4R3DA

Crystal structure of mers coronavirus papain like protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
324
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3
publication title The Crystal Structures of Middle East Respiratory Syndrome Coronavirus Papain-like Protease and Its Complex with an Inhibitor
rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
total genus 82
structure length 319
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08715 Viral_protease Papain like viral protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4r3dA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4r3dA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4r3dA03
4MM3B 3MJ5A 4R3DA 3MP2A 5KO3A 5E6JA 4RNAA 4M0WA 4PT5A 4OW0A 3E9SA 2FE8A 4WURA 4OVZB 4OVZA 4RF0A 4REZA 4P16A 4RF1A
chains in the Genus database with same CATH superfamily
1PQSA 1JR3A 2M0XA 3I06A 2B76B 2JY6A 2NBUA 3ZGZA 1T3TA 1GC6A 3GLIA 3QK0A 2LMCA 2LVQD 3PREA 2A5UA 2DNAA 2DC8A 5EP3A 3SU8X 3U8ZA 7PCKA 2LTUA 3SHGB 1GL7A 1GUAB 2N35A 1HJPA 2FE8A 2LFIA 3RVWA 4HLEA 4HWYA 3GLFB 3VRAB 1SG9A 3KSJA 1P0RA 1HQYE 1NJFA 2WQYB 2V4IB 1I4GA 3VR9B 2V9HA 4L8RC 1AYUA 5L8RF 4MGYE 3AE1B 1JR3D 3AM9A 1T0RC 4YSXB 2C5RA 3VKHA 4TQ1A 2D10A 2HWJA 2LGYA 4L2YA 4Z8XA 2HHNA 5D6JB 3CMMB 3BVZA 4WJNA 1JWBD 4LK0M 4ITQA 3LVWA 3K92A 1P98A 3O65B 3RFWA 1XLQA 2WNMA 2WYQA 1VDLA 1WGYA 1ZXHA 1HT1E 1J8CA 3N3KB 4KLBA 3IAM1 1ITOA 3B1LX 1U4AA 2EKIA 3W2DA 1PXVA 1TJEA 3ZTCA 2QC8A 3ZRFA 1AUAA 2C60A 1T0SC 3DBLI 3GLHE 3CBKA 2DWNA 1NV8A 4PT5A 1ZKHA 5EQTA 3Q3MC 8CATA 2KACA 3ZVVA 1L8QA 1F9JA 1JR3E 1KTKA 1ZW7A 2M19A 3BK1A 3MK6A 3ZJVA 3D8LA 4NSOB 3V76A 2BB5A 3A9KB 1TDZA 2LUEA 1TLOA 3O65A 2R9MA 2K9XA 2H7JA 2DVWB 1QDTA 1T0QC 1FH0A 2L7RA 1QUTA 4DDGD 1Z5SB 3B7QA 3I51A 2N1WA 4WWOA 1ME4A 4B9KA 1VG5A 1XMQM 4RNAA 4QBBA 4PDGA 2ICIA 2NQDB 1VR9A 3AE3B 1SE4A 2AVWA 2NR2A 3FTDA 2R9OA 3U6SA 2DCDA 3U30A 1SP4B 3M99A 3AJIB 3AE8B 4FHJA 4S0RA 2PE6B 2Y3AA 2J42A 3LJ3A 3IUTA 3AOEA 1WIVA 2R45A 1J7KA 4E3CA 2AS8A 4W9JA 5HHDG 3E56A 1XNQM 4DR7M 2HDEA 2YEPF 3L13A 1R4MB 4IUMB 2FS1A 3S3RA 3DBRI 3PSEB 2M8SA 5FR3A 5KPZA 1KSFX 1VDDA 4CHTB 1AU2A 4YWGG 2AQ3B 4W9DA 2CP8A 4F1IA 1AARA 3QT4A 3ZC7B 2AUXA 1XD3B 1Q3CA 3HM6X 3HUIA 3L17A 4OVUA 3W68A 2MR9A 5KHQA 3HJ8A 5FTKA 4WQOB 1TS3A 5CHWA 2UXDM 1EU3A 3D6SA 4K7CA 5G2NA 4KGRA 2GBMA 2L4EA 3CGWA 3PHXB 4JL9A 3NZUA 3CH2X 1X1MA 2KNZA 3PSEA 1Z5CA 4XE0A 1E7UA 4M0WA 5ITQA 5EE9A 2VDBB 1LGRA 2XU3A 1TH3A 1WYGA 3U6LA 1E90A 1FNUA 2MQJA 3RPFC 4AJYB 2DWZB 3BPFA 2RRUA 2N7DA 3OTOM 3ILKA 3U6PA 2VHSA 1IBLM 3SR6A 1YX5B 2LVPA 5H92C 2ATOA 2Y0QA 2BWEA 1Z5AA 3TRKA 1NVMA 3KOWE 2LD9A 4WQMA 2WXOA 5EF4A 1PIPA 4CGYB 3PZ7A 1VD2A 2NMQA 4IBCA 1G41A 3TSSA 2R2QA 3P4SB 4M01A 2LWPA 3V3XA 4IDIA 1FD6A 1T6BX 3C9EA 3J27B 4AS1A 2BT6A 3M95A 1F77A 4NJ7A 1G59A 2K25A 3QHTA 3V62A 3VUYA 2ERCA 2MA9B 2KDFB 1L0XB 2GBNA 1V92A 4DHJB 2KTRA 3ZXVA 3E21A 3IG5A 1QKZA 3HGIA 1YIWA 4DV1M 1R5LA 3TEXA 2M17A 3SFDB 3P5XA 2KO3A 1PGAA 3WALA 3W1SA 1IPGA 1Y8GA 1IM2A 2HJ1A 3PDFA 1NB5A 1TGUA 2XSZD 2JX5A 1Q39A 1OFIA 5FTJA 1TS4A 3U6EA 4B95A 2O6XA 4JXJA 3GQ4A 1GB4A 5EZSA 4QNMA 1MFWA 4CHKA 4B3MM 1A6RA 2LVAA 5E6JA 1C1YB 1V86A 2NQ8C 4RCOA 4LJAA 3ZW3A 4W9CA 3AFHA 4NAWB 5EXSA 1NQCA 1TKGA 3HK0A 2DZOB 1PJJA 1Q1OA 4LNNA 4BS5A 4WJOA 3FUWA 3EA6A 2JZ1A 1LM8B 2QBYB 1PJSA 1YK8A 3A1QB 3NS8A 3L28A 2UZJA 4ITKA 4HPMB 1VLBA 2IGDA 3QQ8B 4HROA 3AKZA 5AZHA 3KW6A 1CJEA 4R3DA 3DBHB 4CO7A 4K3CA 5EDSA 1VEGA 3IHPC 3NHEB 1BT0A 3HKPA 5DPSA 2DC7A 3PRZA 1PBHA 2UXBM 2K0BX 1L0VB 1XXHB 3W67A 2MHJA 2B1NA 4OZAA 3U8EA 2KA6B 3MHSD 2NBVB 4CISA 4W4UA 1NY5A 1ZOYB 4HXDA 1MG4A 1F0ZA 3AEBB 4WA6A 1QZEA 2VZKB 2WXJA 4JI2M 1QF6A 1QANA 1Q02A 1YSYA 1NI2A 2QSDA 2CEAA 1OTRB 4AOFA 3ZUAA 2PBHA 3L26A 2KZUA 2BKFA 4FCTA 2RMMA 1R2YA 3PGEA 5AZFA 3USVA 2FH0A 1QAQA 1QQWA 2FUG1 1QOFA 3M62B 3NHEA 3MC9A 2OZ2A 2JZPA 1XHBA 4L15A 5J17A 5BPVA 1DGJA 1QOBA 3KP1E 2FRQA 3FTFA 5G5HA 3RZFA 1MDWA 1GB1A 1E32A 2GHUA 2D3AA 1F29A 1YD8U 5IA7A 2WDTB 3AEDB 4AG6A 3PS6A 2EUCA 2KQ7A 3C3EA 4YTPB 3BOWA 1ZMVA 1QAMA 5GKNA 4AKGA 2AIMA 4F1SA 4N6EB 2CHWA 1NEKB 2LGSA 4JPSA 5GMVA 1FFUA 1TGZB 2G3QB 2K6BA 2BTWB 4DV4M 4GDLB 3HVDA 5CX3A 2X8XX 4D80A 3X0WA 2MGWA 2WXLA 2KMAA 3Q8CA 3GRYA 2L4FA 1I35A 4HPLB 1GABA 3TE6A 2BS3B 4Q8GA 4LNKA 3EIEA 3MTNB 2G8EA 3BCNA 2MJ3A 3QC8B 5DPRA 2Y5BB 4G0NB 4P6GA 4L1BA 2YJCA 2DWLA 1XQQA 2WXIA 2NCNA 2X8AA 2MRPA 1I4HA 4GSWA 2OJWA 1WXVA 1IXSA 1JWMD 3BVMA 2G3QA 4WAFA 3L54A 3HU1A 4S17A 3PHWB 2D5GA 1VRAB 3MC0B 3SYKA 2L0TA 2MLBA 1Q6KA 1F4IA 3W0FA 1D0LA 1E8YA 2JWUA 2KWDA 3VTUA 4BKTA 2O25A 3KUZA 4TUUA 2DAJA 3N3GA 3HHZA 1R7RA 2MEKA 4LLGM 1E0ZA 1KFVA 4LFCM 1HQRD 2G4DB 1CQDA 2D3CA 3MMPA 2DYOA 3GOEA 2Y5BA 3IBEA 1P3QU 4FJYA 1A5TA 1N62A 1KFXL 1U9QX 2C99A 3PV1A 4C4VA 4LDTD 3PT2B 1XCTL 4L4UA 3UIOB 4DHZB 5F3WA 3TWKA 3NVZA 1GC7A 2X38A 4MEMA 2REXA 3ZIMA 2AL3A 2FO5A 3EC8A 1IQPA 5EXTA 2LUMA 3LDZE 6PADA 4LY6A 1JALA 2QPAA 3M6AA 1FPYA 4EKUA 3TQSA 2DENB 2CHQA 3BBAA 3W5UB 2W55A 1AU0A 1TH4A 1L7YA 4S12A 2HE7A 3BB7A 3SEBA 3B2GA 4C80A 3KOYE 2Z0DB 2JXXA 3HWNA 2LJIA 3MP9A 5LXIB 2FCMA 4LG2A 2BWFA 1HZ6A 3WHLA 2QDFA 1WRDB 1U9XA 3AEFB 4MJSA 3FKEA 2MBOA 4IBDA 2HTME 1DGHA 3Q8AA 5E26A 2N9KA 4UDUC 1B1ZA 1U5IA 2DAFA 4HJKA 1TYGB 1V33A 1UELA 3U60B 3N30A 2F5SA 1GJSA 2GQFA 2YJBA 3PFIA 2K22A 4ZDVA 1AYVA 1QQRA 3HJSA 3OISA 4ARIA 1AYFA 4LCBA 4A3OA 4YXDB 2IO1B 1FM0D 3KYCD 1K50A 3PTFC 1K51A 3CWIA 4PS7A 4D2KA 1ZCMA 1J5EM 3NOBA 5EE1A 3IHPA 4IBGA 1N61A 2QENA 1Z5BA 2J0MA 2DOSA 1L1ZA 1RFKA 2WDQB 3PW3A 3UINB 1S1QB 4RF0A 2XK5A 1CSBB 4CZWA 3AEGB 1YX6B 2L6OA 3FUVA 4N58A 1AYWA 3K9OB 3NJTA 1THEA 3BC3A 3RVXA 4FVMA 4XDCA 3B89A 2L1AA 4NJCA 4RFBA 1V80A 4NAMA 2O6VA 2JWSA 3AI8A 1R4GA 3NVYA 5BO4B 2ZZPB 3NZSA 2LEKA 3KS4A 3KFQA 2ZVNA 3BOSA 3PNYA 4JV5M 2UU7A 2J53A 3C8YA 2EA0A 4DV0M 3LYYA 2DWMA 4C7ZA 4OVZA 1ZMUA 4IM2A 3GPUA 4K81A 2K5PA 2C7HA 2Z8YM 2V1YA 1QXPA 4DR5M 5EXPA 2Y21A 3GRRA 3ZJTA 4A6QA 4DV3M 1PJTA 2Z0EB 3K9OA 4OEMA 4RKXA 3VR8B 4II7A 2DHYA 1PE6A 3GP1A 1HNXM 1WFYA 2R4EA 2GI9A 2K47A 4FCVA 2MJ5B 2Y5PA 1TDHA 3JR4A 2BS4B 2PMVA 3VFDA 3L2AA 1DKIA 4BQVA 1FJGM 1XXGA 4I81A 3DOAA 4M8MA 4RF1A 1FIQA 4DBGA 3HU2A 4MM3B 3HHYA 4LTUA 1CK1A 4DV7M 1ICFA 1FXIA 4KZ0A 1YN3A 2Z8LA 2GRIA 3BYYB 2CU1A 5C2TB 3DCGA 2R4JA 4ZHOA 1JQPA 1X37A 3ZNZB 2UYZB 2GB1A 2FT2A 2LH0A 2E01A 1HA5A 2QHOB 1TKEA 3ABVB 2PVGC 1HNZM 3GRUA 2K1FA 2R6FA 3MJWA 3KDSE 3N1ZC 1Y08A 4XR7A 2GBJA 2D3BA 1HZ5A 3VH4B 2BDLA 1TTNA 2GNOA 3T15A 3RZWC 4MM3A 2N9PC 3GCBA 2K3UA 2APLA 4AG5A 4W5BA 1AU4A 1OJLA 2CV1A 4P17A 1R4NB 2BW2A 2IBIA 2GLSA 2WZJA 2INCC 3ML9A 3U4EG 4GRIA 3AECB 3KFUG 1X9YA 4LJPB 3HHMA 3PZDA 4OX9M 4NZLB 2EMTA 2GMIC 3KSXA 3QJZA 1OGWA 4NQLB 3BYTB 2D7HA 5FKAC 3AOEC 3GZNI 2X4AA 3HIZA 5H8YE 4NNJB 2QILA 1L1TA 1N33M 3WAOA 2WU5B 4FCWA 1V1PA 1CUKA 1SF0A 1IN7A 1H6UA 1XC8A 3I9V1 1SXJD 4ZRIA 5E6PA 3NY5A 2JQGR 1GL6A 2M60A 2BQQA 2WXKA 3PPAA 3PBHA 1WSPA 3H89A 3RE8A 1SB3C 4FJCA 5FSWA 2AQ2B 4AQ7A 1WR6E 2VIIA 4NPNA 4A9AA 2DAGA 4LJ5A 3GQ3A 1XT9B 3PLVA 2R9FA 3ZRCA 1EU4A 3Q6BA 2DZMA 4HEA1 4BSQA 2IZVB 2EJSA 9PAPA 2B3AA 4W9IA 4ZRKA 1TBEA 2LVQA 1F2RC 2KZSA 3KW9A 3BWUD 2BVCA 2KEBA 2RSUA 2JY6B 4N4ZA 1EWCA 4KHPM 1M94A 3GLIB 2A5YB 1FNNA 1R2ZA 2ZBKB 2K6DB 1ESFA 1KHPA 3TUOA 4TKNA 3BINA 4NXNM 4MDKE 1ZPSA 4IP3A 2I1JA 1VSNA 1QMYA 3P5UA 1XF5L 2UUAM 1WGLA 4JX1C 3VDPA 1L2NA 2G45B 1SXJE 1N75A 4KLNA 1F52A 3T3NA 3DZDA 5JHBA 2J4XA 2BGFA 5HI1A 2LXAA 1RAXA 3Q3JA 2LVPC 3GLHA 2P5TA 2OPFA 2KKCA 5BR8M 3A42A 4GUAA 1YJJA 4YTNB 3SDLC 2IDYA 4BS6A 2O2VA 4H2AA 4P6VF 1SXTA 2KFJA 3KYDD 2OO9A 4LJ9A 1BXTA 2BBCA 1VDVA 3RVVA 2HHHM 5A24A 2MSED 2DKLA 2FUHB 2L0FA 2PTLA 3RYTA 4XWTA 4CDCB 4KSLC 3ZNHA 2JXNA 3SAWA 1GMYA 2CIOA 4IWPA 3WANA 5EP2A 4Q7JA 3I57A 3AL0C 1L6VA 3KOXE 4PS3A 5BYQA 2C9WB 4FJVB 1LO5D 1YZBA 4LNOA 4IBIA 3W1SC 2DXIA 1PM5A 1A70A 2R18A 3H7PA 2B1MA 5C3JB 4GHAA 1DV0A 2W82A 4B3SM 2R65A 2ZEQA 3RNFC 1W5SA 3AV8A 1AN8A 5KQ8A 1YJ1A 1NSFA 3KP0E 3RNVA 3JYUA 1JRUA 4PK1A 3KW5B 3B0AA 3EFUA 3N1XC 4ANVA 3DVNU 3TEYA 3IECA 4AUQC 1N77A 1N32M 1Z6TA 4HL4A 1NB3A 3K9PA 1MU5A 4GDKA 4PP2E 1I4XA 5ITXE 4N8WA 3K8ZA 4WJPA 4B3TM 5PADA 2DZLA 3ZUNA 3PRPA 2TSSA 3JSVB 3E1ZB 1DGBA 2HKJA 1ET9A 3NS1A 1CQVA 4FHKA 4USAA 2KZRA 3U7ZA 1WH3A 4WWPA 2LVNC 2AQ1B 3AN1A 3CSTA 2KN5A 3SMSA 1XWIA 1FCCC 3EHVA 4JGHB 3WXEA 5E6NA 1C9FA 2RD0A 4K1RB 1M6DA 3TBLD 2FTDA 1K52A 2QJLA 2XBBC 1MG8A 4KGSA 4M00A 4HRSA 3UGBB 4MGZE 2HD5A 5EJCA 4YTMB 1S4VA 3JSVA 4JN6A 1IY1A 4M9SA 2LWXA 3MFGA 4KT0F 2VH2A 4YT0B 3QYBA 1NDDA 3UIPB 2V4LA 3J2PB 4NL4H 3HHAA 4EZLA 4GH9A 3J9CA 2L09A 4BBAA 3DDCB 2KVRA 1VZ6A 1DO2A 4CIZA 1HR0M 1R4MI 4NSRA 4LJ8A 1SE3A 1C4CA 2K6QA 3DQVA 2HTHA 3NRZA 2Q2EB 3U61A 1WGRA 1DGGA 2KLCA 2JZ0A 3B2FA 3QCAA 3WA0A 5EGWA 2MH8A 3O1GA 3HU3A 2SAKA 3QX1A 2B3TA 2RKOA 3ZO5B 3ZQJA 5BMGA 2FCQA 4YYVA 3J80S 2KC1A 3V6EA 4M0WB 3SFZA 2HL7A 4AJWA 4A55A 3A4RA 4CQNA 1OAIA 1K8RB 3E9SA 4MT5A 3SC3A 5F02A 2I38A 5AZGA 5FK9C 1WE7A 1WIAA 3FUXA 1HNWM 3MHHA 4KIKA 1MS6A 1LTMA 4GXBA 3F5VA 5JZEA 2MBEA 2XF3A 3V60A 1HEZE 2IYDB 1NVID 2WXQA 2PIAA 1E10A 4DR3M 2QNJA 2CHVA 4DR4M 1QOAA 5EP4A 1IYFA 1DGFA 2JYEA 5FLXS 3L08A 2WSFF 3M0EA 3APDA 2IGGA 4EZKA 5TR5A 3I01M 3JAMS 1IGDA 2JQRB 2KNVA 4A20A 3GLFE 4ZYSA 2G5GX 3LW5F 2KC2A 3ZDMC 1V5TA 1D0KA 4LCDE 4MGHA 1UGJA 1UH6A 1Y8RC 2KTRB 5IAAC 2XSZA 3HD3A 1N6ZA 1KXRA 2VF8A 5CVNB 2KFKA 1GOZA 2JF5A 2BYVE 4B08A 2N9XA 4QAYA 3RNEC 3V61A 1FXTB 3W9CB 4LNFA 1GNUA 2FIFA 1NO1A 3FAHA 3I04M 2ZW0A 2INPE 3W1YA 5JA7A 4KX6B 2C7MB 1VJVA 2KXJA 1K53A 1YQ4B 1OIPA 2JUOA 2L7HA 3A4SC 4HDOA 4IC7B 4MZSA 4TMAB 2DAEA 2YLMA 2G1EA 4IBJA 3ONSA 1WJ4A 4X6HA 1XNRM 2DCBA 1UNSA 4LF8M 3FUTA 3JW0X 3URYA 3HZJA 2LRUA 1I4PA 2KAJA 2KTFA 2BWBA 1NPZA 3PRMA 4WH4A 4QOSA 3JVZX 3AE7B 3L0WB 4GN1A 4MACA 1J09A 3H1UA 3GQ5A 1WGHA 4D8IA 1HTOA 2N0SB 3R3MA 4DWFA 3MHSA 4QRGA 2KDBA 1YLAA 2N9LA 3B08A 2KYWA 4G4QA 2PKOA 1BMLC 4MGIE 5IO9A 2P86A 3DBHI 3U6MA 1YJIA 4L78A 2WXGA 4HXDB 4ZRPA 1ZAEA 2MJEA 4J3OD 3RT3B 2W3SA 2FUDA 3B9JA 3GPPA 3H4MA 4AW4A 3KUDB 2Q5WD 3PVLA 3DHIC 2CB5A 1I4RA 4PI3A 2E6XA 2F5NA 3N20C 3A33B 5LNK1 1D0MA 2Z7JA 2KWCA 4WP2A 4JWSC 3EUB2 3KSEA 2JRHA 3H8HA 5EE0A 4GIVA 3IEJA 3A9JB 3HHWA 1Q3BA 2WDVB 4IG7B 5G5GA 1ZUD2 3UZUA 4ANRA 2BTEA 2QZ4A 3IG8A 1WGNA 2NQGA 1YQ3B 2WBFX 4W9EA 2KX0A 3TNXA 1FFVA 3U5ZA 3SATA 3AE2B 3QWLA 1SGHA 1DF0A 2G8JA 3DBSA 1KFYB 4YSZB 5FTLA 2UUCM 2ZAMA 3T8MA 1AU3A 4K7UA 1D5XC 1AECA 1FO4A 3CH3X 1ZE3D 1DO0A 4RGTA 4BVUC 1G6JA 2EO2A 1ZDXA 2MH7A 4CDEB 1K3BB 2MWSB 1DOYA 4OELA 3EIHA 4KDLB 2CUZA 1V1OA 3A9JA 4ICVA 2JTCA 2V1UA 1IBXA 2Z84A 3PVSA 1RRBA 3D32A 5IP4D 2JP7A 2AL6A 2RDGA 4KVGB 1JWUD 3RN9C 4K7SA 4WAAA 3I3TA 1D4BA 3GRVA 2KDLA 2N9EB 2NPTB 2H1RA 4XGAB 4EFOA 4LDTB 4DHJD 2GFOA 2K39A 1WMHB 2F5QA 2PLPA 2DAIA 4NC6A 2JUJA 3J7AS 3BY4A 2LGDA 1IXSB 2MBBB 3M63B 4G54A 3R7RA 3A98B 3VTWA 2R9CA 2OOBA 2KQ4X 4IJFA 3B7ZA 4RKUF 3QWZB 3VDZA 1WJUA 2PEAA 3L16A 1WYWB 4JE3B 4G4RA 2DJFB 3FD9A 1OQRA 3OJ3A 1YNTE 2DZIA 4JI8M 4LNIA 3BWKA 3V05A 1YUBA 2OEDA 4ZOHC 1N36M 1GLNA 2NPTA 3FUUA 1C79A 3V6CA 4DR6M 4IIWA 1UBIA 1WMHA 2BB6A 4ICUA 3VUWA 1WJNA 3SARA 1UM8A 5KQDA 4C4VB 2KRUA 2BWES 3THGA 3P1MA 1UUPA 3UI3A 2VRRB 3ECIA 1MIRA 4BOZA 4OZBA 2JU6X 3A46A 3HRDD 1UFZA 4JLCA 3DFZA 2M1MA 4C7YA 2L52A 2R46A 1F1HA 5HKHA 4E74A 1SXJC 1YVBA 5D2MB 1I94M 2HAKA 4JI3M 1F2CA 4PYUA 1WI0A 4ZYNA 2WHIA 2FYEA 1J7BA 1CB5A 1J7CA 1QZMA 3VAWA 2DAMA 2VZKD 1JQ4A 2V3SA 1RYJA 3QAQA 3Q8EA 2D3GA 1V97A 1QOLA 4XC2A 2HH5A 1OQYA 4I8OA 4MH8A 2Z59B 1MHXA 4RM8A 1QOGA 1MEMA 3UQBA 1NBFC 4MJSB 5ITYA 3GLGE 2PVOD 4PADA 4CDDB 4K7WA 1NL6A 1DGHB 3MHVC 4JWUC 2DJGB 3IVFA 2Z4RA 1ZQ9A 2LBCA 1EIJA 1TR8A 5FTNA 2INDC 3BVGA 3SYLA 1E8ZA 2ZM6M 3O13A 2Y5CA 1EO6A 4FIPA 3KLSX 1JMLA 1ZXIA 4W9KA 1PJIA 1QUSA 1XXHE 1WJ7A 5MPOA 4F8CB 3AE9B 1CV8A 3R7QA 4DXFA 4HJGE 1QILA 1XEEA 4LFBM 3PLUA 1FRRA 2E02A 2DC9A 3TJPA 3VTVA 2XK5B 3Q69A 3R8FA 3HHIA 1L4DB 1PCIA 1P7EA 2KVZA 1SBBB 1RU3A 5IT9S 1IXRC 5CHTA 3F92A 1E8XA 2DZKA 4M9XA 2O6VB 4Q2JA 1I42A 4I5SA 4Z6YA 4BOSA 4LGYA 4LRSA 4LRTA 2YNMD 2G6DA 2E3TA 2R62A 4LF4M 1WGGA 2NTSA 2RR9A 2XNAC 4L6V6 3QA8A 4DMXA 1J7AA 4NRWA 4P6EA 2D2QA 3AV0A 2PE9A 3LFYA 1E9MA 1CTEA 4M9ZA 4OVZB 2KX3A 4W9LA 2JT4B 3RULA 2N7JA 4B0MA 5CVOB 4FXCA 4IBEA 3GPXA 4US8A 3LVVA 5C1BA 1P9DU 2L05A 3U6CA 3APFA 2WXNA 2OP3A 1EWYC 2WX0A 2AUZA 3QSDA 2XEPA 3A45A 3GB1A 4XDDA 3L27A 2HCBA 5DCNA 2M56B 5DPWA 3R8BA 3P2BA 5DPTA 3H7DA 2K9DA 5KO3A 1IXZA 1XLOA 2JYTA 1KF6B 1RM6C 3FC4A 3F75A 1PFDA 3APCA 3ZJUA 1JROA 1EF1A 3J7BA 4Q8HA 2O01F 1NENB 3OAWA 3KXEC 2IO0B 2XEWA 2MP2A 2AU1A 4DBGB 4IM0A 4HWIB 4I04A 4EE2A 1HTQA 3SHQA 5H37D 4QOZC 2R44A 2J7QA 2YR0A 3P5WA 1JW9D 2BS2B 3UGJA 4NJ6A 4X6IA 4YYWA 1I4QA 1MVKA 1OFHA 1GAQB 2KMMA 5CVMA 5IREB 1TTEA 4JQWC 4IJEA 4BLCA 2IO2B 4YV8A 1C3TA 2KDMA 3HWSA 1PGBA 3VK7A 2KDEB 2R61A 2W54A 4KSKC 4IM3A 1E6EB 5AEKB 3AEAB 4JYAM 2ZTDA 1RLFA 4ZTBA 3OVZA 2JWZA 4I6NB 1SXJB 5E6OA 3GP7A 4W5CA 2MX2A 5LMNM 3ERVA 2AHMA 1BUIC 3OJ4B 4RGNA 3C9PA 3RNBC 2DC6A 1XCQL 2RGHA 2QCZA 3KWLA 1D6EC 1GO5A 2M0AA 4FK5A 4E71A 2BU3A 1OQQA 1FEHA 1NNUC 1WE6A 2IBIB 4FJZA 4IOIE 4GB9A 1K82A 4IKGA 5D3DA 1QVRA 4ANXA 4D82A 1V81A 3ZTDA 4DK5A 2FOIC 2OQ4A 1IN6A 3MC8A 1KRHA 2G9HD 2QMTA 4WURA 2LHDA 3HY5A 3NBIA 1ZP0B 1R4NI 2EKEC 2KJRA 3ZLZA 1WM2A 4EZJA 4HVBA 1NJGA 1SXJA 2ZANA 4ARCA 4YYUA 2ZAOA 4JI0M 5HG2A 3VFKA 1V1PB 1IBMM 4WWMA 3IFUA 3AB5A 4UN2B 4GC5A 4BZAA 3VK8A 4CJ6A 1K3WA 4X57B 4HCPB 3DHHC 2CE7A 3GE8C 2L32A 2P0RA 1WZ3A 1N5WA 4GMVA 3NVVA 5DYIA 3U2SC 3KKUA 2V1CA 3VUXA 2DZZA 2ZW1A 5JH5C 4BKSA 4PCZA 1P3QQ 1B9RA 2NQIA 2KXEA 3RGSA 4AZFA 2NVUI 5IKCM 4II2B 1NI3A 1OFFA 1XLPA 4RH6A 2RDHA 1MN3A 5DNYA 1JWAD 4ZRQA 5AUKA 1YE9A 4HKZE 2KWVB 3U6DA 1T5XD 4A90A 4M8NA 3ZXRA 3KOZE 4FN2A 2WGSA 2CV2A 2DI0A 4HKQA 3LMMA 3H9DA 3ZNGC 4TQ0A 1KOTA 3ENEA 4P1BC 2XFTA 3GLHB 3C0RB 5CHVA 3SASA 2WU2B 4XZ4A 1KLUD 2JVCA 4D8EA 3DA1A 4EEWA 3UMMA 1J19A 2O2VB 1L6UA 4BKSD 1LXDA 3AEEB 4LZJA 3AXCA 1EF7A 1H4RA 2F1GA 2CFOA 1E7PB 3WXFA 4KKIA 2KWUB 3T38A 4HEOA 2PREA 2JXTA 2KN4A 2IJ0A 1WXAA 1KYIA 1IN8A 2KT7A 5ITXA 3FILA 4ANUA 3MP2A 4FADA 1WR1A 4BPVA 3TWMA 2DLBA 3ZNHB 4LGMA 4M0DA 4X66M 1PRBA 4DV2M 1L0YB 4G50A 3NWLA 2IO3B 1L5PA 2CR5A 1PPDA 3Q8XA 5JI2E 4FBJB 3C0RA 4RM9A 3TIXA 1ATKA 3CF2A 2KDIA 3DWGC 2LGXA 3Q3FA 1CPJA 1GCBA 2QEJC 4WJQA 2UXCM 3L29A 2Y20A 2MW5A 4GIPA 1TZOA 3H7PB 2ZJDA 1UGMA 4ZPXA 3LXFA 2DBYA 5ITRA 2LVOC 1ACCA 2QCUA 1QLBB 1ZDVA 4GLSC 4AXMA 3AU4A 4P7IA 3K24A 3GE3C 2GBKA 5JH3A 5EXXA 5LLIA 1UBQA 3RFZB 1XKGA 4B7FA 2DZYA 2ACTA 2JPHA 2WWZA 3VH3B 3K9PB 4GDKB 1IUEA 2E5LM 1POPA 3P5VA 3DF0A 1OEYA 1STEA 1EWLA 3PRPB 3FRIA 3M7GA 3VDUA 3EECA 2W9NA 4J6IA 1D5ZC 4KKJA 4MSXA 2BJVA 2LHGA 4TUWA 3ZYYX 3BIID 2AYOA 3I4VA 1KLGD 2ZPYA 2XGNA 5EZQA 1ROEA 1FCLA 2M4NA 3K1JA 4G3OA 1Y4HA 3NG0A 2CKHB 1S3SA 1DOIA 2XU4A 1YOVB 3OQCA 5C23A 4X64M 2C5LC 2BF8B 3ZH9B 2VHFA 1BVSA 4FLHA 2HD5B 3X23A 4BOQA 2XH9A 3N32A 1KM7A 4GOCA 2IGHA 4OZCA 1MEGA 1PGXA 3AU5A 2C7NB 2DYMA 4IWQA 4EOYA 2BYTA 2P7UA 3B74A 2G7YA 2WSCF 1LFDA 2HJ8A 1TL9A 1ENFA 3GO8A 1CZPA 2DNFA 2KHHA 3Q14C 3W31A 2JZZA 3RUIB 3PNRA 2H89B 1N60A 3OWEB 4REZA 2J7NA 3U61B 3TL4X 3TL5A 1EWMA 4R71A 3GLFA 4FWDA 4G3XB 2EKFA 1SJED 2R9NA 2QQ8A 3DWMA 1C7YA 4BB9A 1Q10A 4DXGA 1E7VA 1T6OA 5L83A 2DCAA 1SNKA 4B6WA 2INNE 2J0JA 3AE6B 3RNGC 3FYDA 1P7FA 2LZ6A 3IT4B 3C3DA 1BY8A 3V6EB 4LF7M 3M3JA 1T43A 2Z4SA 1L2BA 1PUTA 5LXHA 1FNVA 1GLOA 2I7NA 1F2RI 1FXAA 3FE3A 2JRIB 4YSYB 2BPSA 4YYSA 1LQBA 3RGPA 3GLIE 4W9GA 3TWLA 4R7GA 2DWQA 2WXRA 3PNVA 3Q2AC 3HHXA 3DBLB 4KIKB 4LJ4A 5JZEB 5AUIA 4Y28F 4RGMA 1PVJA 2PW9A 1TF0B 1GJTA 3N3KA 2LXEA 3GS2A 3CIRB 1AIPC 1VEJA 2YQZA 2EELA 1G8PA 2LHCA 1ET6A 1Q0WB 3UQAA 1HE8A 3IT6B 4KZCA 2WXPA 1QDRA 4GHLA 1UKFA 3VVWB 2BDZA 1S3SG 3E46A 3VKGA 1U9WA 1H8CA 3LXSA 1IWDA 3PHUA 5J2RA 1SIFA 2WP9B 4DQOC 2JRIA 1TKYA 3A9KA 4TSSA 1TY2A 2C98A 1OIZA 2O5RA 3ETRA 1QAOA 4KODA 5HFYA 4FWGA 4IBFA 2XLJA 2KFKB 2OHFA 2PNSA 2KNAA 1MJGM 4DV6M 2RGOA 1K3XA 1OEYJ 1V6EA 1V5OA 2RGFA 3NUHB 3B7NA 5DYGA 2C96A 1JWSD 4HDQA 3P4PB 2KHWB 4L23A 5D7GA 4I6LB 1E8WA 2RDBC 5J18A 1JRPA 2EKKA 4G11A 4XX5A 1WJ6A 5L95C 4LF5M 3SHFA 2K0PA 1F2BA 3WAMA 4IBBA 4PS8A 4DR2M 3IG3A 2JZ3B 2CWBA 3BXWA 1VEKA 2V0GA 1AW7A 3DBRB 1WXQA 1WZ0A 2MJDA 4JI7M 3HX3A 2F5OA 3PRMB 5IWAM 2F7DA 4GU2A 4BAXA 1ISNA 2JY5A 2GBRA 1VJKA 3LQRA 3W30A 4O1NA 3RNCC 2D11A 1QDQA 4IUMA 3B21A 2F5PA 1R7SA 1IY0A 4B7HA 2I7PA 2N4FA 4QHTA 1D5MC 5IOIA 3VXWA 2IPPB 3TPZA 2LVOA 2IY1B 3IFWB 2CHZA 3VQIA 4L16A 2FQ9A 4DR1M 4ACFA 2LJ5A 3TCAA 5BMHA 3ZQ4A 3O0UA 2R6NA 4MSMB 4G6ZA 1DOXA 1ME3A 3KQ4A 3PZ8A 3K9MA 3T1YM 5D3IB 4NY0A 1N34M 1WY8A 1WM3A 3TEWA 1C77A 3HJQA 1NHGC 1YN5A 1IBKM 4RY2A 4BBNF 2CHXA 3R2IA 3PHXA 5JHAA 3T3OA 3DHGC 3VLFB 3SBJA 2BYEA 2Y0TA 3IMAA 4P1CC 1MPEA 2R0IA 1TZ1A 2XU5A 2PPHA 2C0YA 3HM3A 4N59A 3N9YC 1GVNA 3C58A 4MZOA 1L2DA 1FNWA 1R6BX 3SFEB 1C4AA 1UF0A 2CS4A 1SSNA 1U9VA 2H5XA 3FTEA 5FTMA 3U5ZB 5BYRA 4RGOS 1ZMWA 4PDIA 3H6SA 2L3ZA 3B79A 2DZNB 2MBHA 4OU7A 1OKSA 3KH0A 1PJQA 1WX8A 3NZ3A 4BOSC 1M4VA 1N63A 4W9FA 2JSVX 1WHCA 1IN5A 3J81S 2JNHA 1AWDA 1YQBA 3AULA 4YHHM 2LNHC 3U7DA 4X62M 2MROB 1V2YA 4IWOA 2JQFR 4FWHA 5EP1A 4URKA 3KVFB 3K8UA 4TV3A 3NBXX 5KHOA 3SD5A 2AGAA 1IBXB 4LF6M 2L8JA 4JI1M 2UUBM 1G3IA 3KVWA 3LCUA 4AKHA 1C4PA 2KJHB 2WDRB 1KHQA 3I3TB 3GLGB 5T8IA 2V3PA 4A3PA 4W9HA 4X65M 2KNBA 5KPTA 4NRVA 4GITA 1E94E 1KJTA 1ZIVA 1HT2E 1ZV1A 5GXGB 2VQEM 2CU3A 1C76A 4GKKM 3BY4B 2XN9C 5CTRC 1WWTA 2BYFA 1MHHE 2FAZA 2KMCA 2OOBB 3IXSA 4NAWA 2L83A 2N7EA 1CS8A 2DX5B 1WXSA 1BQIA 4EIWA 4US9A 3JR5A 2QBYA 4LF9M 1TT5B 3A1QA 2Z3XA 1FRDA 4YYRA 3GLGA 4I6PA 2J7QC 5FPWA 2KQSA 3V6CB 3GPYA 2ZNVC 1NYQA 3FKYA 1TS2A 4I07A 5LMUM 2FCSA 2YJ2A 4XYCA 2ZPNA 1NY6A 1FMAD 3RMKC 4BOZB 3BBZA 2IPKD 5D94A 2G8LA 4K3BA 3OF8A 2D7GA 1XXHA 3KWVA 4I05A 4X6JA 1MHWA 2QIEB 2D07B 5C1ZA 2ZTCA 4FA6A 4ZRJA 5ITUA 3ALBA 2C9OA 4N9F4 1TU6A 1YMHE 2VH1A 3U52E 1OTRA 1UWXA 3BZDB 2MCNB 4II3B 3WAPA 1W5TA 4BBNC 4B3RM 5CHFA 1TS5A 2D7EA 1KLVA 2HXZA 2DHRA 1WRIA 1E5WA 2Y6EA 4K0KM 3RD2A 1TY0A 1PPOA 2WS3B 4MELA 1HUCB 4YY3M 5BMIA 4LJ6A 2N1VA 3DVNV 5C18A 2AYNA 2GOWA 1JB0F 4ZHPA 2K8CA 3ZKJC 3PO0A 2KJ6A 4MGKE 2CRUA 2M5ZA 3AI5A 3R9XB 1RWSA 1PYWD 1VZ7A 4DXAB 3UK6A 3L10B 3RCZA 1T0YA 2LRWA 4KV2A 4BKGA 3Q8FA 2QP9X 2BTWA 1Q5WB 4GGQA 2LHEA 4GDLA 1WX7A 4LFAM 3AMZA 2CV0A 1YALA 1XMOM 1VCBA 2DAKA 3KX1A 3U6OA 1AIMA 2ASQA 2K8HA 4IW0A 3CSFA 2KOXA 3MTNA 3H6NA 4MH0E 4YVAA 3E4RA 2XFSA 2ZCCA 1Z59A 2LXCA 4JIOU 4OHJA 4PYZA 2VQFM 4MB7A 3Q3NC 4KGTA 3LB8C 2SEBD 1EM7A 1IY2A 3WXGA 2JA2A 3OLMD 3PHWA 5I4DA 2HWKA 3C19A 4AXLA 1G4AE 2KD0A 3WHKA 5FR6A 2CJOA 4PD2A 5CHVC 3UJNA 1UD7A 4B0EA 1KFUL 2PADA 2XU1A 2IY0B 2FCNA 3SAVA 3I4YA 1PPNA 2KANA 4HK2A 1WX9A 1XO3A 1NLJA 1YN4A 4RMAA 2ARYA 2JY8A 1N78A 3UF8A 2X49A 2WXHA 4FD2A 3QARA 4I4LA 1DEUA 1MI0A 2YEPB 3PT2A 2DHZA 5DFLA 3LCVB 4EUTA 2WSEF 1Y56A 2QSFX 1TIFA 2R2OA 1V34A 3MORA 4KDIC 3FRHA 2E00A 1CMXB 2DENA 2MP2B 3Q8GA 1HXYD 4KO8A 4JI5M 2WXMA 3QYEA 1EWOA 2WX1A 3R2TA 4FULA 1WXMA 4XZXA 2RPVA 2J7QB 4N79A 2K8BA 3L25A 2ZNVB 5IN7A 1L2CA 1F2AA 4BOUA 1I7HA 1KH0A 3P42A 2L2DA 3IOQA 2OOAA 3MHZA 1V49A 1STFE 5JI3E 2H88B 1UWMA 1IN4A 5BYSA 1A5RA 1ORYB 2BJWA 1OAOC 1TH2A 2AWTA 4CYEA 3K2LA 1GECE 2DCCA 2KLGA 4G4OA 4A8XC 2KW0A 1RFAA 3W5VB 1YK7A 3U60A 2LASA 1BGOA 3LQQA 3MJ5A 4GMQA 3P4QB 2BNKA 2EMSA 4F2LA 3P63A 4LJOB 8PCHA 1I4WA 1SE9A 2FNJB 3PXGA 5ITTA 2JY7A 1SEBD 1Z2MA 1XLNA 1WGDA 4C00A 4QNRA 1WGKA 2DYBA 2CJNA 7CATA 2XZUA 4WIPA 5G55A 4QH6A 3SMPA 4MSQB 2KK8A 1O0EA 1MX0A 3H7SA 4DV5M 1P1AA 3T6PA 4F7ZA 2L76A 2W3RA 2YVCA 3RNAC 2I2YA 2L00B 2CHGA 4AI6A 1QYRA 1PADA 1SE2A 4DHZE 4XUIA 1HQCA 2C9CA 2UU9M 3QJ3A 3OG5A 1PPPA 1PGYA 4QHSA 3DOWA 3B9PA 3KUCB 4GKJM 1YT7A 3SAUA 3T9LA 1G71A 3QIJA 3KWBX 2O6VD 4GEWA 2OJRA 1SIJA 1CVZA 2ONQA 1EUVB 3DVGY 4FW9A 4W5WA 3CF0A 2V6ZM 2ZCBA 4JI4M 2AX5A 3U6QA 3OVXA 1N5XA 2NS5A 2NQAA 2RPQA 1J0GA 1DYQA 3AE5B 3TMPB 1UZXB 2YJ8A 2L7IA 3AOGA 2G4SA 4D8BA 4XGIA 4DMYA 4HCNB 3OF9A 4NOOB 1NV9A 1JQJC 4LJ7A 3ZDTA 2J7OA 3I5JC 4MI7A 3IAS1 1D3ZA 2J52A 1ZGUB 1GPXA 2FNAA 1C78A 2J0KA 2FFJA 2F4VM 3MTVA 1EF5A 4GC9A 2ON8A 2WLBA 4WW0A 2XZFA 1L4ZB 3T1HM 3CTWB 1VQ1A 1IFYA 1E9SA 4G4NA 1T3QA 2V3NA 1JCKB 3WIMA 1EWPA 3HVZA 4HPPA 2ACZB 3FTCA 2WXFA 3S2AA 5IZ7D 4BOPA 1NYRA 4XWWA 4ASWC 4CDFB 1WF9A 4PP1A 1GJZA 1C1KA 3TMPA 1V9JA 1SJHD 4AWJA 2NBWB 2E03A 4BFRA 4XK8F 3BPMA 4B7GA 2VF7A 4WWNA 3FILB 2QHOA 4YYQA 4DUZM 4AP4C 1WR1B 3QAUA 3RI7C 4YL8A 3H4JA 3ML8A 4M02A 1LV7A 3EGRA 5TSSA 3WCQA 4XBOA 3P4RB 5EE3A 5K16A 2J5YA 1CJLA 2YJ9A 4NQKE 1XB2B 3ZNID 2I1KA 3IV2A 1EFUB 2YFQA 4ANWA 5J94A 2BKRB 2PJHA 4LZZA 2ZVOA 4DUYM 3I63C 1E9RA 3KS8A 4IBKA 2UWQA 3S3QA 1D2NA 1NHWC 2FIDA 3N4CA 3CBJA 5A2QS 2A4ZA 3GZNB 5JXVA 3D8BA 4DDID 3Q3OC 3DPDA 1IP9A 3CF6E 3FYCA 4NXMM 4QRXA 1EE8A 4AQYM 1VZ8A 5KPRA 1BP4A 3N1YC 2FRAA 3KWZA 4QRVA 3DVGX 4P16A 3ZCBB 4ZUXU 1GKIA 2FBWB 3NVWA 4JI6M 1PDXA 2DZJA 3VRBB 3W0LB 3VHTC 2LI5A 3H8CA 1GG3A 3Q8BA 2LGIA 1IGCA 2KRKA 3L4PA 3H8BA 2AEHA 1V8CA 3R66C 2AYOB 4OVVA 4A3VB 1NNJA 4OW0A 4A5UA 1MJDA 4C56C 4HLQA 3EFCA 3TEZA 4D81A 2OULA 1QT9A 3BK2A 2NTTA 3AE4B 4AKIA 3AH7A 2MBQA
chains in the Genus database with same CATH topology
1JR3A 2B76B 3ZGZA 1T3TA 3GLIA 2LMCA 5EP3A 3SHGB 1GL7A 2FE8A 2LFIA 3GLFB 3VRAB 3KSJA 1HQYE 1NJFA 2WQYB 2V4IB 1I4GA 3VR9B 4L8RC 4MGYE 3AE1B 1JR3D 3AM9A 4YSXB 2C5RA 3VKHA 4TQ1A 4L2YA 4Z8XA 3BVZA 1JWBD 4LK0M 4ITQA 3LVWA 3K92A 3RFWA 1XLQA 2WNMA 1ZXHA 1HT1E 3IAM1 2EKIA 3W2DA 1TJEA 2DWNA 4PT5A 5EQTA 8CATA 2KACA 1L8QA 1KTKA 2M19A 3BK1A 3MK6A 3ZJVA 3D8LA 4NSOB 2BB5A 1TDZA 3O65A 2K9XA 2DVWB 3I51A 1XMQM 4RNAA 4PDGA 2ICIA 1VR9A 3AE3B 1SE4A 3FTDA 3U6SA 3AJIB 3AE8B 2Y3AA 2J42A 3AOEA 2R45A 1J7KA 5HHDG 3E56A 1XNQM 4DR7M 2HDEA 2YEPF 5FR3A 5KPZA 1KSFX 1VDDA 4CHTB 4YWGG 2AQ3B 3ZC7B 1Q3CA 3HUIA 3HJ8A 5FTKA 1TS3A 2UXDM 1EU3A 4KGRA 3PSEA 1Z5CA 4XE0A 5EE9A 4M0WA 5ITQA 1TH3A 1WYGA 3U6LA 1FNUA 3RPFC 2DWZB 3OTOM 3ILKA 3U6PA 1IBLM 3SR6A 5H92C 2Y0QA 1Z5AA 3TRKA 1NVMA 3KOWE 4WQMA 2WXOA 4CGYB 3PZ7A 2NMQA 4IBCA 1G41A 3TSSA 3P4SB 3V3XA 4IDIA 1FD6A 1T6BX 3J27B 4AS1A 2BT6A 1F77A 1G59A 2ERCA 1L0XB 3IG5A 1QKZA 3HGIA 4DV1M 3TEXA 3SFDB 1PGAA 3W1SA 1IM2A 1TGUA 2XSZD 2JX5A 1Q39A 1OFIA 5FTJA 1TS4A 3U6EA 4JXJA 3GQ4A 1GB4A 5EZSA 4QNMA 4B3MM 5E6JA 2NQ8C 4RCOA 4LJAA 3AFHA 4NAWB 5EXSA 1TKGA 2DZOB 1PJJA 3FUWA 3EA6A 2QBYB 3L28A 2UZJA 4ITKA 1VLBA 2IGDA 4HROA 3AKZA 3KW6A 1CJEA 4R3DA 3HKPA 2UXBM 1L0VB 1XXHB 4OZAA 2KA6B 4CISA 1NY5A 1ZOYB 1F0ZA 3AEBB 2VZKB 2WXJA 4JI2M 1QF6A 1QANA 2QSDA 1YSYA 2CEAA 3L26A 2KZUA 4FCTA 2RMMA 1R2YA 1QAQA 1QQWA 2FUG1 1QOFA 2JZPA 1XHBA 4L15A 5BPVA 1DGJA 1QOBA 3KP1E 3FTFA 5G5HA 1GB1A 1E32A 3AEDB 4AG6A 4YTPB 2EUCA 1QAMA 5GKNA 4AKGA 4N6EB 1NEKB 4JPSA 1FFUA 2BTWB 4DV4M 4GDLB 3HVDA 4D80A 2WXLA 3Q8CA 3GRYA 2BS3B 3TE6A 3EIEA 2MJ3A 4L1BA 2DWLA 2WXIA 2X8AA 1I4HA 1JWMD 3BVMA 4WAFA 3HU1A 2D5GA 1VRAB 3MC0B 3SYKA 3W0FA 2KWDA 2JWUA 3HHZA 1R7RA 2MEKA 4LLGM 1E0ZA 1KFVA 4LFCM 1HQRD 2DYOA 1N62A 2C99A 1XCTL 4L4UA 5F3WA 3TWKA 3NVZA 2X38A 1IQPA 5EXTA 2LUMA 4LY6A 2QPAA 1JALA 3M6AA 3TQSA 2CHQA 3BBAA 3W5UB 2W55A 1TH4A 4S12A 3BB7A 3SEBA 3B2GA 4C80A 3KOYE 2LJIA 3MP9A 4LG2A 1HZ6A 3WHLA 3AEFB 3FKEA 4IBDA 2HTME 1DGHA 3Q8AA 5E26A 2N9KA 4UDUC 1B1ZA 1TYGB 3U60B 2F5SA 3PFIA 2K22A 1QQRA 3HJSA 4ARIA 1AYFA 4LCBA 4YXDB 1FM0D 1K50A 1K51A 3CWIA 4D2KA 1J5EM 5EE1A 4IBGA 1N61A 2QENA 1Z5BA 2DOSA 1L1ZA 1RFKA 2WDQB 4RF0A 3AEGB 2L6OA 3FUVA 4N58A 4FVMA 4XDCA 2L1AA 4NJCA 4RFBA 4NAMA 3NVYA 2LEKA 3KS4A 3BOSA 3PNYA 4JV5M 2J53A 3C8YA 2EA0A 4DV0M 3LYYA 2DWMA 4C7ZA 4OVZA 3GPUA 2K5PA 4DR5M 5EXPA 2Y21A 3GRRA 3ZJTA 4A6QA 4DV3M 4RKXA 3VR8B 4II7A 3GP1A 1HNXM 2R4EA 2GI9A 2K47A 4FCVA 2Y5PA 1TDHA 3JR4A 2BS4B 2PMVA 3VFDA 3L2AA 1DKIA 1FJGM 1XXGA 4I81A 3DOAA 4RF1A 1FIQA 3HU2A 4MM3B 3HHYA 4LTUA 1CK1A 4DV7M 1FXIA 1YN3A 2Z8LA 2GRIA 3BYYB 5C2TB 2R4JA 4ZHOA 1X37A 2GB1A 2LH0A 1HA5A 1TKEA 3ABVB 2PVGC 1HNZM 3GRUA 3KDSE 1HZ5A 3T15A 2K3UA 4AG5A 1OJLA 2CV1A 2BW2A 3U4EG 4GRIA 3AECB 3KFUG 4OX9M 4NZLB 3KSXA 3BYTB 2D7HA 5FKAC 3AOEC 2X4AA 5H8YE 2QILA 1L1TA 1N33M 2WU5B 4FCWA 1V1PA 1SF0A 1IN7A 1H6UA 1XC8A 3I9V1 1SXJD 1GL6A 2M60A 2WXKA 1WSPA 3RE8A 1SB3C 5FSWA 2AQ2B 4AQ7A 2VIIA 4A9AA 4LJ5A 3GQ3A 1EU4A 4HEA1 1F2RC 2KZSA 3BWUD 2KEBA 1EWCA 4KHPM 3GLIB 2A5YB 1FNNA 1R2ZA 2ZBKB 1ESFA 3TUOA 4NXNM 1ZPSA 4IP3A 1XF5L 2UUAM 4JX1C 3VDPA 1SXJE 1N75A 4KLNA 3T3NA 3DZDA 2J4XA 5HI1A 3GLHA 2P5TA 2OPFA 5BR8M 3A42A 4GUAA 1YJJA 4YTNB 2IDYA 4H2AA 4P6VF 1SXTA 4LJ9A 1BXTA 2BBCA 1VDVA 2HHHM 2PTLA 4XWTA 3ZNHA 3SAWA 5EP2A 3I57A 3AL0C 1L6VA 3KOXE 5BYQA 1LO5D 1YZBA 4IBIA 2DXIA 1PM5A 1A70A 2R18A 5C3JB 4GHAA 2W82A 4B3SM 2R65A 1W5SA 3AV8A 1AN8A 5KQ8A 1NSFA 3KP0E 3RNVA 3TEYA 1N77A 1N32M 1Z6TA 4HL4A 1MU5A 1I4XA 5ITXE 3K8ZA 4B3TM 3PRPA 2TSSA 1DGBA 2HKJA 1ET9A 3NS1A 1CQVA 4USAA 3U7ZA 2AQ1B 3AN1A 3SMSA 1XWIA 1FCCC 1C9FA 1K52A 2QJLA 4KGSA 4HRSA 4MGZE 5EJCA 4YTMB 4JN6A 1IY1A 4M9SA 2LWXA 3MFGA 4YT0B 3J2PB 4NL4H 4GH9A 3J9CA 2L09A 4BBAA 1VZ6A 1DO2A 1HR0M 4NSRA 4LJ8A 1SE3A 1C4CA 3NRZA 2Q2EB 3U61A 1DGGA 3B2FA 3HU3A 2SAKA 2RKOA 5BMGA 3J80S 3SFZA 2HL7A 4A55A 4CQNA 3E9SA 4MT5A 3SC3A 2I38A 5FK9C 3FUXA 1HNWM 5JZEA 2XF3A 1HEZE 2WXQA 1NVID 2PIAA 1E10A 4DR3M 2CHVA 4DR4M 1QOAA 5EP4A 1DGFA 2JYEA 5FLXS 3M0EA 2IGGA 3JAMS 1IGDA 2JQRB 4ZYSA 2G5GX 4MGHA 1UGJA 2XSZA 1GOZA 4B08A 3W9CB 3FAHA 2ZW0A 2INPE 4KX6B 1K53A 1YQ4B 2L7HA 4TMAB 2G1EA 4IBJA 1XNRM 1UNSA 4LF8M 3FUTA 3URYA 1I4PA 2KAJA 3PRMA 4WH4A 4QOSA 3AE7B 4MACA 1J09A 3GQ5A 4D8IA 2N0SB 2N9LA 4G4QA 2PKOA 1BMLC 4MGIE 3U6MA 1YJIA 4L78A 2WXGA 4HXDB 4ZRPA 1ZAEA 2MJEA 4J3OD 2W3SA 3B9JA 3GPPA 3H4MA 4AW4A 2Q5WD 1I4RA 2E6XA 2F5NA 5LNK1 2Z7JA 4JWSC 3EUB2 3H8HA 5EE0A 3HHWA 1Q3BA 2WDVB 5G5GA 1ZUD2 3UZUA 2BTEA 2QZ4A 3IG8A 1YQ3B 1FFVA 3U5ZA 3SATA 3AE2B 3QWLA 1KFYB 4YSZB 5FTLA 2UUCM 2ZAMA 1D5XC 1FO4A 1ZE3D 1DO0A 4RGTA 2EO2A 1ZDXA 2MH7A 1DOYA 3EIHA 1V1OA 2CUZA 2JTCA 2V1UA 1IBXA 2Z84A 3PVSA 2RDGA 1JWUD 1D4BA 3GRVA 2H1RA 2F5QA 2PLPA 3BY4A 3J7AS 1IXSB 3A98B 2KQ4X 4IJFA 4JE3B 4G4RA 3FD9A 1OQRA 1YNTE 4JI8M 3V05A 1YUBA 2OEDA 4ZOHC 1N36M 1GLNA 3FUUA 1C79A 4DR6M 4IIWA 2BB6A 3SARA 1UM8A 5KQDA 2KRUA 3THGA 3P1MA 1UUPA 3UI3A 4BOZA 4OZBA 2JU6X 3A46A 3HRDD 3DFZA 4C7YA 2L52A 2R46A 1SXJC 1I94M 4JI3M 1J7BA 1J7CA 1QZMA 1JQ4A 2VZKD 1RYJA 3Q8EA 1V97A 4I8OA 4MH8A 1MHXA 1QOGA 5ITYA 2PVOD 1DGHB 3MHVC 4JWUC 2Z4RA 1ZQ9A 5FTNA 3BVGA 3SYLA 2ZM6M 3O13A 2Y5CA 3KLSX 1JMLA 1ZXIA 1PJIA 5MPOA 3AE9B 4DXFA 4HJGE 1QILA 1XEEA 4LFBM 1FRRA 3Q69A 3R8FA 1L4DB 1P7EA 1SBBB 5IT9S 1IXRC 4M9XA 4Q2JA 4I5SA 4Z6YA 4BOSA 4LGYA 4LRSA 4LRTA 2YNMD 2E3TA 2R62A 4LF4M 2NTSA 2XNAC 1J7AA 4NRWA 3AV0A 1E9MA 4M9ZA 4OVZB 4B0MA 2N7JA 4FXCA 4IBEA 3GPXA 4US8A 3LVVA 5C1BA 3U6CA 2WXNA 1EWYC 2XEPA 3A45A 3GB1A 4XDDA 3L27A 2HCBA 2M56B 3R8BA 5KO3A 1IXZA 1XLOA 2JYTA 1KF6B 1RM6C 3FC4A 1PFDA 3ZJUA 1JROA 3J7BA 1NENB 3KXEC 4EE2A 5H37D 4QOZC 2J7QA 2YR0A 1JW9D 2BS2B 3UGJA 1I4QA 1MVKA 1OFHA 1GAQB 2KMMA 5IREB 4IJEA 4BLCA 2KDMA 3HWSA 1PGBA 3VK7A 2W54A 2R61A 1E6EB 3AEAB 4JYAM 4ZTBA 1SXJB 3GP7A 5LMNM 2AHMA 1BUIC 4RGNA 1XCQL 2RGHA 3KWLA 1D6EC 2M0AA 2BU3A 1OQQA 1FEHA 1NNUC 4IOIE 1K82A 4IKGA 5D3DA 1QVRA 4D82A 2FOIC 2OQ4A 1IN6A 1KRHA 2G9HD 2QMTA 4WURA 2LHDA 3NBIA 1ZP0B 1NJGA 1SXJA 2ZANA 4ARCA 2ZAOA 4JI0M 5HG2A 1V1PB 1IBMM 4WWMA 3IFUA 3AB5A 4GC5A 3VK8A 1K3WA 2CE7A 2L32A 1N5WA 3NVVA 5DYIA 3U2SC 2V1CA 2ZW1A 4PCZA 1B9RA 2KXEA 3RGSA 4AZFA 1NI3A 1OFFA 1XLPA 4RH6A 2RDHA 5DNYA 1JWAD 4ZRQA 5AUKA 1YE9A 4HKZE 3U6DA 1T5XD 4A90A 3KOZE 2CV2A 4HKQA 3LMMA 4TQ0A 2XFTA 3GLHB 3SASA 2WU2B 1KLUD 4D8EA 3DA1A 3UMMA 1L6UA 3AEEB 4LZJA 2CFOA 1E7PB 4KKIA 3T38A 2JXTA 2KN4A 2IJ0A 1KYIA 1IN8A 3FILA 5ITXA 3MP2A 3TWMA 2DLBA 4LGMA 4M0DA 4X66M 4DV2M 1L0YB 3NWLA 1L5PA 3Q8XA 5JI2E 3C0RA 3CF2A 3DWGC 2QEJC 2UXCM 3L29A 2Y20A 4GIPA 1TZOA 4ZPXA 3LXFA 2DBYA 5ITRA 1ACCA 2QCUA 1QLBB 1ZDVA 4GLSC 5EXXA 3RFZB 4B7FA 4GDKB 1IUEA 2E5LM 1STEA 3M7GA 3VDUA 1D5ZC 4KKJA 2BJVA 4TUWA 3ZYYX 3BIID 3I4VA 1KLGD 2XGNA 5EZQA 1ROEA 1FCLA 3K1JA 1S3SA 1DOIA 3OQCA 4X64M 3ZH9B 4BOQA 2XH9A 2IGHA 4OZCA 1PGXA 2DYMA 2BYTA 3W31A 3GO8A 1CZPA 1ENFA 2H89B 1N60A 3OWEB 4REZA 2J7NA 3U61B 3TL4X 3GLFA 4FWDA 1SJED 3DWMA 4BB9A 1Q10A 4DXGA 2INNE 3AE6B 3FYDA 1P7FA 3IT4B 4LF7M 2Z4SA 1L2BA 1PUTA 1FNVA 2I7NA 1F2RI 1FXAA 4YSYB 3RGPA 3TWLA 4R7GA 2DWQA 2WXRA 3PNVA 3HHXA 4LJ4A 5AUIA 4RGMA 1PVJA 2PW9A 2LXEA 3GS2A 3CIRB 2YQZA 2EELA 1G8PA 1ET6A 3IT6B 2WXPA 4GHLA 1UKFA 3VKGA 3PHUA 2WP9B 4DQOC 2JRIA 1TKYA 4TSSA 1TY2A 2C98A 2O5RA 3ETRA 5HFYA 1QAOA 4KODA 4FWGA 4IBFA 2XLJA 2OHFA 4DV6M 2RGOA 1K3XA 3NUHB 5DYGA 2C96A 1JWSD 3P4PB 4L23A 5D7GA 1JRPA 4LF5M 3SHFA 2K0PA 4IBBA 4DR2M 2V0GA 1AW7A 1WXQA 2MJDA 4JI7M 2F5OA 5IWAM 1VJKA 3LQRA 3W30A 4O1NA 4IUMA 3B21A 2F5PA 1R7SA 1IY0A 4B7HA 2I7PA 4QHTA 1D5MC 3TPZA 3VQIA 4L16A 4DR1M 5BMHA 3ZQ4A 4G6ZA 1DOXA 3KQ4A 3PZ8A 3T1YM 5D3IB 1N34M 3TEWA 1C77A 3HJQA 1NHGC 1YN5A 1IBKM 3R2IA 3PHXA 3T3OA 3VLFB 3SBJA 2Y0TA 1MPEA 4N59A 3N9YC 1GVNA 3C58A 1L2DA 1FNWA 1R6BX 3SFEB 1C4AA 1SSNA 3FTEA 5FTMA 3U5ZB 5BYRA 4RGOS 4PDIA 2DZNB 4OU7A 3NZ3A 1M4VA 1N63A 2JSVX 3J81S 1IN5A 1AWDA 4YHHM 2LNHC 4X62M 4FWHA 5EP1A 2AGAA 1IBXB 4LF6M 4JI1M 2UUBM 1G3IA 3KVWA 4AKHA 1C4PA 2WDRB 3GLGB 5T8IA 2V3PA 4X65M 5KPTA 4NRVA 4GITA 1E94E 1HT2E 5GXGB 2VQEM 2CU3A 1C76A 4GKKM 2XN9C 1WWTA 1MHHE 3IXSA 2L83A 4EIWA 4US9A 3JR5A 2QBYA 4LF9M 2Z3XA 1FRDA 3GLGA 2J7QC 3GPYA 1NYQA 1TS2A 5LMUM 1NY6A 1FMAD 2IPKD 2G8LA 2D7GA 1XXHA 3KWVA 2QIEB 5ITUA 2C9OA 1YMHE 3U52E 1UWXA 3BZDB 1W5TA 4B3RM 1TS5A 2D7EA 2DHRA 1WRIA 4K0KM 1TY0A 2WS3B 4YY3M 5BMIA 4LJ6A 5C18A 4ZHPA 3PO0A 4MGKE 2M5ZA 3R9XB 1RWSA 1PYWD 1VZ7A 3UK6A 3Q8FA 2QP9X 2BTWA 2LHEA 4LFAM 3AMZA 2CV0A 1XMOM 3U6OA 4MH0E 3E4RA 2XFSA 1Z59A 4OHJA 2VQFM 4MB7A 4KGTA 3LB8C 2SEBD 1EM7A 1IY2A 2JA2A 3PHWA 5I4DA 2HWKA 1G4AE 3WHKA 2CJOA 4PD2A 3UJNA 4B0EA 3SAVA 3I4YA 1XO3A 1YN4A 1N78A 2X49A 2WXHA 4FD2A 4I4LA 1MI0A 2YEPB 3PT2A 1Y56A 1HXYD 4KO8A 4JI5M 2WXMA 3R2TA 4XZXA 2RPVA 3L25A 1L2CA 4BOUA 1I7HA 1KH0A 3P42A 3MHZA 5JI3E 2H88B 1UWMA 1IN4A 5BYSA 1ORYB 2BJWA 1TH2A 3K2LA 4G4OA 4A8XC 2KW0A 3W5VB 3U60A 3LQQA 3MJ5A 4GMQA 3P4QB 2BNKA 3P63A 1I4WA 3PXGA 5ITTA 1SEBD 1XLNA 4QNRA 1WGKA 2CJNA 7CATA 2XZUA 4WIPA 3SMPA 1MX0A 4DV5M 2W3RA 2I2YA 2CHGA 4AI6A 1QYRA 1SE2A 1HQCA 2C9CA 2UU9M 4QHSA 3B9PA 4GKJM 3SAUA 1SIJA 2ONQA 4FW9A 4W5WA 3CF0A 2V6ZM 4JI4M 2AX5A 3U6QA 1N5XA 1DYQA 3AE5B 2L7IA 3AOGA 4D8BA 4XGIA 4NOOB 1JQJC 4LJ7A 4MI7A 2J7OA 3IAS1 2J52A 1GPXA 2FNAA 1C78A 2FFJA 2F4VM 3MTVA 4GC9A 2ON8A 2WLBA 4WW0A 2XZFA 3T1HM 1L4ZB 3CTWB 1E9SA 4G4NA 1T3QA 2V3NA 1JCKB 3HVZA 2ACZB 3FTCA 2WXFA 5IZ7D 4BOPA 1NYRA 4XWWA 1C1KA 3TMPA 1SJHD 4B7GA 3FILB 4DUZM 3QAUA 1LV7A 3EGRA 5TSSA 3WCQA 4XBOA 3P4RB 5EE3A 2YFQA 4LZZA 4DUYM 1E9RA 3KS8A 4IBKA 1D2NA 1NHWC 5A2QS 5JXVA 3D8BA 3CF6E 3FYCA 4NXMM 1EE8A 4AQYM 1VZ8A 5KPRA 4P16A 3ZCBB 1GKIA 2FBWB 3NVWA 4JI6M 1PDXA 3VRBB 3W0LB 3Q8BA 2LGIA 1IGCA 2KRKA 3L4PA 1V8CA 4A3VB 1NNJA 4OW0A 4A5UA 4C56C 4HLQA 3TEZA 4D81A 1QT9A 3BK2A 2NTTA 3AE4B 4AKIA 3AH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MM3 B;  3MJ5 A;  4R3D A;  3MP2 A;  5KO3 A;  5E6J A;  4RNA A;  4M0W A;  4PT5 A;  4OW0 A;  3E9S A;  2FE8 A;  4WUR A;  4OVZ B;  4OVZ A;  4RF0 A;  4REZ A;  4P16 A;  4RF1 A; 
#chains in the Genus database with same CATH topology
 1PQS A;  1JR3 A;  2M0X A;  3I06 A;  2B76 B;  2JY6 A;  2NBU A;  3ZGZ A;  1T3T A;  1GC6 A;  3GLI A;  3QK0 A;  2LMC A;  2LVQ D;  3PRE A;  2A5U A;  2DNA A;  2DC8 A;  5EP3 A;  3SU8 X;  3U8Z A;  7PCK A;  2LTU A;  3SHG B;  1GL7 A;  1GUA B;  2N35 A;  1HJP A;  2FE8 A;  2LFI A;  3RVW A;  4HLE A;  4HWY A;  3GLF B;  3VRA B;  1SG9 A;  3KSJ A;  1P0R A;  1HQY E;  1NJF A;  2WQY B;  2V4I B;  1I4G A;  3VR9 B;  2V9H A;  4L8R C;  1AYU A;  5L8R F;  4MGY E;  3AE1 B;  1JR3 D;  3AM9 A;  1T0R C;  4YSX B;  2C5R A;  3VKH A;  4TQ1 A;  2D10 A;  2HWJ A;  2LGY A;  4L2Y A;  4Z8X A;  2HHN A;  5D6J B;  3CMM B;  3BVZ A;  4WJN A;  1JWB D;  4LK0 M;  4ITQ A;  3LVW A;  3K92 A;  1P98 A;  3O65 B;  3RFW A;  1XLQ A;  2WNM A;  2WYQ A;  1VDL A;  1WGY A;  1ZXH A;  1HT1 E;  1J8C A;  3N3K B;  4KLB A;  3IAM 1;  1ITO A;  3B1L X;  1U4A A;  2EKI A;  3W2D A;  1PXV A;  1TJE A;  3ZTC A;  2QC8 A;  3ZRF A;  1AUA A;  2C60 A;  1T0S C;  3DBL I;  3GLH E;  3CBK A;  2DWN A;  1NV8 A;  4PT5 A;  1ZKH A;  5EQT A;  3Q3M C;  8CAT A;  2KAC A;  3ZVV A;  1L8Q A;  1F9J A;  1JR3 E;  1KTK A;  1ZW7 A;  2M19 A;  3BK1 A;  3MK6 A;  3ZJV A;  3D8L A;  4NSO B;  3V76 A;  2BB5 A;  3A9K B;  1TDZ A;  2LUE A;  1TLO A;  3O65 A;  2R9M A;  2K9X A;  2H7J A;  2DVW B;  1QDT A;  1T0Q C;  1FH0 A;  2L7R A;  1QUT A;  4DDG D;  1Z5S B;  3B7Q A;  3I51 A;  2N1W A;  4WWO A;  1ME4 A;  4B9K A;  1VG5 A;  1XMQ M;  4RNA A;  4QBB A;  4PDG A;  2ICI A;  2NQD B;  1VR9 A;  3AE3 B;  1SE4 A;  2AVW A;  2NR2 A;  3FTD A;  2R9O A;  3U6S A;  2DCD A;  3U30 A;  1SP4 B;  3M99 A;  3AJI B;  3AE8 B;  4FHJ A;  4S0R A;  2PE6 B;  2Y3A A;  2J42 A;  3LJ3 A;  3IUT A;  3AOE A;  1WIV A;  2R45 A;  1J7K A;  4E3C A;  2AS8 A;  4W9J A;  5HHD G;  3E56 A;  1XNQ M;  4DR7 M;  2HDE A;  2YEP F;  3L13 A;  1R4M B;  4IUM B;  2FS1 A;  3S3R A;  3DBR I;  3PSE B;  2M8S A;  5FR3 A;  5KPZ A;  1KSF X;  1VDD A;  4CHT B;  1AU2 A;  4YWG G;  2AQ3 B;  4W9D A;  2CP8 A;  4F1I A;  1AAR A;  3QT4 A;  3ZC7 B;  2AUX A;  1XD3 B;  1Q3C A;  3HM6 X;  3HUI A;  3L17 A;  4OVU A;  3W68 A;  2MR9 A;  5KHQ A;  3HJ8 A;  5FTK A;  4WQO B;  1TS3 A;  5CHW A;  2UXD M;  1EU3 A;  3D6S A;  4K7C A;  5G2N A;  4KGR A;  2GBM A;  2L4E A;  3CGW A;  3PHX B;  4JL9 A;  3NZU A;  3CH2 X;  1X1M A;  2KNZ A;  3PSE A;  1Z5C A;  4XE0 A;  1E7U A;  4M0W A;  5ITQ A;  5EE9 A;  2VDB B;  1LGR A;  2XU3 A;  1TH3 A;  1WYG A;  3U6L A;  1E90 A;  1FNU A;  2MQJ A;  3RPF C;  4AJY B;  2DWZ B;  3BPF A;  2RRU A;  2N7D A;  3OTO M;  3ILK A;  3U6P A;  2VHS A;  1IBL M;  3SR6 A;  1YX5 B;  2LVP A;  5H92 C;  2ATO A;  2Y0Q A;  2BWE A;  1Z5A A;  3TRK A;  1NVM A;  3KOW E;  2LD9 A;  4WQM A;  2WXO A;  5EF4 A;  1PIP A;  4CGY B;  3PZ7 A;  1VD2 A;  2NMQ A;  4IBC A;  1G41 A;  3TSS A;  2R2Q A;  3P4S B;  4M01 A;  2LWP A;  3V3X A;  4IDI A;  1FD6 A;  1T6B X;  3C9E A;  3J27 B;  4AS1 A;  2BT6 A;  3M95 A;  1F77 A;  4NJ7 A;  1G59 A;  2K25 A;  3QHT A;  3V62 A;  3VUY A;  2ERC A;  2MA9 B;  2KDF B;  1L0X B;  2GBN A;  1V92 A;  4DHJ B;  2KTR A;  3ZXV A;  3E21 A;  3IG5 A;  1QKZ A;  3HGI A;  1YIW A;  4DV1 M;  1R5L A;  3TEX A;  2M17 A;  3SFD B;  3P5X A;  2KO3 A;  1PGA A;  3WAL A;  3W1S A;  1IPG A;  1Y8G A;  1IM2 A;  2HJ1 A;  3PDF A;  1NB5 A;  1TGU A;  2XSZ D;  2JX5 A;  1Q39 A;  1OFI A;  5FTJ A;  1TS4 A;  3U6E A;  4B95 A;  2O6X A;  4JXJ A;  3GQ4 A;  1GB4 A;  5EZS A;  4QNM A;  1MFW A;  4CHK A;  4B3M M;  1A6R A;  2LVA A;  5E6J A;  1C1Y B;  1V86 A;  2NQ8 C;  4RCO A;  4LJA A;  3ZW3 A;  4W9C A;  3AFH A;  4NAW B;  5EXS A;  1NQC A;  1TKG A;  3HK0 A;  2DZO B;  1PJJ A;  1Q1O A;  4LNN A;  4BS5 A;  4WJO A;  3FUW A;  3EA6 A;  2JZ1 A;  1LM8 B;  2QBY B;  1PJS A;  1YK8 A;  3A1Q B;  3NS8 A;  3L28 A;  2UZJ A;  4ITK A;  4HPM B;  1VLB A;  2IGD A;  3QQ8 B;  4HRO A;  3AKZ A;  5AZH A;  3KW6 A;  1CJE A;  4R3D A;  3DBH B;  4CO7 A;  4K3C A;  5EDS A;  1VEG A;  3IHP C;  3NHE B;  1BT0 A;  3HKP A;  5DPS A;  2DC7 A;  3PRZ A;  1PBH A;  2UXB M;  2K0B X;  1L0V B;  1XXH B;  3W67 A;  2MHJ A;  2B1N A;  4OZA A;  3U8E A;  2KA6 B;  3MHS D;  2NBV B;  4CIS A;  4W4U A;  1NY5 A;  1ZOY B;  4HXD A;  1MG4 A;  1F0Z A;  3AEB B;  4WA6 A;  1QZE A;  2VZK B;  2WXJ A;  4JI2 M;  1QF6 A;  1QAN A;  1Q02 A;  1YSY A;  1NI2 A;  2QSD A;  2CEA A;  1OTR B;  4AOF A;  3ZUA A;  2PBH A;  3L26 A;  2KZU A;  2BKF A;  4FCT A;  2RMM A;  1R2Y A;  3PGE A;  5AZF A;  3USV A;  2FH0 A;  1QAQ A;  1QQW A;  2FUG 1;  1QOF A;  3M62 B;  3NHE A;  3MC9 A;  2OZ2 A;  2JZP A;  1XHB A;  4L15 A;  5J17 A;  5BPV A;  1DGJ A;  1QOB A;  3KP1 E;  2FRQ A;  3FTF A;  5G5H A;  3RZF A;  1MDW A;  1GB1 A;  1E32 A;  2GHU A;  2D3A A;  1F29 A;  1YD8 U;  5IA7 A;  2WDT B;  3AED B;  4AG6 A;  3PS6 A;  2EUC A;  2KQ7 A;  3C3E A;  4YTP B;  3BOW A;  1ZMV A;  1QAM A;  5GKN A;  4AKG A;  2AIM A;  4F1S A;  4N6E B;  2CHW A;  1NEK B;  2LGS A;  4JPS A;  5GMV A;  1FFU A;  1TGZ B;  2G3Q B;  2K6B A;  2BTW B;  4DV4 M;  4GDL B;  3HVD A;  5CX3 A;  2X8X X;  4D80 A;  3X0W A;  2MGW A;  2WXL A;  2KMA A;  3Q8C A;  3GRY A;  2L4F A;  1I35 A;  4HPL B;  1GAB A;  3TE6 A;  2BS3 B;  4Q8G A;  4LNK A;  3EIE A;  3MTN B;  2G8E A;  3BCN A;  2MJ3 A;  3QC8 B;  5DPR A;  2Y5B B;  4G0N B;  4P6G A;  4L1B A;  2YJC A;  2DWL A;  1XQQ A;  2WXI A;  2NCN A;  2X8A A;  2MRP A;  1I4H A;  4GSW A;  2OJW A;  1WXV A;  1IXS A;  1JWM D;  3BVM A;  2G3Q A;  4WAF A;  3L54 A;  3HU1 A;  4S17 A;  3PHW B;  2D5G A;  1VRA B;  3MC0 B;  3SYK A;  2L0T A;  2MLB A;  1Q6K A;  1F4I A;  3W0F A;  1D0L A;  1E8Y A;  2JWU A;  2KWD A;  3VTU A;  4BKT A;  2O25 A;  3KUZ A;  4TUU A;  2DAJ A;  3N3G A;  3HHZ A;  1R7R A;  2MEK A;  4LLG M;  1E0Z A;  1KFV A;  4LFC M;  1HQR D;  2G4D B;  1CQD A;  2D3C A;  3MMP A;  2DYO A;  3GOE A;  2Y5B A;  3IBE A;  1P3Q U;  4FJY A;  1A5T A;  1N62 A;  1KFX L;  1U9Q X;  2C99 A;  3PV1 A;  4C4V A;  4LDT D;  3PT2 B;  1XCT L;  4L4U A;  3UIO B;  4DHZ B;  5F3W A;  3TWK A;  3NVZ A;  1GC7 A;  2X38 A;  4MEM A;  2REX A;  3ZIM A;  2AL3 A;  2FO5 A;  3EC8 A;  1IQP A;  5EXT A;  2LUM A;  3LDZ E;  6PAD A;  4LY6 A;  1JAL A;  2QPA A;  3M6A A;  1FPY A;  4EKU A;  3TQS A;  2DEN B;  2CHQ A;  3BBA A;  3W5U B;  2W55 A;  1AU0 A;  1TH4 A;  1L7Y A;  4S12 A;  2HE7 A;  3BB7 A;  3SEB A;  3B2G A;  4C80 A;  3KOY E;  2Z0D B;  2JXX A;  3HWN A;  2LJI A;  3MP9 A;  5LXI B;  2FCM A;  4LG2 A;  2BWF A;  1HZ6 A;  3WHL A;  2QDF A;  1WRD B;  1U9X A;  3AEF B;  4MJS A;  3FKE A;  2MBO A;  4IBD A;  2HTM E;  1DGH A;  3Q8A A;  5E26 A;  2N9K A;  4UDU C;  1B1Z A;  1U5I A;  2DAF A;  4HJK A;  1TYG B;  1V33 A;  1UEL A;  3U60 B;  3N30 A;  2F5S A;  1GJS A;  2GQF A;  2YJB A;  3PFI A;  2K22 A;  4ZDV A;  1AYV A;  1QQR A;  3HJS A;  3OIS A;  4ARI A;  1AYF A;  4LCB A;  4A3O A;  4YXD B;  2IO1 B;  1FM0 D;  3KYC D;  1K50 A;  3PTF C;  1K51 A;  3CWI A;  4PS7 A;  4D2K A;  1ZCM A;  1J5E M;  3NOB A;  5EE1 A;  3IHP A;  4IBG A;  1N61 A;  2QEN A;  1Z5B A;  2J0M A;  2DOS A;  1L1Z A;  1RFK A;  2WDQ B;  3PW3 A;  3UIN B;  1S1Q B;  4RF0 A;  2XK5 A;  1CSB B;  4CZW A;  3AEG B;  1YX6 B;  2L6O A;  3FUV A;  4N58 A;  1AYW A;  3K9O B;  3NJT A;  1THE A;  3BC3 A;  3RVX A;  4FVM A;  4XDC A;  3B89 A;  2L1A A;  4NJC A;  4RFB A;  1V80 A;  4NAM A;  2O6V A;  2JWS A;  3AI8 A;  1R4G A;  3NVY A;  5BO4 B;  2ZZP B;  3NZS A;  2LEK A;  3KS4 A;  3KFQ A;  2ZVN A;  3BOS A;  3PNY A;  4JV5 M;  2UU7 A;  2J53 A;  3C8Y A;  2EA0 A;  4DV0 M;  3LYY A;  2DWM A;  4C7Z A;  4OVZ A;  1ZMU A;  4IM2 A;  3GPU A;  4K81 A;  2K5P A;  2C7H A;  2Z8Y M;  2V1Y A;  1QXP A;  4DR5 M;  5EXP A;  2Y21 A;  3GRR A;  3ZJT A;  4A6Q A;  4DV3 M;  1PJT A;  2Z0E B;  3K9O A;  4OEM A;  4RKX A;  3VR8 B;  4II7 A;  2DHY A;  1PE6 A;  3GP1 A;  1HNX M;  1WFY A;  2R4E A;  2GI9 A;  2K47 A;  4FCV A;  2MJ5 B;  2Y5P A;  1TDH A;  3JR4 A;  2BS4 B;  2PMV A;  3VFD A;  3L2A A;  1DKI A;  4BQV A;  1FJG M;  1XXG A;  4I81 A;  3DOA A;  4M8M A;  4RF1 A;  1FIQ A;  4DBG A;  3HU2 A;  4MM3 B;  3HHY A;  4LTU A;  1CK1 A;  4DV7 M;  1ICF A;  1FXI A;  4KZ0 A;  1YN3 A;  2Z8L A;  2GRI A;  3BYY B;  2CU1 A;  5C2T B;  3DCG A;  2R4J A;  4ZHO A;  1JQP A;  1X37 A;  3ZNZ B;  2UYZ B;  2GB1 A;  2FT2 A;  2LH0 A;  2E01 A;  1HA5 A;  2QHO B;  1TKE A;  3ABV B;  2PVG C;  1HNZ M;  3GRU A;  2K1F A;  2R6F A;  3MJW A;  3KDS E;  3N1Z C;  1Y08 A;  4XR7 A;  2GBJ A;  2D3B A;  1HZ5 A;  3VH4 B;  2BDL A;  1TTN A;  2GNO A;  3T15 A;  3RZW C;  4MM3 A;  2N9P C;  3GCB A;  2K3U A;  2APL A;  4AG5 A;  4W5B A;  1AU4 A;  1OJL A;  2CV1 A;  4P17 A;  1R4N B;  2BW2 A;  2IBI A;  2GLS A;  2WZJ A;  2INC C;  3ML9 A;  3U4E G;  4GRI A;  3AEC B;  3KFU G;  1X9Y A;  4LJP B;  3HHM A;  3PZD A;  4OX9 M;  4NZL B;  2EMT A;  2GMI C;  3KSX A;  3QJZ A;  1OGW A;  4NQL B;  3BYT B;  2D7H A;  5FKA C;  3AOE C;  3GZN I;  2X4A A;  3HIZ A;  5H8Y E;  4NNJ B;  2QIL A;  1L1T A;  1N33 M;  3WAO A;  2WU5 B;  4FCW A;  1V1P A;  1CUK A;  1SF0 A;  1IN7 A;  1H6U A;  1XC8 A;  3I9V 1;  1SXJ D;  4ZRI A;  5E6P A;  3NY5 A;  2JQG R;  1GL6 A;  2M60 A;  2BQQ A;  2WXK A;  3PPA A;  3PBH A;  1WSP A;  3H89 A;  3RE8 A;  1SB3 C;  4FJC A;  5FSW A;  2AQ2 B;  4AQ7 A;  1WR6 E;  2VII A;  4NPN A;  4A9A A;  2DAG A;  4LJ5 A;  3GQ3 A;  1XT9 B;  3PLV A;  2R9F A;  3ZRC A;  1EU4 A;  3Q6B A;  2DZM A;  4HEA 1;  4BSQ A;  2IZV B;  2EJS A;  9PAP A;  2B3A A;  4W9I A;  4ZRK A;  1TBE A;  2LVQ A;  1F2R C;  2KZS A;  3KW9 A;  3BWU D;  2BVC A;  2KEB A;  2RSU A;  2JY6 B;  4N4Z A;  1EWC A;  4KHP M;  1M94 A;  3GLI B;  2A5Y B;  1FNN A;  1R2Z A;  2ZBK B;  2K6D B;  1ESF A;  1KHP A;  3TUO A;  4TKN A;  3BIN A;  4NXN M;  4MDK E;  1ZPS A;  4IP3 A;  2I1J A;  1VSN A;  1QMY A;  3P5U A;  1XF5 L;  2UUA M;  1WGL A;  4JX1 C;  3VDP A;  1L2N A;  2G45 B;  1SXJ E;  1N75 A;  4KLN A;  1F52 A;  3T3N A;  3DZD A;  5JHB A;  2J4X A;  2BGF A;  5HI1 A;  2LXA A;  1RAX A;  3Q3J A;  2LVP C;  3GLH A;  2P5T A;  2OPF A;  2KKC A;  5BR8 M;  3A42 A;  4GUA A;  1YJJ A;  4YTN B;  3SDL C;  2IDY A;  4BS6 A;  2O2V A;  4H2A A;  4P6V F;  1SXT A;  2KFJ A;  3KYD D;  2OO9 A;  4LJ9 A;  1BXT A;  2BBC A;  1VDV A;  3RVV A;  2HHH M;  5A24 A;  2MSE D;  2DKL A;  2FUH B;  2L0F A;  2PTL A;  3RYT A;  4XWT A;  4CDC B;  4KSL C;  3ZNH A;  2JXN A;  3SAW A;  1GMY A;  2CIO A;  4IWP A;  3WAN A;  5EP2 A;  4Q7J A;  3I57 A;  3AL0 C;  1L6V A;  3KOX E;  4PS3 A;  5BYQ A;  2C9W B;  4FJV B;  1LO5 D;  1YZB A;  4LNO A;  4IBI A;  3W1S C;  2DXI A;  1PM5 A;  1A70 A;  2R18 A;  3H7P A;  2B1M A;  5C3J B;  4GHA A;  1DV0 A;  2W82 A;  4B3S M;  2R65 A;  2ZEQ A;  3RNF C;  1W5S A;  3AV8 A;  1AN8 A;  5KQ8 A;  1YJ1 A;  1NSF A;  3KP0 E;  3RNV A;  3JYU A;  1JRU A;  4PK1 A;  3KW5 B;  3B0A A;  3EFU A;  3N1X C;  4ANV A;  3DVN U;  3TEY A;  3IEC A;  4AUQ C;  1N77 A;  1N32 M;  1Z6T A;  4HL4 A;  1NB3 A;  3K9P A;  1MU5 A;  4GDK A;  4PP2 E;  1I4X A;  5ITX E;  4N8W A;  3K8Z A;  4WJP A;  4B3T M;  5PAD A;  2DZL A;  3ZUN A;  3PRP A;  2TSS A;  3JSV B;  3E1Z B;  1DGB A;  2HKJ A;  1ET9 A;  3NS1 A;  1CQV A;  4FHK A;  4USA A;  2KZR A;  3U7Z A;  1WH3 A;  4WWP A;  2LVN C;  2AQ1 B;  3AN1 A;  3CST A;  2KN5 A;  3SMS A;  1XWI A;  1FCC C;  3EHV A;  4JGH B;  3WXE A;  5E6N A;  1C9F A;  2RD0 A;  4K1R B;  1M6D A;  3TBL D;  2FTD A;  1K52 A;  2QJL A;  2XBB C;  1MG8 A;  4KGS A;  4M00 A;  4HRS A;  3UGB B;  4MGZ E;  2HD5 A;  5EJC A;  4YTM B;  1S4V A;  3JSV A;  4JN6 A;  1IY1 A;  4M9S A;  2LWX A;  3MFG A;  4KT0 F;  2VH2 A;  4YT0 B;  3QYB A;  1NDD A;  3UIP B;  2V4L A;  3J2P B;  4NL4 H;  3HHA A;  4EZL A;  4GH9 A;  3J9C A;  2L09 A;  4BBA A;  3DDC B;  2KVR A;  1VZ6 A;  1DO2 A;  4CIZ A;  1HR0 M;  1R4M I;  4NSR A;  4LJ8 A;  1SE3 A;  1C4C A;  2K6Q A;  3DQV A;  2HTH A;  3NRZ A;  2Q2E B;  3U61 A;  1WGR A;  1DGG A;  2KLC A;  2JZ0 A;  3B2F A;  3QCA A;  3WA0 A;  5EGW A;  2MH8 A;  3O1G A;  3HU3 A;  2SAK A;  3QX1 A;  2B3T A;  2RKO A;  3ZO5 B;  3ZQJ A;  5BMG A;  2FCQ A;  4YYV A;  3J80 S;  2KC1 A;  3V6E A;  4M0W B;  3SFZ A;  2HL7 A;  4AJW A;  4A55 A;  3A4R A;  4CQN A;  1OAI A;  1K8R B;  3E9S A;  4MT5 A;  3SC3 A;  5F02 A;  2I38 A;  5AZG A;  5FK9 C;  1WE7 A;  1WIA A;  3FUX A;  1HNW M;  3MHH A;  4KIK A;  1MS6 A;  1LTM A;  4GXB A;  3F5V A;  5JZE A;  2MBE A;  2XF3 A;  3V60 A;  1HEZ E;  2IYD B;  1NVI D;  2WXQ A;  2PIA A;  1E10 A;  4DR3 M;  2QNJ A;  2CHV A;  4DR4 M;  1QOA A;  5EP4 A;  1IYF A;  1DGF A;  2JYE A;  5FLX S;  3L08 A;  2WSF F;  3M0E A;  3APD A;  2IGG A;  4EZK A;  5TR5 A;  3I01 M;  3JAM S;  1IGD A;  2JQR B;  2KNV A;  4A20 A;  3GLF E;  4ZYS A;  2G5G X;  3LW5 F;  2KC2 A;  3ZDM C;  1V5T A;  1D0K A;  4LCD E;  4MGH A;  1UGJ A;  1UH6 A;  1Y8R C;  2KTR B;  5IAA C;  2XSZ A;  3HD3 A;  1N6Z A;  1KXR A;  2VF8 A;  5CVN B;  2KFK A;  1GOZ A;  2JF5 A;  2BYV E;  4B08 A;  2N9X A;  4QAY A;  3RNE C;  3V61 A;  1FXT B;  3W9C B;  4LNF A;  1GNU A;  2FIF A;  1NO1 A;  3FAH A;  3I04 M;  2ZW0 A;  2INP E;  3W1Y A;  5JA7 A;  4KX6 B;  2C7M B;  1VJV A;  2KXJ A;  1K53 A;  1YQ4 B;  1OIP A;  2JUO A;  2L7H A;  3A4S C;  4HDO A;  4IC7 B;  4MZS A;  4TMA B;  2DAE A;  2YLM A;  2G1E A;  4IBJ A;  3ONS A;  1WJ4 A;  4X6H A;  1XNR M;  2DCB A;  1UNS A;  4LF8 M;  3FUT A;  3JW0 X;  3URY A;  3HZJ A;  2LRU A;  1I4P A;  2KAJ A;  2KTF A;  2BWB A;  1NPZ A;  3PRM A;  4WH4 A;  4QOS A;  3JVZ X;  3AE7 B;  3L0W B;  4GN1 A;  4MAC A;  1J09 A;  3H1U A;  3GQ5 A;  1WGH A;  4D8I A;  1HTO A;  2N0S B;  3R3M A;  4DWF A;  3MHS A;  4QRG A;  2KDB A;  1YLA A;  2N9L A;  3B08 A;  2KYW A;  4G4Q A;  2PKO A;  1BML C;  4MGI E;  5IO9 A;  2P86 A;  3DBH I;  3U6M A;  1YJI A;  4L78 A;  2WXG A;  4HXD B;  4ZRP A;  1ZAE A;  2MJE A;  4J3O D;  3RT3 B;  2W3S A;  2FUD A;  3B9J A;  3GPP A;  3H4M A;  4AW4 A;  3KUD B;  2Q5W D;  3PVL A;  3DHI C;  2CB5 A;  1I4R A;  4PI3 A;  2E6X A;  2F5N A;  3N20 C;  3A33 B;  5LNK 1;  1D0M A;  2Z7J A;  2KWC A;  4WP2 A;  4JWS C;  3EUB 2;  3KSE A;  2JRH A;  3H8H A;  5EE0 A;  4GIV A;  3IEJ A;  3A9J B;  3HHW A;  1Q3B A;  2WDV B;  4IG7 B;  5G5G A;  1ZUD 2;  3UZU A;  4ANR A;  2BTE A;  2QZ4 A;  3IG8 A;  1WGN A;  2NQG A;  1YQ3 B;  2WBF X;  4W9E A;  2KX0 A;  3TNX A;  1FFV A;  3U5Z A;  3SAT A;  3AE2 B;  3QWL A;  1SGH A;  1DF0 A;  2G8J A;  3DBS A;  1KFY B;  4YSZ B;  5FTL A;  2UUC M;  2ZAM A;  3T8M A;  1AU3 A;  4K7U A;  1D5X C;  1AEC A;  1FO4 A;  3CH3 X;  1ZE3 D;  1DO0 A;  4RGT A;  4BVU C;  1G6J A;  2EO2 A;  1ZDX A;  2MH7 A;  4CDE B;  1K3B B;  2MWS B;  1DOY A;  4OEL A;  3EIH A;  4KDL B;  2CUZ A;  1V1O A;  3A9J A;  4ICV A;  2JTC A;  2V1U A;  1IBX A;  2Z84 A;  3PVS A;  1RRB A;  3D32 A;  5IP4 D;  2JP7 A;  2AL6 A;  2RDG A;  4KVG B;  1JWU D;  3RN9 C;  4K7S A;  4WAA A;  3I3T A;  1D4B A;  3GRV A;  2KDL A;  2N9E B;  2NPT B;  2H1R A;  4XGA B;  4EFO A;  4LDT B;  4DHJ D;  2GFO A;  2K39 A;  1WMH B;  2F5Q A;  2PLP A;  2DAI A;  4NC6 A;  2JUJ A;  3J7A S;  3BY4 A;  2LGD A;  1IXS B;  2MBB B;  3M63 B;  4G54 A;  3R7R A;  3A98 B;  3VTW A;  2R9C A;  2OOB A;  2KQ4 X;  4IJF A;  3B7Z A;  4RKU F;  3QWZ B;  3VDZ A;  1WJU A;  2PEA A;  3L16 A;  1WYW B;  4JE3 B;  4G4R A;  2DJF B;  3FD9 A;  1OQR A;  3OJ3 A;  1YNT E;  2DZI A;  4JI8 M;  4LNI A;  3BWK A;  3V05 A;  1YUB A;  2OED A;  4ZOH C;  1N36 M;  1GLN A;  2NPT A;  3FUU A;  1C79 A;  3V6C A;  4DR6 M;  4IIW A;  1UBI A;  1WMH A;  2BB6 A;  4ICU A;  3VUW A;  1WJN A;  3SAR A;  1UM8 A;  5KQD A;  4C4V B;  2KRU A;  2BWE S;  3THG A;  3P1M A;  1UUP A;  3UI3 A;  2VRR B;  3ECI A;  1MIR A;  4BOZ A;  4OZB A;  2JU6 X;  3A46 A;  3HRD D;  1UFZ A;  4JLC A;  3DFZ A;  2M1M A;  4C7Y A;  2L52 A;  2R46 A;  1F1H A;  5HKH A;  4E74 A;  1SXJ C;  1YVB A;  5D2M B;  1I94 M;  2HAK A;  4JI3 M;  1F2C A;  4PYU A;  1WI0 A;  4ZYN A;  2WHI A;  2FYE A;  1J7B A;  1CB5 A;  1J7C A;  1QZM A;  3VAW A;  2DAM A;  2VZK D;  1JQ4 A;  2V3S A;  1RYJ A;  3QAQ A;  3Q8E A;  2D3G A;  1V97 A;  1QOL A;  4XC2 A;  2HH5 A;  1OQY A;  4I8O A;  4MH8 A;  2Z59 B;  1MHX A;  4RM8 A;  1QOG A;  1MEM A;  3UQB A;  1NBF C;  4MJS B;  5ITY A;  3GLG E;  2PVO D;  4PAD A;  4CDD B;  4K7W A;  1NL6 A;  1DGH B;  3MHV C;  4JWU C;  2DJG B;  3IVF A;  2Z4R A;  1ZQ9 A;  2LBC A;  1EIJ A;  1TR8 A;  5FTN A;  2IND C;  3BVG A;  3SYL A;  1E8Z A;  2ZM6 M;  3O13 A;  2Y5C A;  1EO6 A;  4FIP A;  3KLS X;  1JML A;  1ZXI A;  4W9K A;  1PJI A;  1QUS A;  1XXH E;  1WJ7 A;  5MPO A;  4F8C B;  3AE9 B;  1CV8 A;  3R7Q A;  4DXF A;  4HJG E;  1QIL A;  1XEE A;  4LFB M;  3PLU A;  1FRR A;  2E02 A;  2DC9 A;  3TJP A;  3VTV A;  2XK5 B;  3Q69 A;  3R8F A;  3HHI A;  1L4D B;  1PCI A;  1P7E A;  2KVZ A;  1SBB B;  1RU3 A;  5IT9 S;  1IXR C;  5CHT A;  3F92 A;  1E8X A;  2DZK A;  4M9X A;  2O6V B;  4Q2J A;  1I42 A;  4I5S A;  4Z6Y A;  4BOS A;  4LGY A;  4LRS A;  4LRT A;  2YNM D;  2G6D A;  2E3T A;  2R62 A;  4LF4 M;  1WGG A;  2NTS A;  2RR9 A;  2XNA C;  4L6V 6;  3QA8 A;  4DMX A;  1J7A A;  4NRW A;  4P6E A;  2D2Q A;  3AV0 A;  2PE9 A;  3LFY A;  1E9M A;  1CTE A;  4M9Z A;  4OVZ B;  2KX3 A;  4W9L A;  2JT4 B;  3RUL A;  2N7J A;  4B0M A;  5CVO B;  4FXC A;  4IBE A;  3GPX A;  4US8 A;  3LVV A;  5C1B A;  1P9D U;  2L05 A;  3U6C A;  3APF A;  2WXN A;  2OP3 A;  1EWY C;  2WX0 A;  2AUZ A;  3QSD A;  2XEP A;  3A45 A;  3GB1 A;  4XDD A;  3L27 A;  2HCB A;  5DCN A;  2M56 B;  5DPW A;  3R8B A;  3P2B A;  5DPT A;  3H7D A;  2K9D A;  5KO3 A;  1IXZ A;  1XLO A;  2JYT A;  1KF6 B;  1RM6 C;  3FC4 A;  3F75 A;  1PFD A;  3APC A;  3ZJU A;  1JRO A;  1EF1 A;  3J7B A;  4Q8H A;  2O01 F;  1NEN B;  3OAW A;  3KXE C;  2IO0 B;  2XEW A;  2MP2 A;  2AU1 A;  4DBG B;  4IM0 A;  4HWI B;  4I04 A;  4EE2 A;  1HTQ A;  3SHQ A;  5H37 D;  4QOZ C;  2R44 A;  2J7Q A;  2YR0 A;  3P5W A;  1JW9 D;  2BS2 B;  3UGJ A;  4NJ6 A;  4X6I A;  4YYW A;  1I4Q A;  1MVK A;  1OFH A;  1GAQ B;  2KMM A;  5CVM A;  5IRE B;  1TTE A;  4JQW C;  4IJE A;  4BLC A;  2IO2 B;  4YV8 A;  1C3T A;  2KDM A;  3HWS A;  1PGB A;  3VK7 A;  2KDE B;  2R61 A;  2W54 A;  4KSK C;  4IM3 A;  1E6E B;  5AEK B;  3AEA B;  4JYA M;  2ZTD A;  1RLF A;  4ZTB A;  3OVZ A;  2JWZ A;  4I6N B;  1SXJ B;  5E6O A;  3GP7 A;  4W5C A;  2MX2 A;  5LMN M;  3ERV A;  2AHM A;  1BUI C;  3OJ4 B;  4RGN A;  3C9P A;  3RNB C;  2DC6 A;  1XCQ L;  2RGH A;  2QCZ A;  3KWL A;  1D6E C;  1GO5 A;  2M0A A;  4FK5 A;  4E71 A;  2BU3 A;  1OQQ A;  1FEH A;  1NNU C;  1WE6 A;  2IBI B;  4FJZ A;  4IOI E;  4GB9 A;  1K82 A;  4IKG A;  5D3D A;  1QVR A;  4ANX A;  4D82 A;  1V81 A;  3ZTD A;  4DK5 A;  2FOI C;  2OQ4 A;  1IN6 A;  3MC8 A;  1KRH A;  2G9H D;  2QMT A;  4WUR A;  2LHD A;  3HY5 A;  3NBI A;  1ZP0 B;  1R4N I;  2EKE C;  2KJR A;  3ZLZ A;  1WM2 A;  4EZJ A;  4HVB A;  1NJG A;  1SXJ A;  2ZAN A;  4ARC A;  4YYU A;  2ZAO A;  4JI0 M;  5HG2 A;  3VFK A;  1V1P B;  1IBM M;  4WWM A;  3IFU A;  3AB5 A;  4UN2 B;  4GC5 A;  4BZA A;  3VK8 A;  4CJ6 A;  1K3W A;  4X57 B;  4HCP B;  3DHH C;  2CE7 A;  3GE8 C;  2L32 A;  2P0R A;  1WZ3 A;  1N5W A;  4GMV A;  3NVV A;  5DYI A;  3U2S C;  3KKU A;  2V1C A;  3VUX A;  2DZZ A;  2ZW1 A;  5JH5 C;  4BKS A;  4PCZ A;  1P3Q Q;  1B9R A;  2NQI A;  2KXE A;  3RGS A;  4AZF A;  2NVU I;  5IKC M;  4II2 B;  1NI3 A;  1OFF A;  1XLP A;  4RH6 A;  2RDH A;  1MN3 A;  5DNY A;  1JWA D;  4ZRQ A;  5AUK A;  1YE9 A;  4HKZ E;  2KWV B;  3U6D A;  1T5X D;  4A90 A;  4M8N A;  3ZXR A;  3KOZ E;  4FN2 A;  2WGS A;  2CV2 A;  2DI0 A;  4HKQ A;  3LMM A;  3H9D A;  3ZNG C;  4TQ0 A;  1KOT A;  3ENE A;  4P1B C;  2XFT A;  3GLH B;  3C0R B;  5CHV A;  3SAS A;  2WU2 B;  4XZ4 A;  1KLU D;  2JVC A;  4D8E A;  3DA1 A;  4EEW A;  3UMM A;  1J19 A;  2O2V B;  1L6U A;  4BKS D;  1LXD A;  3AEE B;  4LZJ A;  3AXC A;  1EF7 A;  1H4R A;  2F1G A;  2CFO A;  1E7P B;  3WXF A;  4KKI A;  2KWU B;  3T38 A;  4HEO A;  2PRE A;  2JXT A;  2KN4 A;  2IJ0 A;  1WXA A;  1KYI A;  1IN8 A;  2KT7 A;  5ITX A;  3FIL A;  4ANU A;  3MP2 A;  4FAD A;  1WR1 A;  4BPV A;  3TWM A;  2DLB A;  3ZNH B;  4LGM A;  4M0D A;  4X66 M;  1PRB A;  4DV2 M;  1L0Y B;  4G50 A;  3NWL A;  2IO3 B;  1L5P A;  2CR5 A;  1PPD A;  3Q8X A;  5JI2 E;  4FBJ B;  3C0R A;  4RM9 A;  3TIX A;  1ATK A;  3CF2 A;  2KDI A;  3DWG C;  2LGX A;  3Q3F A;  1CPJ A;  1GCB A;  2QEJ C;  4WJQ A;  2UXC M;  3L29 A;  2Y20 A;  2MW5 A;  4GIP A;  1TZO A;  3H7P B;  2ZJD A;  1UGM A;  4ZPX A;  3LXF A;  2DBY A;  5ITR A;  2LVO C;  1ACC A;  2QCU A;  1QLB B;  1ZDV A;  4GLS C;  4AXM A;  3AU4 A;  4P7I A;  3K24 A;  3GE3 C;  2GBK A;  5JH3 A;  5EXX A;  5LLI A;  1UBQ A;  3RFZ B;  1XKG A;  4B7F A;  2DZY A;  2ACT A;  2JPH A;  2WWZ A;  3VH3 B;  3K9P B;  4GDK B;  1IUE A;  2E5L M;  1POP A;  3P5V A;  3DF0 A;  1OEY A;  1STE A;  1EWL A;  3PRP B;  3FRI A;  3M7G A;  3VDU A;  3EEC A;  2W9N A;  4J6I A;  1D5Z C;  4KKJ A;  4MSX A;  2BJV A;  2LHG A;  4TUW A;  3ZYY X;  3BII D;  2AYO A;  3I4V A;  1KLG D;  2ZPY A;  2XGN A;  5EZQ A;  1ROE A;  1FCL A;  2M4N A;  3K1J A;  4G3O A;  1Y4H A;  3NG0 A;  2CKH B;  1S3S A;  1DOI A;  2XU4 A;  1YOV B;  3OQC A;  5C23 A;  4X64 M;  2C5L C;  2BF8 B;  3ZH9 B;  2VHF A;  1BVS A;  4FLH A;  2HD5 B;  3X23 A;  4BOQ A;  2XH9 A;  3N32 A;  1KM7 A;  4GOC A;  2IGH A;  4OZC A;  1MEG A;  1PGX A;  3AU5 A;  2C7N B;  2DYM A;  4IWQ A;  4EOY A;  2BYT A;  2P7U A;  3B74 A;  2G7Y A;  2WSC F;  1LFD A;  2HJ8 A;  1TL9 A;  1ENF A;  3GO8 A;  1CZP A;  2DNF A;  2KHH A;  3Q14 C;  3W31 A;  2JZZ A;  3RUI B;  3PNR A;  2H89 B;  1N60 A;  3OWE B;  4REZ A;  2J7N A;  3U61 B;  3TL4 X;  3TL5 A;  1EWM A;  4R71 A;  3GLF A;  4FWD A;  4G3X B;  2EKF A;  1SJE D;  2R9N A;  2QQ8 A;  3DWM A;  1C7Y A;  4BB9 A;  1Q10 A;  4DXG A;  1E7V A;  1T6O A;  5L83 A;  2DCA A;  1SNK A;  4B6W A;  2INN E;  2J0J A;  3AE6 B;  3RNG C;  3FYD A;  1P7F A;  2LZ6 A;  3IT4 B;  3C3D A;  1BY8 A;  3V6E B;  4LF7 M;  3M3J A;  1T43 A;  2Z4S A;  1L2B A;  1PUT A;  5LXH A;  1FNV A;  1GLO A;  2I7N A;  1F2R I;  1FXA A;  3FE3 A;  2JRI B;  4YSY B;  2BPS A;  4YYS A;  1LQB A;  3RGP A;  3GLI E;  4W9G A;  3TWL A;  4R7G A;  2DWQ A;  2WXR A;  3PNV A;  3Q2A C;  3HHX A;  3DBL B;  4KIK B;  4LJ4 A;  5JZE B;  5AUI A;  4Y28 F;  4RGM A;  1PVJ A;  2PW9 A;  1TF0 B;  1GJT A;  3N3K A;  2LXE A;  3GS2 A;  3CIR B;  1AIP C;  1VEJ A;  2YQZ A;  2EEL A;  1G8P A;  2LHC A;  1ET6 A;  1Q0W B;  3UQA A;  1HE8 A;  3IT6 B;  4KZC A;  2WXP A;  1QDR A;  4GHL A;  1UKF A;  3VVW B;  2BDZ A;  1S3S G;  3E46 A;  3VKG A;  1U9W A;  1H8C A;  3LXS A;  1IWD A;  3PHU A;  5J2R A;  1SIF A;  2WP9 B;  4DQO C;  2JRI A;  1TKY A;  3A9K A;  4TSS A;  1TY2 A;  2C98 A;  1OIZ A;  2O5R A;  3ETR A;  1QAO A;  4KOD A;  5HFY A;  4FWG A;  4IBF A;  2XLJ A;  2KFK B;  2OHF A;  2PNS A;  2KNA A;  1MJG M;  4DV6 M;  2RGO A;  1K3X A;  1OEY J;  1V6E A;  1V5O A;  2RGF A;  3NUH B;  3B7N A;  5DYG A;  2C96 A;  1JWS D;  4HDQ A;  3P4P B;  2KHW B;  4L23 A;  5D7G A;  4I6L B;  1E8W A;  2RDB C;  5J18 A;  1JRP A;  2EKK A;  4G11 A;  4XX5 A;  1WJ6 A;  5L95 C;  4LF5 M;  3SHF A;  2K0P A;  1F2B A;  3WAM A;  4IBB A;  4PS8 A;  4DR2 M;  3IG3 A;  2JZ3 B;  2CWB A;  3BXW A;  1VEK A;  2V0G A;  1AW7 A;  3DBR B;  1WXQ A;  1WZ0 A;  2MJD A;  4JI7 M;  3HX3 A;  2F5O A;  3PRM B;  5IWA M;  2F7D A;  4GU2 A;  4BAX A;  1ISN A;  2JY5 A;  2GBR A;  1VJK A;  3LQR A;  3W30 A;  4O1N A;  3RNC C;  2D11 A;  1QDQ A;  4IUM A;  3B21 A;  2F5P A;  1R7S A;  1IY0 A;  4B7H A;  2I7P A;  2N4F A;  4QHT A;  1D5M C;  5IOI A;  3VXW A;  2IPP B;  3TPZ A;  2LVO A;  2IY1 B;  3IFW B;  2CHZ A;  3VQI A;  4L16 A;  2FQ9 A;  4DR1 M;  4ACF A;  2LJ5 A;  3TCA A;  5BMH A;  3ZQ4 A;  3O0U A;  2R6N A;  4MSM B;  4G6Z A;  1DOX A;  1ME3 A;  3KQ4 A;  3PZ8 A;  3K9M A;  3T1Y M;  5D3I B;  4NY0 A;  1N34 M;  1WY8 A;  1WM3 A;  3TEW A;  1C77 A;  3HJQ A;  1NHG C;  1YN5 A;  1IBK M;  4RY2 A;  4BBN F;  2CHX A;  3R2I A;  3PHX A;  5JHA A;  3T3O A;  3DHG C;  3VLF B;  3SBJ A;  2BYE A;  2Y0T A;  3IMA A;  4P1C C;  1MPE A;  2R0I A;  1TZ1 A;  2XU5 A;  2PPH A;  2C0Y A;  3HM3 A;  4N59 A;  3N9Y C;  1GVN A;  3C58 A;  4MZO A;  1L2D A;  1FNW A;  1R6B X;  3SFE B;  1C4A A;  1UF0 A;  2CS4 A;  1SSN A;  1U9V A;  2H5X A;  3FTE A;  5FTM A;  3U5Z B;  5BYR A;  4RGO S;  1ZMW A;  4PDI A;  3H6S A;  2L3Z A;  3B79 A;  2DZN B;  2MBH A;  4OU7 A;  1OKS A;  3KH0 A;  1PJQ A;  1WX8 A;  3NZ3 A;  4BOS C;  1M4V A;  1N63 A;  4W9F A;  2JSV X;  1WHC A;  1IN5 A;  3J81 S;  2JNH A;  1AWD A;  1YQB A;  3AUL A;  4YHH M;  2LNH C;  3U7D A;  4X62 M;  2MRO B;  1V2Y A;  4IWO A;  2JQF R;  4FWH A;  5EP1 A;  4URK A;  3KVF B;  3K8U A;  4TV3 A;  3NBX X;  5KHO A;  3SD5 A;  2AGA A;  1IBX B;  4LF6 M;  2L8J A;  4JI1 M;  2UUB M;  1G3I A;  3KVW A;  3LCU A;  4AKH A;  1C4P A;  2KJH B;  2WDR B;  1KHQ A;  3I3T B;  3GLG B;  5T8I A;  2V3P A;  4A3P A;  4W9H A;  4X65 M;  2KNB A;  5KPT A;  4NRV A;  4GIT A;  1E94 E;  1KJT A;  1ZIV A;  1HT2 E;  1ZV1 A;  5GXG B;  2VQE M;  2CU3 A;  1C76 A;  4GKK M;  3BY4 B;  2XN9 C;  5CTR C;  1WWT A;  2BYF A;  1MHH E;  2FAZ A;  2KMC A;  2OOB B;  3IXS A;  4NAW A;  2L83 A;  2N7E A;  1CS8 A;  2DX5 B;  1WXS A;  1BQI A;  4EIW A;  4US9 A;  3JR5 A;  2QBY A;  4LF9 M;  1TT5 B;  3A1Q A;  2Z3X A;  1FRD A;  4YYR A;  3GLG A;  4I6P A;  2J7Q C;  5FPW A;  2KQS A;  3V6C B;  3GPY A;  2ZNV C;  1NYQ A;  3FKY A;  1TS2 A;  4I07 A;  5LMU M;  2FCS A;  2YJ2 A;  4XYC A;  2ZPN A;  1NY6 A;  1FMA D;  3RMK C;  4BOZ B;  3BBZ A;  2IPK D;  5D94 A;  2G8L A;  4K3B A;  3OF8 A;  2D7G A;  1XXH A;  3KWV A;  4I05 A;  4X6J A;  1MHW A;  2QIE B;  2D07 B;  5C1Z A;  2ZTC A;  4FA6 A;  4ZRJ A;  5ITU A;  3ALB A;  2C9O A;  4N9F 4;  1TU6 A;  1YMH E;  2VH1 A;  3U52 E;  1OTR A;  1UWX A;  3BZD B;  2MCN B;  4II3 B;  3WAP A;  1W5T A;  4BBN C;  4B3R M;  5CHF A;  1TS5 A;  2D7E A;  1KLV A;  2HXZ A;  2DHR A;  1WRI A;  1E5W A;  2Y6E A;  4K0K M;  3RD2 A;  1TY0 A;  1PPO A;  2WS3 B;  4MEL A;  1HUC B;  4YY3 M;  5BMI A;  4LJ6 A;  2N1V A;  3DVN V;  5C18 A;  2AYN A;  2GOW A;  1JB0 F;  4ZHP A;  2K8C A;  3ZKJ C;  3PO0 A;  2KJ6 A;  4MGK E;  2CRU A;  2M5Z A;  3AI5 A;  3R9X B;  1RWS A;  1PYW D;  1VZ7 A;  4DXA B;  3UK6 A;  3L10 B;  3RCZ A;  1T0Y A;  2LRW A;  4KV2 A;  4BKG A;  3Q8F A;  2QP9 X;  2BTW A;  1Q5W B;  4GGQ A;  2LHE A;  4GDL A;  1WX7 A;  4LFA M;  3AMZ A;  2CV0 A;  1YAL A;  1XMO M;  1VCB A;  2DAK A;  3KX1 A;  3U6O A;  1AIM A;  2ASQ A;  2K8H A;  4IW0 A;  3CSF A;  2KOX A;  3MTN A;  3H6N A;  4MH0 E;  4YVA A;  3E4R A;  2XFS A;  2ZCC A;  1Z59 A;  2LXC A;  4JIO U;  4OHJ A;  4PYZ A;  2VQF M;  4MB7 A;  3Q3N C;  4KGT A;  3LB8 C;  2SEB D;  1EM7 A;  1IY2 A;  3WXG A;  2JA2 A;  3OLM D;  3PHW A;  5I4D A;  2HWK A;  3C19 A;  4AXL A;  1G4A E;  2KD0 A;  3WHK A;  5FR6 A;  2CJO A;  4PD2 A;  5CHV C;  3UJN A;  1UD7 A;  4B0E A;  1KFU L;  2PAD A;  2XU1 A;  2IY0 B;  2FCN A;  3SAV A;  3I4Y A;  1PPN A;  2KAN A;  4HK2 A;  1WX9 A;  1XO3 A;  1NLJ A;  1YN4 A;  4RMA A;  2ARY A;  2JY8 A;  1N78 A;  3UF8 A;  2X49 A;  2WXH A;  4FD2 A;  3QAR A;  4I4L A;  1DEU A;  1MI0 A;  2YEP B;  3PT2 A;  2DHZ A;  5DFL A;  3LCV B;  4EUT A;  2WSE F;  1Y56 A;  2QSF X;  1TIF A;  2R2O A;  1V34 A;  3MOR A;  4KDI C;  3FRH A;  2E00 A;  1CMX B;  2DEN A;  2MP2 B;  3Q8G A;  1HXY D;  4KO8 A;  4JI5 M;  2WXM A;  3QYE A;  1EWO A;  2WX1 A;  3R2T A;  4FUL A;  1WXM A;  4XZX A;  2RPV A;  2J7Q B;  4N79 A;  2K8B A;  3L25 A;  2ZNV B;  5IN7 A;  1L2C A;  1F2A A;  4BOU A;  1I7H A;  1KH0 A;  3P42 A;  2L2D A;  3IOQ A;  2OOA A;  3MHZ A;  1V49 A;  1STF E;  5JI3 E;  2H88 B;  1UWM A;  1IN4 A;  5BYS A;  1A5R A;  1ORY B;  2BJW A;  1OAO C;  1TH2 A;  2AWT A;  4CYE A;  3K2L A;  1GEC E;  2DCC A;  2KLG A;  4G4O A;  4A8X C;  2KW0 A;  1RFA A;  3W5V B;  1YK7 A;  3U60 A;  2LAS A;  1BGO A;  3LQQ A;  3MJ5 A;  4GMQ A;  3P4Q B;  2BNK A;  2EMS A;  4F2L A;  3P63 A;  4LJO B;  8PCH A;  1I4W A;  1SE9 A;  2FNJ B;  3PXG A;  5ITT A;  2JY7 A;  1SEB D;  1Z2M A;  1XLN A;  1WGD A;  4C00 A;  4QNR A;  1WGK A;  2DYB A;  2CJN A;  7CAT A;  2XZU A;  4WIP A;  5G55 A;  4QH6 A;  3SMP A;  4MSQ B;  2KK8 A;  1O0E A;  1MX0 A;  3H7S A;  4DV5 M;  1P1A A;  3T6P A;  4F7Z A;  2L76 A;  2W3R A;  2YVC A;  3RNA C;  2I2Y A;  2L00 B;  2CHG A;  4AI6 A;  1QYR A;  1PAD A;  1SE2 A;  4DHZ E;  4XUI A;  1HQC A;  2C9C A;  2UU9 M;  3QJ3 A;  3OG5 A;  1PPP A;  1PGY A;  4QHS A;  3DOW A;  3B9P A;  3KUC B;  4GKJ M;  1YT7 A;  3SAU A;  3T9L A;  1G71 A;  3QIJ A;  3KWB X;  2O6V D;  4GEW A;  2OJR A;  1SIJ A;  1CVZ A;  2ONQ A;  1EUV B;  3DVG Y;  4FW9 A;  4W5W A;  3CF0 A;  2V6Z M;  2ZCB A;  4JI4 M;  2AX5 A;  3U6Q A;  3OVX A;  1N5X A;  2NS5 A;  2NQA A;  2RPQ A;  1J0G A;  1DYQ A;  3AE5 B;  3TMP B;  1UZX B;  2YJ8 A;  2L7I A;  3AOG A;  2G4S A;  4D8B A;  4XGI A;  4DMY A;  4HCN B;  3OF9 A;  4NOO B;  1NV9 A;  1JQJ C;  4LJ7 A;  3ZDT A;  2J7O A;  3I5J C;  4MI7 A;  3IAS 1;  1D3Z A;  2J52 A;  1ZGU B;  1GPX A;  2FNA A;  1C78 A;  2J0K A;  2FFJ A;  2F4V M;  3MTV A;  1EF5 A;  4GC9 A;  2ON8 A;  2WLB A;  4WW0 A;  2XZF A;  1L4Z B;  3T1H M;  3CTW B;  1VQ1 A;  1IFY A;  1E9S A;  4G4N A;  1T3Q A;  2V3N A;  1JCK B;  3WIM A;  1EWP A;  3HVZ A;  4HPP A;  2ACZ B;  3FTC A;  2WXF A;  3S2A A;  5IZ7 D;  4BOP A;  1NYR A;  4XWW A;  4ASW C;  4CDF B;  1WF9 A;  4PP1 A;  1GJZ A;  1C1K A;  3TMP A;  1V9J A;  1SJH D;  4AWJ A;  2NBW B;  2E03 A;  4BFR A;  4XK8 F;  3BPM A;  4B7G A;  2VF7 A;  4WWN A;  3FIL B;  2QHO A;  4YYQ A;  4DUZ M;  4AP4 C;  1WR1 B;  3QAU A;  3RI7 C;  4YL8 A;  3H4J A;  3ML8 A;  4M02 A;  1LV7 A;  3EGR A;  5TSS A;  3WCQ A;  4XBO A;  3P4R B;  5EE3 A;  5K16 A;  2J5Y A;  1CJL A;  2YJ9 A;  4NQK E;  1XB2 B;  3ZNI D;  2I1K A;  3IV2 A;  1EFU B;  2YFQ A;  4ANW A;  5J94 A;  2BKR B;  2PJH A;  4LZZ A;  2ZVO A;  4DUY M;  3I63 C;  1E9R A;  3KS8 A;  4IBK A;  2UWQ A;  3S3Q A;  1D2N A;  1NHW C;  2FID A;  3N4C A;  3CBJ A;  5A2Q S;  2A4Z A;  3GZN B;  5JXV A;  3D8B A;  4DDI D;  3Q3O C;  3DPD A;  1IP9 A;  3CF6 E;  3FYC A;  4NXM M;  4QRX A;  1EE8 A;  4AQY M;  1VZ8 A;  5KPR A;  1BP4 A;  3N1Y C;  2FRA A;  3KWZ A;  4QRV A;  3DVG X;  4P16 A;  3ZCB B;  4ZUX U;  1GKI A;  2FBW B;  3NVW A;  4JI6 M;  1PDX A;  2DZJ A;  3VRB B;  3W0L B;  3VHT C;  2LI5 A;  3H8C A;  1GG3 A;  3Q8B A;  2LGI A;  1IGC A;  2KRK A;  3L4P A;  3H8B A;  2AEH A;  1V8C A;  3R66 C;  2AYO B;  4OVV A;  4A3V B;  1NNJ A;  4OW0 A;  4A5U A;  1MJD A;  4C56 C;  4HLQ A;  3EFC A;  3TEZ A;  4D81 A;  2OUL A;  1QT9 A;  3BK2 A;  2NTT A;  3AE4 B;  4AKI A;  3AH7 A;  2MBQ A; 
#chains in the Genus database with same CATH homology
 1JR3 A;  2B76 B;  3ZGZ A;  1T3T A;  3GLI A;  2LMC A;  5EP3 A;  3SHG B;  1GL7 A;  2FE8 A;  2LFI A;  3GLF B;  3VRA B;  3KSJ A;  1HQY E;  1NJF A;  2WQY B;  2V4I B;  1I4G A;  3VR9 B;  4L8R C;  4MGY E;  3AE1 B;  1JR3 D;  3AM9 A;  4YSX B;  2C5R A;  3VKH A;  4TQ1 A;  4L2Y A;  4Z8X A;  3BVZ A;  1JWB D;  4LK0 M;  4ITQ A;  3LVW A;  3K92 A;  3RFW A;  1XLQ A;  2WNM A;  1ZXH A;  1HT1 E;  3IAM 1;  2EKI A;  3W2D A;  1TJE A;  2DWN A;  4PT5 A;  5EQT A;  8CAT A;  2KAC A;  1L8Q A;  1KTK A;  2M19 A;  3BK1 A;  3MK6 A;  3ZJV A;  3D8L A;  4NSO B;  2BB5 A;  1TDZ A;  3O65 A;  2K9X A;  2DVW B;  3I51 A;  1XMQ M;  4RNA A;  4PDG A;  2ICI A;  1VR9 A;  3AE3 B;  1SE4 A;  3FTD A;  3U6S A;  3AJI B;  3AE8 B;  2Y3A A;  2J42 A;  3AOE A;  2R45 A;  1J7K A;  5HHD G;  3E56 A;  1XNQ M;  4DR7 M;  2HDE A;  2YEP F;  5FR3 A;  5KPZ A;  1KSF X;  1VDD A;  4CHT B;  4YWG G;  2AQ3 B;  3ZC7 B;  1Q3C A;  3HUI A;  3HJ8 A;  5FTK A;  1TS3 A;  2UXD M;  1EU3 A;  4KGR A;  3PSE A;  1Z5C A;  4XE0 A;  5EE9 A;  4M0W A;  5ITQ A;  1TH3 A;  1WYG A;  3U6L A;  1FNU A;  3RPF C;  2DWZ B;  3OTO M;  3ILK A;  3U6P A;  1IBL M;  3SR6 A;  5H92 C;  2Y0Q A;  1Z5A A;  3TRK A;  1NVM A;  3KOW E;  4WQM A;  2WXO A;  4CGY B;  3PZ7 A;  2NMQ A;  4IBC A;  1G41 A;  3TSS A;  3P4S B;  3V3X A;  4IDI A;  1FD6 A;  1T6B X;  3J27 B;  4AS1 A;  2BT6 A;  1F77 A;  1G59 A;  2ERC A;  1L0X B;  3IG5 A;  1QKZ A;  3HGI A;  4DV1 M;  3TEX A;  3SFD B;  1PGA A;  3W1S A;  1IM2 A;  1TGU A;  2XSZ D;  2JX5 A;  1Q39 A;  1OFI A;  5FTJ A;  1TS4 A;  3U6E A;  4JXJ A;  3GQ4 A;  1GB4 A;  5EZS A;  4QNM A;  4B3M M;  5E6J A;  2NQ8 C;  4RCO A;  4LJA A;  3AFH A;  4NAW B;  5EXS A;  1TKG A;  2DZO B;  1PJJ A;  3FUW A;  3EA6 A;  2QBY B;  3L28 A;  2UZJ A;  4ITK A;  1VLB A;  2IGD A;  4HRO A;  3AKZ A;  3KW6 A;  1CJE A;  4R3D A;  3HKP A;  2UXB M;  1L0V B;  1XXH B;  4OZA A;  2KA6 B;  4CIS A;  1NY5 A;  1ZOY B;  1F0Z A;  3AEB B;  2VZK B;  2WXJ A;  4JI2 M;  1QF6 A;  1QAN A;  2QSD A;  1YSY A;  2CEA A;  3L26 A;  2KZU A;  4FCT A;  2RMM A;  1R2Y A;  1QAQ A;  1QQW A;  2FUG 1;  1QOF A;  2JZP A;  1XHB A;  4L15 A;  5BPV A;  1DGJ A;  1QOB A;  3KP1 E;  3FTF A;  5G5H A;  1GB1 A;  1E32 A;  3AED B;  4AG6 A;  4YTP B;  2EUC A;  1QAM A;  5GKN A;  4AKG A;  4N6E B;  1NEK B;  4JPS A;  1FFU A;  2BTW B;  4DV4 M;  4GDL B;  3HVD A;  4D80 A;  2WXL A;  3Q8C A;  3GRY A;  2BS3 B;  3TE6 A;  3EIE A;  2MJ3 A;  4L1B A;  2DWL A;  2WXI A;  2X8A A;  1I4H A;  1JWM D;  3BVM A;  4WAF A;  3HU1 A;  2D5G A;  1VRA B;  3MC0 B;  3SYK A;  3W0F A;  2KWD A;  2JWU A;  3HHZ A;  1R7R A;  2MEK A;  4LLG M;  1E0Z A;  1KFV A;  4LFC M;  1HQR D;  2DYO A;  1N62 A;  2C99 A;  1XCT L;  4L4U A;  5F3W A;  3TWK A;  3NVZ A;  2X38 A;  1IQP A;  5EXT A;  2LUM A;  4LY6 A;  2QPA A;  1JAL A;  3M6A A;  3TQS A;  2CHQ A;  3BBA A;  3W5U B;  2W55 A;  1TH4 A;  4S12 A;  3BB7 A;  3SEB A;  3B2G A;  4C80 A;  3KOY E;  2LJI A;  3MP9 A;  4LG2 A;  1HZ6 A;  3WHL A;  3AEF B;  3FKE A;  4IBD A;  2HTM E;  1DGH A;  3Q8A A;  5E26 A;  2N9K A;  4UDU C;  1B1Z A;  1TYG B;  3U60 B;  2F5S A;  3PFI A;  2K22 A;  1QQR A;  3HJS A;  4ARI A;  1AYF A;  4LCB A;  4YXD B;  1FM0 D;  1K50 A;  1K51 A;  3CWI A;  4D2K A;  1J5E M;  5EE1 A;  4IBG A;  1N61 A;  2QEN A;  1Z5B A;  2DOS A;  1L1Z A;  1RFK A;  2WDQ B;  4RF0 A;  3AEG B;  2L6O A;  3FUV A;  4N58 A;  4FVM A;  4XDC A;  2L1A A;  4NJC A;  4RFB A;  4NAM A;  3NVY A;  2LEK A;  3KS4 A;  3BOS A;  3PNY A;  4JV5 M;  2J53 A;  3C8Y A;  2EA0 A;  4DV0 M;  3LYY A;  2DWM A;  4C7Z A;  4OVZ A;  3GPU A;  2K5P A;  4DR5 M;  5EXP A;  2Y21 A;  3GRR A;  3ZJT A;  4A6Q A;  4DV3 M;  4RKX A;  3VR8 B;  4II7 A;  3GP1 A;  1HNX M;  2R4E A;  2GI9 A;  2K47 A;  4FCV A;  2Y5P A;  1TDH A;  3JR4 A;  2BS4 B;  2PMV A;  3VFD A;  3L2A A;  1DKI A;  1FJG M;  1XXG A;  4I81 A;  3DOA A;  4RF1 A;  1FIQ A;  3HU2 A;  4MM3 B;  3HHY A;  4LTU A;  1CK1 A;  4DV7 M;  1FXI A;  1YN3 A;  2Z8L A;  2GRI A;  3BYY B;  5C2T B;  2R4J A;  4ZHO A;  1X37 A;  2GB1 A;  2LH0 A;  1HA5 A;  1TKE A;  3ABV B;  2PVG C;  1HNZ M;  3GRU A;  3KDS E;  1HZ5 A;  3T15 A;  2K3U A;  4AG5 A;  1OJL A;  2CV1 A;  2BW2 A;  3U4E G;  4GRI A;  3AEC B;  3KFU G;  4OX9 M;  4NZL B;  3KSX A;  3BYT B;  2D7H A;  5FKA C;  3AOE C;  2X4A A;  5H8Y E;  2QIL A;  1L1T A;  1N33 M;  2WU5 B;  4FCW A;  1V1P A;  1SF0 A;  1IN7 A;  1H6U A;  1XC8 A;  3I9V 1;  1SXJ D;  1GL6 A;  2M60 A;  2WXK A;  1WSP A;  3RE8 A;  1SB3 C;  5FSW A;  2AQ2 B;  4AQ7 A;  2VII A;  4A9A A;  4LJ5 A;  3GQ3 A;  1EU4 A;  4HEA 1;  1F2R C;  2KZS A;  3BWU D;  2KEB A;  1EWC A;  4KHP M;  3GLI B;  2A5Y B;  1FNN A;  1R2Z A;  2ZBK B;  1ESF A;  3TUO A;  4NXN M;  1ZPS A;  4IP3 A;  1XF5 L;  2UUA M;  4JX1 C;  3VDP A;  1SXJ E;  1N75 A;  4KLN A;  3T3N A;  3DZD A;  2J4X A;  5HI1 A;  3GLH A;  2P5T A;  2OPF A;  5BR8 M;  3A42 A;  4GUA A;  1YJJ A;  4YTN B;  2IDY A;  4H2A A;  4P6V F;  1SXT A;  4LJ9 A;  1BXT A;  2BBC A;  1VDV A;  2HHH M;  2PTL A;  4XWT A;  3ZNH A;  3SAW A;  5EP2 A;  3I57 A;  3AL0 C;  1L6V A;  3KOX E;  5BYQ A;  1LO5 D;  1YZB A;  4IBI A;  2DXI A;  1PM5 A;  1A70 A;  2R18 A;  5C3J B;  4GHA A;  2W82 A;  4B3S M;  2R65 A;  1W5S A;  3AV8 A;  1AN8 A;  5KQ8 A;  1NSF A;  3KP0 E;  3RNV A;  3TEY A;  1N77 A;  1N32 M;  1Z6T A;  4HL4 A;  1MU5 A;  1I4X A;  5ITX E;  3K8Z A;  4B3T M;  3PRP A;  2TSS A;  1DGB A;  2HKJ A;  1ET9 A;  3NS1 A;  1CQV A;  4USA A;  3U7Z A;  2AQ1 B;  3AN1 A;  3SMS A;  1XWI A;  1FCC C;  1C9F A;  1K52 A;  2QJL A;  4KGS A;  4HRS A;  4MGZ E;  5EJC A;  4YTM B;  4JN6 A;  1IY1 A;  4M9S A;  2LWX A;  3MFG A;  4YT0 B;  3J2P B;  4NL4 H;  4GH9 A;  3J9C A;  2L09 A;  4BBA A;  1VZ6 A;  1DO2 A;  1HR0 M;  4NSR A;  4LJ8 A;  1SE3 A;  1C4C A;  3NRZ A;  2Q2E B;  3U61 A;  1DGG A;  3B2F A;  3HU3 A;  2SAK A;  2RKO A;  5BMG A;  3J80 S;  3SFZ A;  2HL7 A;  4A55 A;  4CQN A;  3E9S A;  4MT5 A;  3SC3 A;  2I38 A;  5FK9 C;  3FUX A;  1HNW M;  5JZE A;  2XF3 A;  1HEZ E;  2WXQ A;  1NVI D;  2PIA A;  1E10 A;  4DR3 M;  2CHV A;  4DR4 M;  1QOA A;  5EP4 A;  1DGF A;  2JYE A;  5FLX S;  3M0E A;  2IGG A;  3JAM S;  1IGD A;  2JQR B;  4ZYS A;  2G5G X;  4MGH A;  1UGJ A;  2XSZ A;  1GOZ A;  4B08 A;  3W9C B;  3FAH A;  2ZW0 A;  2INP E;  4KX6 B;  1K53 A;  1YQ4 B;  2L7H A;  4TMA B;  2G1E A;  4IBJ A;  1XNR M;  1UNS A;  4LF8 M;  3FUT A;  3URY A;  1I4P A;  2KAJ A;  3PRM A;  4WH4 A;  4QOS A;  3AE7 B;  4MAC A;  1J09 A;  3GQ5 A;  4D8I A;  2N0S B;  2N9L A;  4G4Q A;  2PKO A;  1BML C;  4MGI E;  3U6M A;  1YJI A;  4L78 A;  2WXG A;  4HXD B;  4ZRP A;  1ZAE A;  2MJE A;  4J3O D;  2W3S A;  3B9J A;  3GPP A;  3H4M A;  4AW4 A;  2Q5W D;  1I4R A;  2E6X A;  2F5N A;  5LNK 1;  2Z7J A;  4JWS C;  3EUB 2;  3H8H A;  5EE0 A;  3HHW A;  1Q3B A;  2WDV B;  5G5G A;  1ZUD 2;  3UZU A;  2BTE A;  2QZ4 A;  3IG8 A;  1YQ3 B;  1FFV A;  3U5Z A;  3SAT A;  3AE2 B;  3QWL A;  1KFY B;  4YSZ B;  5FTL A;  2UUC M;  2ZAM A;  1D5X C;  1FO4 A;  1ZE3 D;  1DO0 A;  4RGT A;  2EO2 A;  1ZDX A;  2MH7 A;  1DOY A;  3EIH A;  1V1O A;  2CUZ A;  2JTC A;  2V1U A;  1IBX A;  2Z84 A;  3PVS A;  2RDG A;  1JWU D;  1D4B A;  3GRV A;  2H1R A;  2F5Q A;  2PLP A;  3BY4 A;  3J7A S;  1IXS B;  3A98 B;  2KQ4 X;  4IJF A;  4JE3 B;  4G4R A;  3FD9 A;  1OQR A;  1YNT E;  4JI8 M;  3V05 A;  1YUB A;  2OED A;  4ZOH C;  1N36 M;  1GLN A;  3FUU A;  1C79 A;  4DR6 M;  4IIW A;  2BB6 A;  3SAR A;  1UM8 A;  5KQD A;  2KRU A;  3THG A;  3P1M A;  1UUP A;  3UI3 A;  4BOZ A;  4OZB A;  2JU6 X;  3A46 A;  3HRD D;  3DFZ A;  4C7Y A;  2L52 A;  2R46 A;  1SXJ C;  1I94 M;  4JI3 M;  1J7B A;  1J7C A;  1QZM A;  1JQ4 A;  2VZK D;  1RYJ A;  3Q8E A;  1V97 A;  4I8O A;  4MH8 A;  1MHX A;  1QOG A;  5ITY A;  2PVO D;  1DGH B;  3MHV C;  4JWU C;  2Z4R A;  1ZQ9 A;  5FTN A;  3BVG A;  3SYL A;  2ZM6 M;  3O13 A;  2Y5C A;  3KLS X;  1JML A;  1ZXI A;  1PJI A;  5MPO A;  3AE9 B;  4DXF A;  4HJG E;  1QIL A;  1XEE A;  4LFB M;  1FRR A;  3Q69 A;  3R8F A;  1L4D B;  1P7E A;  1SBB B;  5IT9 S;  1IXR C;  4M9X A;  4Q2J A;  4I5S A;  4Z6Y A;  4BOS A;  4LGY A;  4LRS A;  4LRT A;  2YNM D;  2E3T A;  2R62 A;  4LF4 M;  2NTS A;  2XNA C;  1J7A A;  4NRW A;  3AV0 A;  1E9M A;  4M9Z A;  4OVZ B;  4B0M A;  2N7J A;  4FXC A;  4IBE A;  3GPX A;  4US8 A;  3LVV A;  5C1B A;  3U6C A;  2WXN A;  1EWY C;  2XEP A;  3A45 A;  3GB1 A;  4XDD A;  3L27 A;  2HCB A;  2M56 B;  3R8B A;  5KO3 A;  1IXZ A;  1XLO A;  2JYT A;  1KF6 B;  1RM6 C;  3FC4 A;  1PFD A;  3ZJU A;  1JRO A;  3J7B A;  1NEN B;  3KXE C;  4EE2 A;  5H37 D;  4QOZ C;  2J7Q A;  2YR0 A;  1JW9 D;  2BS2 B;  3UGJ A;  1I4Q A;  1MVK A;  1OFH A;  1GAQ B;  2KMM A;  5IRE B;  4IJE A;  4BLC A;  2KDM A;  3HWS A;  1PGB A;  3VK7 A;  2W54 A;  2R61 A;  1E6E B;  3AEA B;  4JYA M;  4ZTB A;  1SXJ B;  3GP7 A;  5LMN M;  2AHM A;  1BUI C;  4RGN A;  1XCQ L;  2RGH A;  3KWL A;  1D6E C;  2M0A A;  2BU3 A;  1OQQ A;  1FEH A;  1NNU C;  4IOI E;  1K82 A;  4IKG A;  5D3D A;  1QVR A;  4D82 A;  2FOI C;  2OQ4 A;  1IN6 A;  1KRH A;  2G9H D;  2QMT A;  4WUR A;  2LHD A;  3NBI A;  1ZP0 B;  1NJG A;  1SXJ A;  2ZAN A;  4ARC A;  2ZAO A;  4JI0 M;  5HG2 A;  1V1P B;  1IBM M;  4WWM A;  3IFU A;  3AB5 A;  4GC5 A;  3VK8 A;  1K3W A;  2CE7 A;  2L32 A;  1N5W A;  3NVV A;  5DYI A;  3U2S C;  2V1C A;  2ZW1 A;  4PCZ A;  1B9R A;  2KXE A;  3RGS A;  4AZF A;  1NI3 A;  1OFF A;  1XLP A;  4RH6 A;  2RDH A;  5DNY A;  1JWA D;  4ZRQ A;  5AUK A;  1YE9 A;  4HKZ E;  3U6D A;  1T5X D;  4A90 A;  3KOZ E;  2CV2 A;  4HKQ A;  3LMM A;  4TQ0 A;  2XFT A;  3GLH B;  3SAS A;  2WU2 B;  1KLU D;  4D8E A;  3DA1 A;  3UMM A;  1L6U A;  3AEE B;  4LZJ A;  2CFO A;  1E7P B;  4KKI A;  3T38 A;  2JXT A;  2KN4 A;  2IJ0 A;  1KYI A;  1IN8 A;  3FIL A;  5ITX A;  3MP2 A;  3TWM A;  2DLB A;  4LGM A;  4M0D A;  4X66 M;  4DV2 M;  1L0Y B;  3NWL A;  1L5P A;  3Q8X A;  5JI2 E;  3C0R A;  3CF2 A;  3DWG C;  2QEJ C;  2UXC M;  3L29 A;  2Y20 A;  4GIP A;  1TZO A;  4ZPX A;  3LXF A;  2DBY A;  5ITR A;  1ACC A;  2QCU A;  1QLB B;  1ZDV A;  4GLS C;  5EXX A;  3RFZ B;  4B7F A;  4GDK B;  1IUE A;  2E5L M;  1STE A;  3M7G A;  3VDU A;  1D5Z C;  4KKJ A;  2BJV A;  4TUW A;  3ZYY X;  3BII D;  3I4V A;  1KLG D;  2XGN A;  5EZQ A;  1ROE A;  1FCL A;  3K1J A;  1S3S A;  1DOI A;  3OQC A;  4X64 M;  3ZH9 B;  4BOQ A;  2XH9 A;  2IGH A;  4OZC A;  1PGX A;  2DYM A;  2BYT A;  3W31 A;  3GO8 A;  1CZP A;  1ENF A;  2H89 B;  1N60 A;  3OWE B;  4REZ A;  2J7N A;  3U61 B;  3TL4 X;  3GLF A;  4FWD A;  1SJE D;  3DWM A;  4BB9 A;  1Q10 A;  4DXG A;  2INN E;  3AE6 B;  3FYD A;  1P7F A;  3IT4 B;  4LF7 M;  2Z4S A;  1L2B A;  1PUT A;  1FNV A;  2I7N A;  1F2R I;  1FXA A;  4YSY B;  3RGP A;  3TWL A;  4R7G A;  2DWQ A;  2WXR A;  3PNV A;  3HHX A;  4LJ4 A;  5AUI A;  4RGM A;  1PVJ A;  2PW9 A;  2LXE A;  3GS2 A;  3CIR B;  2YQZ A;  2EEL A;  1G8P A;  1ET6 A;  3IT6 B;  2WXP A;  4GHL A;  1UKF A;  3VKG A;  3PHU A;  2WP9 B;  4DQO C;  2JRI A;  1TKY A;  4TSS A;  1TY2 A;  2C98 A;  2O5R A;  3ETR A;  5HFY A;  1QAO A;  4KOD A;  4FWG A;  4IBF A;  2XLJ A;  2OHF A;  4DV6 M;  2RGO A;  1K3X A;  3NUH B;  5DYG A;  2C96 A;  1JWS D;  3P4P B;  4L23 A;  5D7G A;  1JRP A;  4LF5 M;  3SHF A;  2K0P A;  4IBB A;  4DR2 M;  2V0G A;  1AW7 A;  1WXQ A;  2MJD A;  4JI7 M;  2F5O A;  5IWA M;  1VJK A;  3LQR A;  3W30 A;  4O1N A;  4IUM A;  3B21 A;  2F5P A;  1R7S A;  1IY0 A;  4B7H A;  2I7P A;  4QHT A;  1D5M C;  3TPZ A;  3VQI A;  4L16 A;  4DR1 M;  5BMH A;  3ZQ4 A;  4G6Z A;  1DOX A;  3KQ4 A;  3PZ8 A;  3T1Y M;  5D3I B;  1N34 M;  3TEW A;  1C77 A;  3HJQ A;  1NHG C;  1YN5 A;  1IBK M;  3R2I A;  3PHX A;  3T3O A;  3VLF B;  3SBJ A;  2Y0T A;  1MPE A;  4N59 A;  3N9Y C;  1GVN A;  3C58 A;  1L2D A;  1FNW A;  1R6B X;  3SFE B;  1C4A A;  1SSN A;  3FTE A;  5FTM A;  3U5Z B;  5BYR A;  4RGO S;  4PDI A;  2DZN B;  4OU7 A;  3NZ3 A;  1M4V A;  1N63 A;  2JSV X;  3J81 S;  1IN5 A;  1AWD A;  4YHH M;  2LNH C;  4X62 M;  4FWH A;  5EP1 A;  2AGA A;  1IBX B;  4LF6 M;  4JI1 M;  2UUB M;  1G3I A;  3KVW A;  4AKH A;  1C4P A;  2WDR B;  3GLG B;  5T8I A;  2V3P A;  4X65 M;  5KPT A;  4NRV A;  4GIT A;  1E94 E;  1HT2 E;  5GXG B;  2VQE M;  2CU3 A;  1C76 A;  4GKK M;  2XN9 C;  1WWT A;  1MHH E;  3IXS A;  2L83 A;  4EIW A;  4US9 A;  3JR5 A;  2QBY A;  4LF9 M;  2Z3X A;  1FRD A;  3GLG A;  2J7Q C;  3GPY A;  1NYQ A;  1TS2 A;  5LMU M;  1NY6 A;  1FMA D;  2IPK D;  2G8L A;  2D7G A;  1XXH A;  3KWV A;  2QIE B;  5ITU A;  2C9O A;  1YMH E;  3U52 E;  1UWX A;  3BZD B;  1W5T A;  4B3R M;  1TS5 A;  2D7E A;  2DHR A;  1WRI A;  4K0K M;  1TY0 A;  2WS3 B;  4YY3 M;  5BMI A;  4LJ6 A;  5C18 A;  4ZHP A;  3PO0 A;  4MGK E;  2M5Z A;  3R9X B;  1RWS A;  1PYW D;  1VZ7 A;  3UK6 A;  3Q8F A;  2QP9 X;  2BTW A;  2LHE A;  4LFA M;  3AMZ A;  2CV0 A;  1XMO M;  3U6O A;  4MH0 E;  3E4R A;  2XFS A;  1Z59 A;  4OHJ A;  2VQF M;  4MB7 A;  4KGT A;  3LB8 C;  2SEB D;  1EM7 A;  1IY2 A;  2JA2 A;  3PHW A;  5I4D A;  2HWK A;  1G4A E;  3WHK A;  2CJO A;  4PD2 A;  3UJN A;  4B0E A;  3SAV A;  3I4Y A;  1XO3 A;  1YN4 A;  1N78 A;  2X49 A;  2WXH A;  4FD2 A;  4I4L A;  1MI0 A;  2YEP B;  3PT2 A;  1Y56 A;  1HXY D;  4KO8 A;  4JI5 M;  2WXM A;  3R2T A;  4XZX A;  2RPV A;  3L25 A;  1L2C A;  4BOU A;  1I7H A;  1KH0 A;  3P42 A;  3MHZ A;  5JI3 E;  2H88 B;  1UWM A;  1IN4 A;  5BYS A;  1ORY B;  2BJW A;  1TH2 A;  3K2L A;  4G4O A;  4A8X C;  2KW0 A;  3W5V B;  3U60 A;  3LQQ A;  3MJ5 A;  4GMQ A;  3P4Q B;  2BNK A;  3P63 A;  1I4W A;  3PXG A;  5ITT A;  1SEB D;  1XLN A;  4QNR A;  1WGK A;  2CJN A;  7CAT A;  2XZU A;  4WIP A;  3SMP A;  1MX0 A;  4DV5 M;  2W3R A;  2I2Y A;  2CHG A;  4AI6 A;  1QYR A;  1SE2 A;  1HQC A;  2C9C A;  2UU9 M;  4QHS A;  3B9P A;  4GKJ M;  3SAU A;  1SIJ A;  2ONQ A;  4FW9 A;  4W5W A;  3CF0 A;  2V6Z M;  4JI4 M;  2AX5 A;  3U6Q A;  1N5X A;  1DYQ A;  3AE5 B;  2L7I A;  3AOG A;  4D8B A;  4XGI A;  4NOO B;  1JQJ C;  4LJ7 A;  4MI7 A;  2J7O A;  3IAS 1;  2J52 A;  1GPX A;  2FNA A;  1C78 A;  2FFJ A;  2F4V M;  3MTV A;  4GC9 A;  2ON8 A;  2WLB A;  4WW0 A;  2XZF A;  3T1H M;  1L4Z B;  3CTW B;  1E9S A;  4G4N A;  1T3Q A;  2V3N A;  1JCK B;  3HVZ A;  2ACZ B;  3FTC A;  2WXF A;  5IZ7 D;  4BOP A;  1NYR A;  4XWW A;  1C1K A;  3TMP A;  1SJH D;  4B7G A;  3FIL B;  4DUZ M;  3QAU A;  1LV7 A;  3EGR A;  5TSS A;  3WCQ A;  4XBO A;  3P4R B;  5EE3 A;  2YFQ A;  4LZZ A;  4DUY M;  1E9R A;  3KS8 A;  4IBK A;  1D2N A;  1NHW C;  5A2Q S;  5JXV A;  3D8B A;  3CF6 E;  3FYC A;  4NXM M;  1EE8 A;  4AQY M;  1VZ8 A;  5KPR A;  4P16 A;  3ZCB B;  1GKI A;  2FBW B;  3NVW A;  4JI6 M;  1PDX A;  3VRB B;  3W0L B;  3Q8B A;  2LGI A;  1IGC A;  2KRK A;  3L4P A;  1V8C A;  4A3V B;  1NNJ A;  4OW0 A;  4A5U A;  4C56 C;  4HLQ A;  3TEZ A;  4D81 A;  1QT9 A;  3BK2 A;  2NTT A;  3AE4 B;  4AKI A;  3AH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...