS A;  1QKZ A;  2EA0 A;  3H4M A;  4IBK A;  1QAM A;  2R62 A;  4B0M A;  5HFY A;  2BYT A;  2O5R A;  4N59 A;  4DV4 M;  1F0Z A;  1IQP A;  3U60 A;  3SYK A;  1FM0 D;  2EKI A;  3L26 A;  2INN E;  2WXR A;  3TWK A;  3VR8 B;  4FWH A;  3VRA B;  3U6S A;  2ONQ A;  3DWG C;  3U5Z A;  2VZK B;  2WXH A;  1QAN A;  3Q8C A;  1XWI A;  3K92 A;  3RE8 A;  2PIA A;  4LF5 M;  4A3V B;  3U61 B;  4WIP A;  4LF9 M;  3PXG A;  1KRH A;  4NSR A;  4LJ5 A;  3I4Y A;  4IBI A;  1SB3 C;  4I81 A;  5C1B A;  3J81 S;  2XZF A;  2DZO B;  4QOS A;  3FTC A;  3AOG A;  3NVV A;  4JWS C;  2G5G X;  1K51 A;  4GRI A;  3B2G A;  3IT6 B;  5T8I A;  5H92 C;  3PRP A;  3TEW A;  3WHK A;  1S3S A;  3QAU A;  4N6E B;  2K3U A;  1ZXH A;  3VKG A;  3ZQ4 A;  3TPZ A;  1N36 M;  1PGX A;  3U2S C;  3AN1 A;  2JRI A;  5DYI A;  5FSW A;  1TZO A;  3KWL A;  3B2F A;  3BYY B;  5D3D A;  1EE8 A;  4NJC A;  1JQ4 A;  3KSX A;  2WXP A;  4IBF A;  4PDG A;  1L1T A;  3VDU A;  1RYJ A;  4JN6 A;  3P1M A;  1C1K A;  3L25 A;  3GQ3 A;  1AYF A;  4LF4 M;  3T1H M;  3AE2 B;  1WYG A;  4GC9 A;  4QHT A;  1V1P A;  1FCC C;  1G8P A;  1D4B A;  2WU2 B;  3UZU A;  1NY6 A;  3AKZ A;  4AKH A;  2DWZ B;  5E6J A;  1GAQ B;  2I7N A;  3KP0 E;  1XLP A;  1IY2 A;  2DWM A;  4GC5 A;  2LHE A;  2XGN A;  2XFS A;  4X66 M;  1IXS B;  4B3S M;  1WRI A;  2KWD A;  3I57 A;  4IBJ A;  5GXG B;  1TKY A;  3E4R A;  3GP7 A;  1XLO A;  1EU4 A;  3TL4 X;  2K22 A;  2MJE A;  2VQE M;  1HNX M;  4G4O A;  1C77 A;  2XEP A;  3GLH B;  2N7J A;  1D5M C;  3GP1 A;  2C96 A;  4LF6 M;  3D8B A;  3UJN A;  2R4J A;  3FAH A;  4L4U A;  2UUC M;  1QOG A;  3GRV A;  4NRW A;  2CJO A;  4DXF A;  3TUO A;  4LLG M;  1N34 M;  3R9X B;  4PDI A;  3KDS E;  1E9R A;  4NSO B;  2EEL A;  1NYQ A;  2P5T A;  3EGR A;  2NQ8 C;  1L0Y B;  1HA5 A;  4M9X A;  4DV3 M;  2BB6 A;  1V97 A;  5ITX E;  1FFU A;  3MHZ A;  1SSN A;  2WXK A;  3K2L A;  3ABV B;  2ZAN A;  4IBD A;  1DGF A;  2XH9 A;  1C76 A;  4L78 A;  2L09 A;  1JWU D;  4MGZ E;  2INP E;  3KOZ E;  1XCT L;  4MH0 E;  5KQ8 A;  3T3O A;  2J7Q C;  2LXE A;  4BOP A;  5EE9 A;  3CF0 A;  1N62 A;  2WNM A;  3P4P B;  2QBY A;  1MVK A;  3ZNH A;  1KLU D;  1TS3 A;  2Y20 A;  2KDM A;  1XXH A;  4XWW A;  3SEB A;  3HJS A;  4IP3 A;  4D2K A;  3V3X A;  1QAO A;  2AHM A;  5HG2 A;  4D81 A;  4BB9 A;  1SJH D;  1ROE A;  2BU3 A;  3EIH A;  2MJD A;  2J7O A;  2DZN B;  2YFQ A;  1SXJ C;  1QYR A;  4I8O A;  3J80 S;  1SIJ A;  5EXT A;  1JW9 D;  3GPY A;  2CHQ A;  1E7P B;  2BS3 B;  4A6Q A;  2F5S A;  1BXT A;  1X37 A;  2FNA A;  3URY A;  3PSE A;  4HL4 A;  1N78 A;  3IFU A;  4DQO C;  3W31 A;  3KOX E;  1FIQ A;  1FO4 A;  3SAW A;  4JI7 M;  3BK2 A;  3GB1 A;  3L2A A;  3OTO M;  1QLB B;  4M9Z A;  4AG6 A;  4PT5 A;  5FTL A;  3VFD A;  4GHA A;  4H2A A;  2PLP A;  2YR0 A;  1PGA A;  1JQJ C;  3MC0 B;  2LEK A;  3LYY A;  4JX1 C;  4GHL A;  1I4Q A;  2UXC M;  2L83 A;  2JWU A;  3B9P A;  2C99 A;  1W5S A;  1C79 A;  1XHB A;  1Z5A A;  3TEZ A;  2MEK A;  2DWL A;  4L15 A;  1F2R C;  5I4D A;  4L2Y A;  1WXQ A;  4Q2J A;  1MI0 A;  1AN8 A;  2FOI C;  5ITX A;  4OU7 A;  4YTP B;  1FD6 A;  1HQY E;  3L29 A;  3HWS A;  3RNV A;  3BYT B;  3JAM S;  1N77 A;  3LXF A;  3W5V B;  3FYD A;  2PKO A;  3FIL A;  2KXE A;  3NUH B;  4OX9 M;  2X4A A;  1XNQ M;  4XE0 A;  4A90 A;  2I7P A;  2M5Z A;  3J9C A;  4JI1 M;  1T3Q A;  1E94 E;  3W2D A;  1NJF A;  3FUV A;  4GIT A;  2XSZ D;  2NTT A;  1DO2 A;  2Z3X A;  4REZ A;  3MP9 A;  1TGU A;  2LH0 A;  1XEE A;  1DKI A;  5EE0 A;  5ITR A;  1E9S A;  1CQV A;  1J5E M;  1HEZ E;  4YXD B;  4TUW A;  1I4G A;  4DR7 M;  1IGC A;  3PVS A;  3LVW A;  2OHF A;  1JRP A;  1DGH B;  4CHT B;  1QZM A;  5BMH A;  3FUU A;  4DR5 M;  1SBB B;  4ZRQ A;  3UGJ A;  1C9F A;  2BT6 A;  3W30 A;  3HKP A;  4LF8 M;  3FD9 A;  4KO8 A;  4JI8 M;  3KS8 A;  4DV6 M;  1QF6 A;  1DGJ A;  3ETR A;  1SJE D;  1TJE A;  1V1P B;  5C3J B;  2G9H D;  1NYR A;  4MAC A;  4YWG G;  3TQS A;  3R2T A;  3B9J A;  2QPA A;  2CV1 A;  4QOZ C;  1FEH A;  4B7F A;  1NEN B;  3C8Y A;  1A70 A;  1QOA A;  4GLS C;  2E5L M;  2WU5 B;  1TDH A;  5EXX A;  5FTN A;  2R61 A;  4DR3 M;  3FTF A;  2I38 A;  3IT4 B;  4FW9 A;  2ZW1 A;  4NL4 H;  3DA1 A;  3AB5 A;  4BOS A;  1Q39 A;  1L5P A;  3GRY A;  1HT1 E;  3RPF C;  3TEY A;  2KW0 A;  4OVZ B;  3GQ4 A;  1D5X C;  1SXJ A;  4DR1 M;  4FCW A;  2D5G A;  3OWE B;  4D8I A;  3UI3 A;  1MHH E;  1YJI A;  3ZCB B;  3AFH A;  5FKA C;  2LFI A;  4LTU A;  4LJ6 A;  2KZS A;  1OQQ A;  1IBX B;  2F5Q A;  1YQ4 B;  2H1R A;  3W5U B;  1QOF A;  4D80 A;  4JXJ A;  2JXT A;  5JI2 E;  5D3I B;  3AEE B;  3GRU A;  3A45 A;  3AV8 A;  5DYG A;  3PT2 A;  1YNT E;  2CHV A;  2JQR B;  3RFZ B;  1UGJ A;  1CZP A;  1IM2 A;  1ZPS A;  2W55 A;  3HU1 A;  3ZJT A;  2J7N A;  2R65 A;  1UWX A;  1JAL A;  3NVW A;  3NVY A;  4Z6Y A;  3FIL B;  3GRR A;  3BVG A;  2CU3 A;  4ARC A;  3BK1 A;  1QQW A;  3U6Q A;  1TY0 A;  4UDU C;  4A55 A;  3K1J A;  3L28 A;  2WXQ A;  3TEX A;  4KGR A;  3MJ5 A;  1ZOY B;  3HJQ A;  1GPX A;  1MU5 A;  2D7G A;  3GLG B;  4DUY M;  1L6U A;  3H8H A;  3KXE C;  4FVM A;  3SHG B;  4BBA A;  4FXC A;  3NZ3 A;  1ET9 A;  4GKK M;  3VQI A;  3GPP A;  3DZD A;  1OFH A;  2L52 A;  2RMM A;  4JI6 M;  4A5U A;  3CTW B;  3LQR A;  3LQQ A;  4YHH M;  2LNH C;  4MGY E;  3MTV A;  3EUB 2;  3U6L A;  2Y0T A;  3HU2 A;  1NY5 A;  1V1O A;  2WQY B;  5G5G A;  3AE5 B;  4LG2 A;  2BJW A;  2XF3 A;  2ERC A;  4GMQ A;  2Z8L A;  3DFZ A;  1OFF A;  2K9X A;  1L0V B;  3R2I A;  2IDY A;  5GKN A;  1L1Z A;  4B08 A;  5C18 A;  1XO3 A;  1WSP A;  1G59 A;  4GIP A;  4O1N A;  4R3D A;  3VDP A;  4ITQ A;  1FMA D;  4HRS A;  1PJI A;  4JPS A;  1NNU C;  1GKI A;  5EP4 A;  3ZJV A;  3U7Z A;  1VDD A;  1XLQ A;  4US8 A;  5KPR A;  4AKG A;  3E56 A;  2FUG 1;  3ILK A;  1K50 A;  2WS3 B;  4DR4 M;  4XDC A;  4HXD B;  2V1U A;  1VZ7 A;  4N58 A;  5BMG A;  4AI6 A;  4NAM A;  4LZZ A;  1TKE A;  3HGI A;  1TH2 A;  2BB5 A;  2QIL A;  4MGI E;  3KOW E;  3NBI A;  2X38 A;  2WXF A;  1HQR D;  3BZD B;  3M6A A;  3RGP A;  1DGB A;  1KF6 B;  1E6E B;  3UMM A;  1IN8 A;  4WAF A;  1IUE A;  3BB7 A;  4GH9 A;  1UNS A;  1E32 A;  2LHD A;  3PHW A;  3SMP A;  2QEN A;  1N63 A;  3WCQ A;  5A2Q S;  4OZB A;  4I5S A;  4ZHO A;  3UK6 A;  3HHW A;  1YMH E;  3E9S A;  2PMV A;  4DUZ M;  1KYI A;  1K82 A;  1ESF A;  1Z5B A;  1HQC A;  2QBY B;  4P16 A;  2Z4S A;  1TS2 A;  3BVZ A;  4M0W A;  4NXN M;  3AOE C;  4M9S A;  2F5O A;  1GL7 A;  2CJN A;  4G4R A;  3AEB B;  1EU3 A;  1FNN A;  4RH6 A;  4IDI A;  3AEC B;  5ITU A;  2RDG A;  4LZJ A;  1V8C A;  3J27 B;  5D7G A;  4RKX A;  4JYA M;  4JI5 M;  4G6Z A;  3CWI A;  1MX0 A;  4RF1 A;  1WGK A;  2DVW B;  1ENF A;  2FE8 A;  5JXV A;  2SAK A;  1PM5 A;  2A5Y B;  1R7S A;  1HZ6 A;  1H6U A;  2KQ4 X;  1XMO M;  1XMQ M;  1G41 A;  4LJ9 A;  1PGB A;  3AE7 B;  1VZ6 A;  2YNM D;  2F5N A;  2R18 A;  2XLJ A;  2WDR B;  1K53 A;  1C78 A;  4L16 A;  3B21 A;  4MH8 A;  3Q8A A;  4ZOH C;  2XZU A;  1F2R I;  3KS4 A;  3BBA A;  1NJG A;  1IBX A;  5LMN M;  1D2N A;  4ZYS A;  3T15 A;  2J7Q A;  1L0X B;  2DLB A;  4USA A;  8CAT A;  2WXJ A;  2KZU A;  3GLF B;  1QQR A;  3SFZ A;  2PVO D;  4K0K M;  2SEB D;  3KOY E;  1J7A A;  3IAS 1;  1Z6T A;  3NRZ A;  1B9R A;  1N5W A;  3P4R B;  7CAT A;  1L2D A;  5BPV A;  5BYS A;  1SXJ B;  3THG A;  3HU3 A;  4FWG A;  4BOQ A;  4XWT A;  3SC3 A;  2QIE B;  4D8E A;  2XFT A;  2Z4R A;  4LFA M;  3PHX A;  4ARI A;  5FLX S;  2DBY A;  3AM9 A;  3R8F A;  2LJI A;  1GOZ A;  4KKJ A;  3IG8 A;  2RPV A;  1KH0 A;  4S12 A;  1QAQ A;  4X62 M;  3AE6 B;  5EZS A;  2QZ4 A;  5FTJ A;  4YSZ B;  1I4W A;  2AQ1 B;  4DV2 M;  2C9O A;  4FCT A;  2JZP A;  4JE3 B;  1TY2 A;  3OQC A;  5FR3 A;  2CV0 A;  5FTM A;  2AQ2 B;  1GB1 A;  3U60 B;  1I4R A;  2UXB M;  5F3W A;  4MI7 A;  3Q69 A;  5KPT A;  3P4S B;  1ET6 A;  2LMC A;  1SE2 A;  3RFW A;  2XSZ A;  1RWS A;  3T1Y M;  4DXG A;  2GB1 A;  2WXI A;  1IN6 A;  4NOO B;  3I51 A;  3SR6 A;  2HL7 A;  1N5X A;  2HWK A;  3PRM A;  2J4X A;  3AMZ A;  1N75 A;  2M56 B;  4KKI A;  3KWV A;  2VZK D;  2FBW B;  5TSS A;  5HHD G;  1Q10 A;  5EP3 A;  4XZX A;  1YE9 A;  4NRV A;  3GS2 A;  2CV2 A;  4ITK A;  5MPO A;  4DV1 M;  3KVW A;  3AE4 B;  3A42 A;  1JML A;  4OHJ A;  4PD2 A;  3AV0 A;  2GRI A;  2E6X A;  2DYM A;  3T38 A;  5H8Y E;  1N33 M;  4II7 A;  1ZXI A;  3V05 A;  1Y56 A;  3Q8E A;  2ZBK B;  2E3T A;  2DWQ A;  1Q3B A;  3O65 A;  2F5P A;  1R2Z A;  1T5X D;  1T3T A;  3O13 A;  1KFY B;  1DOY A;  5ITQ A;  3VK7 A;  3ZYY X;  2JYT A;  3Q8B A;  5JZE A;  1ACC A;  2D7E A;  3FC4 A;  1I7H A;  4KOD A;  4CGY B;  3PHU A;  3AOE A;  2Y3A A;  1I94 M;  5EE3 A;  1IXZ A;  2JU6 X;  3AED B;  1UM8 A;  3L4P A;  2AQ3 B;  4IBB A;  1FJG M;  2I2Y A;  2WP9 B;  3Q8X A;  4LF7 M;  2QEJ C;  4HJG E;  3ZJU A;  3PZ8 A;  2BS2 B;  3ZGZ A;  3AEF B;  2C9C A;  1XXH B;  1FNU A;  4A8X C;  3MFG A;  2R46 A;  1AW7 A;  4GKJ M;  3M7G A;  4JI3 M;  4AKI A;  1TH3 A;  2Z7J A;  4B3M M;  4B3T M;  1N60 A;  1SE4 A;  2V3P A;  4AW4 A;  2R4E A;  4MB7 A;  1I4P A;  1R2Y A;  3GPU A;  1VLB A;  4MM3 B;  4OW0 A;  2OED A;  4QHS A;  3KSJ A;  2K47 A;  1L8Q A;  4C7Z A;  1T6B X;  1SE3 A;  4GUA A;  1KTK A;  3VK8 A;  4P6V F;  2BTE A;  5KQD A;  1VRA B;  1EWY C;  1OFI A;  4TSS A;  2QCU A;  3L27 A;  3HUI A;  2V1C A;  4B0E A;  1KSF X;  3IXS A;  4LJ8 A;  4LGY A;  3SFE B;  1LO5 D;  3BII D;  3U6P A;  1TS5 A;  4KGT A;  2Q5W D;  2N0S B;  1XC8 A;  4RGT A;  3TE6 A;  1N32 M;  3ZC7 B;  2CE7 A;  3GLI B;  4IIW A;  3FKE A;  3VLF B;  5BMI A;  5KO3 A;  1VR9 A;  1JWB D;  4RF0 A;  3MK6 A;  3W0L B;  4GDL B;  1IY1 A;  4L8R C;  1IN4 A;  1E0Z A;  3GPX A;  2D7H A;  4IKG A;  3GO8 A;  2AGA A;  2QSD A;  2ICI A;  1OQR A;  4D8B A;  1TDZ A;  1YZB A;  3FYC A;  3T3N A;  1JCK B;  3U6O A;  4WH4 A;  2UXD M;  2LUM A;  1CK1 A;  5LNK 1;  2DYO A;  1IN5 A;  4LJ4 A;  4B3R M;  3SAU A;  4LGM A;  4M0D A;  1PVJ A;  2M19 A;  2EO2 A;  4AQ7 A;  3D8L A;  4C80 A;  3AE3 B;  1FXI A;  4ZTB A;  2DHR A;  3VR9 B;  1L4Z B;  5EJC A;  3SMS A;  1SXT A;  2N9L A;  1RM6 C;  2KN4 A;  2PTL A;  1YN5 A;  1TYG B;  1PDX A;  3CF6 E;  3HHY A;  3TWL A;  1HNW M;  1XXG A;  2XNA C;  3U5Z B;  2DWN A;  1GVN A;  3J7B A;  1NVI D;  3TRK A;  4HRO A;  2L1A A;  5EP1 A;  3NWL A;  3LVV A;  3SFD B;  3AE9 B;  1IXR C;  3QWL A;  3P42 A;  4PCZ A;  4GDK B;  3U6C A;  1J7K A;  1JR3 D;  4C7Y A;  1G4A E;  2Q2E B;  5DNY A;  4YSY B;  5HI1 A;  1XLN A;  4IBG A;  4HLQ A;  2L32 A;  1GB4 A;  4LFB M;  1PYW D;  4MT5 A;  4WW0 A;  2F4V M;  2R45 A;  1NHG C;  3VKH A;  2IGD A;  2M0A A;  2PVG C;  1M4V A;  2ON8 A;  2BW2 A;  4HEA 1;  2UUA M;  2ACZ B;  3Q8F A;  3U6D A;  3JR5 A;  1Q3C A;  4DV7 M;  3HRD D;  1EWC A;  3WHL A;  1LV7 A;  5EXP A;  1VDV A;  4YTN B;  1PJJ A;  4D82 A;  2UUB M;  3HJ8 A;  4B7G A;  1DGG A;  4LFC M;  1YN3 A;  1IBL M;  3P63 A;  3AEA B;  2RGO A;  2ZW0 A;  2BBC A;  4QNM A;  1BML C;  2WLB A;  3SBJ A;  3K8Z A;  3NVZ A;  1FRR A;  3MP2 A;  2Y5C A;  3GLG A;  2X49 A;  3W0F A;  4KGS A;  2BNK A;  2CEA A;  2V4I B;  4CQN A;  4KX6 B;  1JR3 A;  4RCO A;  1C4P A;  5BR8 M;  2Y5P A;  4OZC A;  2KMM A;  4DR2 M;  2OPF A;  3PNY A;  3AE1 B;  2EUC A;  1P7E A;  3AL0 C;  3PO0 A;  1HR0 M;  2HKJ A;  2G1E A;  2J42 A;  2V6Z M;  5EZQ A;  4L1B A;  2M60 A;  1FNV A;  4RNA A;  1UWM A;  4MGK E;  4FWD A;  1NEK B;  2JSV X;  2WDQ B;  1DGH A;  1PFD A;  3A46 A;  1R7R A;  3N9Y C;  3J7A S;  2DXI A;  1JWA D;  2UZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...