4R3DA

Crystal structure of mers coronavirus papain like protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
324
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Non-structural protein 3
publication title The Crystal Structures of Middle East Respiratory Syndrome Coronavirus Papain-like Protease and Its Complex with an Inhibitor
rcsb
source organism Betacoronavirus england 1
total genus 82
structure length 319
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08715 Viral_protease Papain like viral protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4r3dA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4r3dA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4r3dA03
4P16A 4M0WA 4OW0A 4RF1A 3E9SA 2FE8A 4MM3B 3MJ5A 5E6JA 5KO3A 4OVZA 4RNAA 4R3DA 4OVZB 4RF0A 4PT5A 4WURA 3MP2A 4REZA
chains in the Genus database with same CATH superfamily
3VR9B 3GO8A 1TDZA 1WX8A 1BUIC 5C3JB 2BYVE 1FCCC 2I1JA 3IFWB 1KHQA 3PRMA 4PI3A 2WXKA 4K81A 3RUIB 2BWES 2BYEA 3DHHC 4FJYA 4TMAB 3HWNA 2WSFF 2F5SA 4BKTA 2F4VM 3ZJTA 3Q8EA 3M0EA 1CJLA 1UH6A 1JQPA 4ZPXA 3GZNI 4JI5M 2QILA 2FOIC 2NVUI 3VKHA 3PRPB 5T8IA 4OVZB 3AEGB 3B9PA 1C4PA 2G3QB 2NBUA 2VDBB 2LGSA 3DVNV 3W31A 4ZHPA 3P42A 2G8EA 4IBEA 3R2TA 3V6CA 3W30A 2BVCA 3RNBC 1ZXIA 5C1BA 1F52A 3PNVA 3BYTB 4HWIB 3TL4X 2WLBA 1QYRA 2IGGA 3PT2B 2K0BX 5AZFA 1QXPA 4KDLB 4N59A 2DZKA 1NHGC 3J80S 1GOZA 4YTPB 4AKIA 1FCLA 3A9JB 3GB1A 2MHJA 3ZRFA 2C98A 3PW3A 4DV4M 4YT0B 2LH0A 4FHKA 2C96A 2Z59B 3IECA 3W5VB 3D8BA 3W68A 1ZGUB 2WXIA 3AEAB 1SXJC 3PHWA 3GQ3A 4E3CA 2DNAA 3P4PB 2IPPB 1B9RA 2JRIA 1N36M 5G5GA 3NZUA 5G55A 1WXAA 4NAWA 3C19A 3KLSX 3RZFA 3KSEA 1V80A 4RH6A 1ZUD2 3KDSE 4G0NB 5LNK1 3O65A 1H6UA 3SHGB 3SDLC 2QPAA 2QBYA 3QK0A 2DAEA 4IWQA 1KF6B 4X64M 4L4UA 5FSWA 4AZFA 1TBEA 1HEZE 3KP0E 1J5EM 2M5ZA 4D82A 4WJNA 5LMNM 3KS8A 1V1OA 3DBRB 4US8A 5J17A 1XQQA 2V4IB 2CIOA 1R4GA 1L6UA 1C4AA 4WW0A 3QCAA 3OJ4B 2WXLA 4ACFA 5JI2E 4D8BA 2WU2B 3AM9A 1QAOA 2N9PC 4S0RA 1XEEA 2V3SA 1IY0A 2VRRB 1NEKB 4K7UA 5FR6A 1YIWA 3HUIA 4MZOA 4CO7A 3TCAA 4Y28F 2DENB 3CF0A 3SARA 3KUCB 1IXSB 1C3TA 3SHFA 2LVOA 3B74A 3NS1A 2KK8A 3Q8GA 3FUUA 5C2TB 1ACCA 2VZKD 2ZW1A 4GDKB 4DR3M 4GH9A 2NQDB 3GRYA 5IREB 3AE3B 3N1ZC 2IY0B 2JU6X 3PFIA 1HE8A 5CHVC 3H8CA 5E6OA 3DBHI 1SEBD 2CFOA 1NY6A 3A42A 3J81S 2HJ1A 2FYEA 4KIKB 3MMPA 3TJPA 1Q1OA 1GABA 3K8UA 3UJNA 1MX0A 1GECE 2FCSA 3SEBA 2ZNVC 2DJGB 2WU5B 1V1PA 4CJ6A 5L95C 2FRQA 1Q6KA 4RGNA 4G4OA 3OQCA 2D10A 2IJ0A 2KLGA 2KWCA 1Z5BA 1KOTA 1F2BA 5D94A 4W5CA 2GBNA 3DBSA 2KWVB 2AUZA 1UUPA 3NUHB 2XZUA 4IBGA 1WMHB 2KKCA 2FAZA 2ZAOA 1MVKA 4HPPA 1KFYB 4M0WB 2BQQA 4F8CB 3PNRA 3USVA 4AJWA 2PJHA 1TTEA 3SBJA 3KYDD 4JI8M 4JI4M 1K52A 2DAFA 3AE7B 2P86A 3VK8A 1XXHE 3GLGA 3TUOA 1TH4A 2P0RA 4K3CA 2X4AA 2ZAMA 1UZXB 2QHOB 2DC6A 4OX9M 1IN4A 1WR6E 4BQVA 4KX6B 1XC8A 3HVDA 4FN2A 3ILKA 2D11A 1XMQM 2IYDB 4FCTA 4GGQA 5IZ7D 2F5PA 4LDTD 4FXCA 3UQAA 1VJVA 1I4WA 1WM3A 3A46A 2JY6B 1RFKA 1Q3BA 4JXJA 2XF3A 2INNE 2NQIA 3KX1A 2BTWB 3RULA 3WXGA 3BBAA 3TE6A 2V1CA 4HXDA 1DGGA 3U6SA 3RYTA 3DDCB 1F2RC 2KZRA 3B7NA 3WALA 5GXGB 4A3PA 4B0EA 2KFKA 2QQ8A 3VH3B 2WXNA 4ANVA 4IP3A 3UGJA 4NRWA 4I81A 2MBQA 4PD2A 2KHHA 2V0GA 4IC7B 3HJSA 3LXSA 5FPWA 1S4VA 1V5TA 4B95A 2Z4RA 4KZ0A 3HHIA 2C5RA 4W5WA 2J0JA 1L2BA 3ALBA 3B0AA 3IBEA 3TWLA 5JXVA 2AHMA 2R46A 2PLPA 4XBOA 1FNUA 4QNMA 2L0TA 2RSUA 2E03A 2HH5A 3K24A 4AWJA 1DV0A 2PW9A 1Q0WB 4UDUC 1KSFX 2J53A 1HR0M 2AYOA 1HNZM 3GPYA 1ZOYB 3KOXE 3QT4A 3FUTA 5CTRC 1IY1A 1FIQA 2DVWB 2KANA 3L08A 3PDFA 3AH7A 3PPAA 1CV8A 1D5XC 4G50A 1CJEA 1J09A 2Z3XA 4GHAA 4EFOA 1MG4A 5HFYA 1KLUD 1RU3A 2JA2A 4NJ6A 1SXJA 2GFOA 4LF5M 3VRBB 2ZM6M 4XR7A 2ZBKB 4LJPB 2Y5CA 2LHEA 2JX5A 2LTUA 1BT0A 3HKPA 3SD5A 3PLVA 3L16A 4II2B 4DHJD 1VRAB 1YK7A 1WR1A 4L15A 4GMQA 2M17A 3N32A 3I3TA 4YSYB 9PAPA 2QC8A 4N8WA 1NB3A 3R2IA 4FA6A 1PVJA 3RD2A 1NNJA 1N5XA 3RPFC 2XK5A 2XEWA 3DWMA 3W2DA 4CDDB 1VEKA 4MT5A 4RGMA 3ZVVA 4PCZA 2N9LA 2E00A 4XDDA 1WYWB 3A9KB 4EZJA 1ZDXA 2Y20A 4XYCA 3QHTA 1FMAD 1ICFA 4ZOHC 1PJTA 3L26A 1NV8A 5EDSA 4QBBA 1A5RA 2MP2A 5KPZA 1KFUL 2YR0A 2AYNA 5IN7A 1D0MA 4RF0A 4CHTB 2INPE 4L2YA 1PGYA 4R71A 2LHGA 1FFVA 3GPPA 2Z0DB 2JNHA 3GLHB 1N75A 4I07A 3LVVA 1YJJA 2O6VD 4FJVB 4L6V6 3ZTCA 4PK1A 3PHXA 2BWEA 1UKFA 1FXAA 4JV5M 2WXPA 4PS3A 4YTNB 1MEGA 1XLOA 2PE6B 3VAWA 3Q14C 4BLCA 3CIRB 2UXBM 2DAIA 2O6XA 1P3QQ 4IBDA 4P6VF 2EJSA 2KTFA 2XH9A 2RGOA 4PYZA 5CHVA 1JMLA 3AE2B 2Y0TA 2L3ZA 4N58A 5BMIA 3M99A 4RFBA 3L54A 1K50A 1MHXA 1V49A 3L29A 3O0UA 3PVSA 1QDQA 1SJED 2IY1B 3PHUA 1E32A 2WSCF 2NQAA 1E7UA 3WAMA 2RR9A 1DOXA 3EHVA 3LDZE 1EO6A 2WGSA 1WX7A 2YJCA 1EFUB 4DUZM 2DZMA 1D0KA 1TZ1A 3KWVA 3O1GA 5H37D 2UUCM 2GBJA 2KDIA 1J7AA 3TQSA 4RNAA 3N20C 4LRSA 4G3OA 4IG7B 5ITUA 2ZCBA 3IAS1 3NBXX 1V86A 3L4PA 3KW5B 3VTWA 1XT9B 2MWSB 5C18A 5CHFA 1BVSA 1IBMM 2BDZA 5CVMA 7CATA 4W9JA 4DK5A 3GOEA 1GC6A 3OF8A 3FUXA 2YJ9A 2D3AA 4JE3B 2DKLA 3SAWA 4A9AA 1TS3A 3HX3A 1QUSA 1S3SA 2MH7A 2WBFX 3NS8A 4C80A 1PJIA 1MJDA 4NOOB 2NTTA 5JI3E 1E7VA 4JPSA 4P7IA 1TU6A 1C7YA 2H7JA 3X23A 3L25A 4CZWA 2LGXA 1YE9A 2LVPC 3RGSA 1PJSA 5DCNA 3WHKA 1DO2A 3PNYA 3HGIA 3E21A 1JB0F 2GBMA 3CSTA 3CF6E 3SFEB 1ORYB 1VG5A 2DWQA 2ZEQA 2DZNB 2OZ2A 1FM0D 4MH0E 1PRBA 1V6EA 1D4BA 3DBLI 2EKKA 5A2QS 4OHJA 3AJIB 3SR6A 1TS5A 3GCBA 1Z6TA 3GPUA 2JSVX 4I04A 3W1SA 1Z2MA 3DWGC 3NVYA 1FNNA 5LXHA 2ON8A 2XSZA 3Q8XA 1L0XB 1EWLA 1BXTA 3R9XB 3I57A 1ZXHA 3P5UA 1YD8U 2OP3A 5ITRA 3ZYYX 3AEBB 4BBAA 2WXRA 3Q8BA 2L32A 3OISA 1RRBA 3NWLA 5KO3A 3SYLA 2UYZB 3PRPA 2CU3A 1PUTA 3JSVB 3WXFA 2V1UA 3E46A 1WGDA 1STFE 4OVZA 1I35A 2G3QA 2CUZA 2BBCA 1QILA 3PO0A 2VIIA 4DMYA 5BO4B 2IO1B 2D3BA 4EZKA 4KVGB 4LNIA 3ZXRA 4A55A 2WXQA 1XF5L 1GCBA 1W5SA 2M4NA 3PT2A 1XB2B 5LLIA 1QKZA 2N7EA 3PTFC 2IGHA 5EF4A 2KNVA 2W9NA 4JI1M 1S1QB 3J27B 3DHIC 1KFXL 2PADA 1VLBA 2HTHA 3QSDA 4LFAM 2XU4A 2AX5A 3LVWA 4D2KA 2L2DA 3MC9A 3QWLA 4PT5A 5ITYA 1GG3A 1PDXA 4F1IA 3B7QA 3IOQA 1WI0A 4LGYA 4NSRA 4NXNM 1NY5A 4GKJM 4LF4M 4BOSC 3JW0X 3OG5A 2CB5A 2KT7A 2LD9A 4RKXA 3HHMA 5DPTA 3N4CA 4MM3B 2BS4B 2KRKA 3T6PA 1YX6B 2KDEB 4HKQA 1I4RA 2M0AA 2OEDA 5D3DA 4DXGA 2HWKA 2KMAA 1OFFA 2G6DA 4QAYA 3RFWA 1F2RI 4O1NA 3D6SA 2CE7A 3P5VA 3RNVA 1PGXA 2XU1A 3ABVB 2KNAA 2WXJA 4I05A 2VZKB 1R7RA 3ZNGC 4ITQA 2OJWA 4YYUA 1WZ0A 5KQ8A 2G4DB 2K8BA 2CHWA 3MHHA 2X8AA 2KTRB 1QZMA 3PV1A 3UK6A 2DENA 2UXDM 4IJEA 1JROA 5C1ZA 1J7KA 2JWSA 1JWMD 4EEWA 2LGYA 1RWSA 1QOLA 4ANWA 3AV0A 2J4XA 1K8RB 1NO1A 4FWGA 4JIOU 4ARIA 3T3OA 5L8RF 2Y21A 4IM2A 2MEKA 2K6BA 1WH3A 2MBBB 2CHZA 1X37A 1L5PA 2MW5A 2LRWA 2GRIA 4ZRJA 1WGHA 1YVBA 4YY3M 4KIKA 1T43A 3HK0A 3NHEB 1JW9D 2NBWB 4XZ4A 2YJ2A 2K5PA 2DXIA 3QQ8B 3A33B 3I63C 2YEPF 4YXDB 3FTEA 3AE4B 5TR5A 2FUDA 1IUEA 2KVRA 4LJAA 1IBKM 2B1NA 2RDGA 2EELA 3CSFA 3DVGX 4MGZE 2B1MA 4A3OA 2KW0A 3HU3A 2O5RA 3N3KB 1TS4A 1WMHA 2KJ6A 5AEKB 4M01A 4DMXA 1NV9A 5FTNA 4ANRA 1KH0A 3Q3JA 1TL9A 4YL8A 1TH2A 4YVAA 5IWAM 1DGFA 1J7BA 1WRDB 2H89B 1IM2A 1SSNA 5HG2A 1WIVA 5JA7A 2N7JA 2DAMA 2LJ5A 3E4RA 4LDTB 2I7NA 1YX5B 2V3PA 1EWOA 1JWBD 3H8BA 2L05A 2C9CA 5DPSA 3ZH9B 2LVPA 2QHOA 2LRUA 3HVZA 2QCUA 1PJJA 1BGOA 4WJPA 1MU5A 1QQRA 3CH2X 5IOIA 3NBIA 3Q8CA 1DO0A 1V9JA 3HM3A 2PBHA 1Z5CA 1DOYA 3HU1A 1ZW7A 4WWOA 3U61B 1C76A 4ZTBA 2JY6A 2HKJA 2O01F 4IJFA 1U9QX 4HPLB 5KQDA 3Q3FA 2BTWA 1D5MC 3MHSA 1E90A 4CISA 3SMPA 5BYRA 5BPVA 2K22A 2OOBA 4NRVA 2LZ6A 4OZAA 1IYFA 3D8LA 3W0LB 2HE7A 1ESFA 4IM3A 4IBCA 2IZVB 4HEOA 2KC1A 2R9OA 3U5ZA 2DYBA 3ZC7B 3ZGZA 3U6LA 3U7ZA 2NQGA 1NYQA 1ZCMA 4Q2JA 1O0EA 4QHTA 2DZYA 5TSSA 1AU2A 3KFQA 4KGRA 4N79A 4XZXA 4M9SA 1YJ1A 1CK1A 2RDBC 2NPTB 2WP9B 3PS6A 1K3XA 1N62A 3HRDD 3BPMA 5EXXA 2AGAA 1D0LA 1P9DU 3ZTDA 3MTVA 1SXTA 3MJ5A 1GL7A 2LVQA 1MN3A 3BIID 2O2VB 1LV7A 1ZKHA 3VDZA 3AEEB 3U8EA 1R4NI 2ASQA 2JZ1A 4B7FA 4KGSA 1EIJA 4AXMA 1C1YB 2J0MA 2AEHA 3IT6B 2JXTA 5BMHA 3NOBA 1Z5AA 3LW5F 1I4HA 3IXSA 3UINB 4DHJB 5EXSA 3AEFB 4FJCA 2K1FA 3AU5A 4ZRIA 4HWYA 2DWMA 1R6BX 2FBWB 1P7EA 1MFWA 2KJHB 1IN8A 1OJLA 3ML9A 2LXCA 1ISNA 4HROA 4I6LB 3LQRA 2C7MB 1P0RA 1E9SA 5G5HA 4BOSA 3M3JA 4IW0A 3AI5A 4OZBA 3B2GA 1GC7A 2FT2A 2ZPNA 4WIPA 3N1XC 2RPVA 3D32A 5DYIA 3APFA 2KRUA 4BB9A 3AULA 2AQ3B 4JWSC 2QNJA 3L13A 1CSBB 1DGHB 3ZXVA 5A24A 1AYVA 3B89A 3A9KA 1JR3E 1UELA 4NPNA 4ZRPA 2DI0A 2LVNC 2HHHM 4USAA 3HY5A 1EM7A 3QJZA 3KP1E 4KV2A 3RMKC 1KFVA 5I4DA 2DZIA 2C9OA 3EFUA 3GE3C 3I04M 2SAKA 4I5SA 2ERCA 3MTNA 5IT9S 4TQ0A 2KHWB 1STEA 4KSKC 2K9DA 1OIZA 1E10A 4C7ZA 1AIPC 3GLHA 1WXQA 1OKSA 2WHIA 4B0MA 5BMGA 1OFIA 2FUHB 4W9LA 5JH5C 2W55A 1PYWD 2JF5A 2VH1A 1XHBA 2M8SA 4JI2M 1FO4A 1LQBA 2L52A 2VHSA 3CWIA 5EGWA 4ARCA 3MFGA 3T1YM 1CUKA 1D5ZC 2G9HD 4M0DA 4XWWA 1T5XD 3N9YC 1PPOA 2PNSA 2LWXA 2N4FA 4N6EB 1N33M 2AQ1B 4PP1A 1V33A 1L4DB 2FRAA 2WZJA 3HHXA 1GVNA 5C23A 1UWMA 4AG5A 2X8XX 4MGKE 1CQVA 5JH3A 2MGWA 2KOXA 5HI1A 2JUJA 2BPSA 3VVWB 1AARA 1A70A 1CB5A 3UI3A 4FJZA 2G4SA 4A8XC 4M9XA 3GRRA 1ET6A 2X38A 1NQCA 1IN6A 1G4AE 3TEWA 1L1TA 3SATA 2FCQA 4LNFA 4C4VB 2D3GA 2PREA 1MS6A 4ZUXU 3TNXA 3HWSA 3ZUNA 2E01A 2XZFA 3IHPC 2A5UA 2MBEA 1R4NB 4P1BC 3NVVA 1FH0A 3DF0A 2GOWA 2WWZA 3GZNB 4REZA 2DYMA 3BINA 1N61A 1AUAA 3WIMA 4DV0M 4MSMB 5JHAA 5DFLA 3F5VA 3EIHA 3O13A 4LCDE 1BQIA 1R7SA 3U6OA 2J7QB 4TUWA 4BKSA 2KYWA 1WIAA 1TF0B 1FRRA 2I38A 4R7GA 3BPFA 2R65A 2QIEB 2QSFX 2R4EA 2JY8A 2LASA 3P5XA 1F2CA 1T0SC 1FJGM 2XNAC 4HCNB 2MROB 1GB4A 4BOUA 3AU4A 1NHWC 2KXEA 3J7BA 1OGWA 4CHKA 2Y5BA 4OU7A 3CMMB 1ME3A 3OJ3A 2P5TA 3SAVA 1EU4A 2YVCA 1AYWA 4N4ZA 1VEGA 4A3VB 3FD9A 1N32M 4GEWA 2D3CA 3K9PA 1E94E 4AOFA 3AECB 1BY8A 4PADA 4QNRA 4JX1C 4W9IA 1CMXB 3RNFC 3CBJA 3EGRA 2WXOA 3K2LA 1Y08A 1GJZA 3VTVA 2R61A 3N30A 1AU4A 2Z0EB 1PGAA 2GI9A 5D3IB 3DPDA 2VF7A 2BWBA 3QWZB 2FUG1 3I01M 1NNUC 3QYEA 4P1CC 2K47A 4JI0M 2E3TA 2L76A 5FTLA 2J52A 5CX3A 1E8ZA 3U6QA 1EE8A 2LFIA 2D5GA 2XFTA 3JSVA 2TSSA 1AW7A 1OTRB 1KHPA 4X57B 3TSSA 3BC3A 4MJSB 3W1SC 2RRUA 3OWEB 3NVWA 1B1ZA 2WDRB 4NJCA 1WF9A 4HKZE 3FYCA 1XNRM 2RDHA 2L0FA 2KO3A 3IG3A 1G8PA 3AOGA 1WY8A 2AQ2B 2BU3A 3KXEC 2P7UA 1TKGA 2ATOA 3RT3B 4AQ7A 3HIZA 2QMTA 3SFZA 2GLSA 1SE2A 1UFZA 3EECA 4QH6A 3GS2A 3H8HA 5E26A 1BMLC 3MK6A 3KOZE 1EF7A 4G11A 1QT9A 3GQ4A 4LNKA 4IBKA 2NS5A 3DBHB 3VUXA 4Z6YA 3CH3X 2BS2B 2N1WA 4B3SM 5H92C 4LJ8A 2ZCCA 5KHQA 1WE7A 3GLHE 2N7DA 5EP1A 4MACA 4M8NA 1RM6C 3OF9A 4IBBA 3T1HM 1IWDA 2C5LC 5IAAC 1HNXM 2KDMA 4WJOA 3IUTA 3T15A 2WXGA 3B21A 3HD3A 2N35A 3LYYA 3B2FA 1FFUA 2QDFA 1MG8A 1N6ZA 1F29A 2DX5B 2RPQA 1CZPA 5CHWA 1Z5SB 2NQ8C 3AFHA 1Q5WB 3RGPA 1NB5A 3B79A 2N0SB 3HZJA 2MJ5B 4EZLA 2HD5B 1HTQA 3SFDB 1ATKA 4FD2A 1WRIA 2AL3A 3FE3A 4DBGA 5JZEA 1Y8RC 3CGWA 1XNQM 2VQFM 2DAKA 3P1MA 2R6FA 1A5TA 1D3ZA 1UF0A 2I7PA 4DHZB 1V92A 2KTRA 4AG6A 3NZSA 3PVLA 3RNAC 3OVXA 3PXGA 4MEMA 5G2NA 2MSED 2Y3AA 4EKUA 3J2PB 4YWGG 3F75A 4BVUC 1VZ7A 1P98A 2G7YA 1OAOC 2J7NA 1L0YB 5E6NA 2ONQA 2IO2B 1QANA 4LJ4A 4KSLC 2UWQA 3DOWA 1OEYA 3MC8A 3W9CB 2ZANA 2MJ3A 3IAM1 2KACA 1NVID 4B7HA 2CU1A 2ZZPB 3PREA 2R44A 3I5JC 1HJPA 2W54A 1X1MA 4YHHM 2R0IA 3NHEA 2KQSA 5AZHA 3IHPA 2B76B 2FQ9A 1VZ8A 3AE6B 4GB9A 3TPZA 1WGNA 3LCVB 2LXEA 3PSEA 1KJTA 4DV6M 4J3OD 4OZCA 4C56C 3BVZA 4B6WA 2EMTA 2WDTB 3E1ZB 4G54A 1AU0A 1XXGA 4K7SA 2LJIA 2BB6A 2Z8YM 3N3KA 3B9JA 1QUTA 2L6OA 4KLBA 3THGA 3PZDA 2R9MA 3GLFB 3K9OA 5KPTA 1EWPA 2HDEA 4KZCA 3DCGA 1QMYA 2N9EB 3W0FA 1K82A 2DBYA 3V76A 2KFJA 4MZSA 4IBFA 2B3TA 2W3SA 3V3XA 3NZ3A 1K3BB 3FAHA 4K7CA 3FTCA 2UU7A 4X66M 2LGDA 3U60B 3VKGA 3WCQA 4P17A 2G45B 3BZDB 3APDA 3I9V1 2J7QC 2DJFB 4LNNA 2JQRB 2C99A 3T3NA 3U61A 1JALA 1ZMVA 1TYGB 3E56A 1TTNA 2K3UA 3A98B 1L4ZB 1XO3A 4AP4C 2RGHA 4BBNF 3GQ5A 2OHFA 2XU5A 4GOCA 2FE8A 1F2AA 2ZTDA 3IFUA 2GBKA 1FNVA 1QDRA 4AJYB 3H89A 3KW9A 4LJOB 4LFCM 5D7GA 3KW6A 3GLGB 4W9CA 1I4GA 2WXFA 3RCZA 4BOPA 2QZ4A 3C3DA 3AL0C 4M8MA 3U7DA 1TDHA 3RI7C 2SEBD 3KUDB 4HPMB 2DHZA 4IM0A 4NZLB 2W3RA 2BWFA 4DWFA 4CIZA 1IGCA 2FIFA 4K1RB 1ROEA 2QEJC 2YFQA 3KWBX 3VDPA 4YYVA 1N78A 3ZIMA 3F92A 3V6EB 2K39A 2JXNA 2CV2A 4G3XB 1ZIVA 3PBHA 1ZQ9A 2RGFA 1YN3A 1BP4A 1QOAA 4HCPB 3VTUA 3Q8AA 3X0WA 2YJ8A 1NVMA 1ITOA 1NJFA 2R9FA 3JR5A 1TGZB 1J8CA 4LF6M 1RLFA 2DHYA 1L2CA 4GN1A 4II3B 3MHSD 4B3RM 2JZPA 3ZNID 5L83A 2H88B 2VF8A 1SE3A 1V81A 1UGJA 2R6NA 4W5BA 1Y8GA 2KXJA 1PXVA 2JWZA 2XBBC 1CPJA 3A9JA 3C9PA 2E5LM 4W9FA 3IT4B 2L4FA 5EJCA 3AE9B 1K53A 3OTOM 1TKYA 3C0RB 3VFDA 5PADA 1UWXA 1OQRA 1V2YA 1WGRA 3TBLD 1C1KA 1IQPA 1XCTL 4W9KA 1QVRA 2L4EA 2K6DB 1LGRA 1DGHA 1SBBB 4XGAB 4MSQB 3SHQA 1YLAA 4B08A 4KKIA 2E6XA 2QSDA 4URKA 5K16A 1T0YA 1D2NA 1PADA 1HNWM 2LVQD 3I4VA 3MHVC 2WSEF 2DCAA 1XLQA 2KVZA 3AKZA 2MJEA 2OO9A 1MIRA 3CF2A 4K3BA 5EE9A 2DZZA 1AYUA 1DGJA 2KN5A 1MEMA 2HTME 4GIPA 5EXPA 1GLNA 4GSWA 4MELA 3RE8A 4B3MM 3UIOB 1PE6A 1D6EC 4D81A 4C00A 2BJVA 4ZDVA 1MDWA 4WWNA 1TZOA 1Y4HA 1OQYA 1K51A 4GRIA 3TWMA 3SASA 5BR8M 2MR9A 2WS3B 1I4PA 4JI7M 1XMOM 4YYRA 1JR3A 4JL9A 3TMPB 5E6JA 1UBIA 1IXSA 1KXRA 1V34A 3PRZA 4DQOC 5E6PA 3GE8C 1YNTE 1F77A 2PPHA 1QAMA 4QOSA 2BYFA 4S12A 2M56B 2REXA 4GDKA 4M02A 3GRUA 4M00A 1DGBA 1L6VA 1T0RC 4WAFA 1GMYA 3M7GA 5BYQA 3KWLA 3LB8C 1YZBA 3DBLB 1U9WA 2HHNA 4XUIA 1IY2A 1WE6A 3QJ3A 2JPHA 3Q3MC 2G8LA 4FCVA 1R4MI 2CR5A 1U9XA 2C7HA 1H4RA 1WXVA 2KNZA 3M6AA 2Q2EB 1WSPA 4JI3M 5LXIB 3ENEA 3Q3OC 3BWKA 5IKCM 1P1AA 1YK8A 3KSXA 1IGDA 2Z8LA 5CVOB 5DNYA 2B3AA 2PMVA 2N9XA 4B9KA 1E8WA 3GP7A 4CDEB 1HZ5A 4B3TM 4WQOB 1W5TA 2R62A 2CJNA 4TKNA 4X6IA 2DWLA 1T0QC 4YYWA 1KM7A 3GPXA 4M0WA 3U6DA 3ZNHB 1DF0A 4RGOS 4OW0A 1ZV1A 1E0ZA 4FW9A 2J7QA 2NMQA 5AUIA 2FFJA 3IVFA 4LLGM 2JWUA 2J42A 1JRUA 2ACZB 3ML8A 2ICIA 2KJRA 1E8XA 3H7SA 1WGLA 1QAQA 3BY4B 3VFKA 2IDYA 3BOSA 2K8HA 1IP9A 4LFBM 3VK7A 2RKOA 1MI0A 2DZOB 3MP2A 2V6ZM 2CP8A 3VQIA 1SE4A 2K9XA 2M1MA 2X49A 1ME4A 2FIDA 5IA7A 4L16A 3CTWB 1FPYA 3LQQA 1E5WA 1TGUA 4MB7A 3EA6A 3U6EA 1JWAD 2DZJA 3PLUA 1OAIA 1JWSD 3E9SA 3NG0A 1YN5A 1KLVA 2LUEA 4D8IA 4YYSA 1P7FA 4XDCA 2H1RA 4TUUA 3DBRI 2EKFA 2GB1A 2IO0B 3VHTC 1NI3A 4R3DA 1SG9A 4NXMM 4KKJA 1IN7A 3FRHA 4GC5A 1Z59A 2E02A 1G41A 4GDLB 1TKEA 5F3WA 1YUBA 1C9FA 3KQ4A 1LXDA 2CWBA 4RGTA 2L7RA 1GB1A 1F1HA 4WA6A 3M63B 2MBOA 3IG5A 4JWUC 4BKSD 2KDLA 2EO2A 1OTRA 3BB7A 4CDCB 4WP2A 4DR6M 3H4MA 4LF8M 1GJSA 1TJEA 3R8BA 4BPVA 3BK2A 4GU2A 1AIMA 3P4SB 5FTJA 3ZQJA 2V1YA 1L8QA 3VRAB 1SJHD 2KZUA 3ZO5B 4ASWC 3RN9C 3FTDA 2LI5A 5F02A 2KNBA 2XN9C 1UGMA 1A6RA 4NJ7A 3RNEC 3A1QB 4FWDA 2YNMD 2KQ4X 3LFYA 2AIMA 1XLPA 2H5XA 2IBIB 3AXCA 1WXSA 3NY5A 2F7DA 1VDLA 3WAPA 1JCKB 2R9CA 2JUOA 1N77A 2BDLA 3FTFA 4WQMA 2GBRA 4YTMB 4MDKE 3V61A 4NNJB 1R4MB 2BS3B 4D8EA 2AVWA 1L0VB 4FWHA 2DWZB 1GAQB 5EE0A 2CHXA 1QOFA 5DYGA 5DPWA 1HQYE 4W9DA 3EIEA 1SP4B 4YSXB 3V60A 2L7HA 5GMVA 1NPZA 1HQRD 3VXWA 4RMAA 1WGKA 4LZJA 4XC2A 2J7OA 1GPXA 1OEYJ 1YQBA 1HZ6A 2QJLA 4A20A 4AI6A 4IDIA 1QF6A 4IIWA 2BTEA 1I7HA 4K7WA 4X62M 1DYQA 4L8RC 4K0KM 2ZTCA 1YQ4B 2MBHA 2O6VB 1QOBA 3A4RA 2WDVB 3P2BA 1PGBA 3BWUD 2QENA 4RY2A 2WX1A 2HD5A 1ZMUA 4EE2A 2N1VA 1P3QU 4OEMA 1TR8A 1HXYD 2C7NB 4J6IA 4S17A 1ET9A 2DCDA 2D07B 2OJRA 1KTKA 4EIWA 1F9JA 1EUVB 4A90A 2AWTA 5EE1A 3ZLZA 4F7ZA 3IEJA 2KMMA 1SXJD 2L7IA 4AXLA 4RM9A 4IBIA 1FD6A 1E6EB 1IBXB 1J7CA 3H6SA 2PTLA 2OOAA 4I4LA 4G4QA 3IMAA 2J0KA 3QX1A 2AUXA 3TRKA 3H6NA 5EP4A 4IKGA 3IV2A 5AUKA 1U9VA 3AB5A 4LNOA 1THEA 1N34M 4FVMA 1MHHE 2HWJA 2IO3B 2CHVA 3R7QA 4KHPM 2INDC 4MH8A 5EXTA 3L27A 4HLQA 4NL4H 2INCC 2C60A 2R9NA 6PADA 2AS8A 5CHTA 1C77A 2OQ4A 4NSOB 4F2LA 4DV7M 3KUZA 4AKGA 4CDFB 1UD7A 2BKRB 1RAXA 4G6ZA 1K3WA 1V97A 2I1KA 3AMZA 2JP7A 2L1AA 3HJQA 3KOYE 3T38A 1M6DA 1CQDA 3W1YA 2LBCA 4DDID 2WXHA 1MHWA 3H1UA 4QHSA 1U4AA 3TL5A 4G4RA 3P4QB 5FKAC 3AE5B 3P63A 3AI8A 3TEXA 3KKUA 1GKIA 4PDIA 1YALA 3FKYA 2JY5A 4I8OA 2CRUA 5EP3A 3FILB 1HUCB 4X6JA 5FK9C 4DR1M 3UMMA 4M9ZA 4WURA 3GLFA 2R2OA 8CATA 4BS6A 2UXCM 3BVMA 3A4SC 4IUMB 3ZW3A 4BOZB 4X65M 3DA1A 3K1JA 1KRHA 4B7GA 2A4ZA 3HJ8A 4II7A 1WJUA 3PGEA 3RVXA 4L1BA 2LEKA 3URYA 4OVVA 3TWKA 4W9EA 5JHBA 1IN5A 5AZGA 3T9LA 1L1ZA 1PIPA 1EWYC 3UQBA 1Q3CA 2Z84A 2EKIA 2W82A 4LCBA 3U60A 1V5OA 1ZP0B 4FULA 1ENFA 4OVUA 3V62A 1G6JA 4KGTA 4DXFA 2ZPYA 3FRIA 1WFYA 4EUTA 2CV1A 3A45A 1WJNA 1JWUD 2JZZA 3U6CA 2LGIA 3P4RB 1OFHA 3HHWA 4DXAB 4PYUA 4BFRA 1NBFC 1VDDA 3VH4B 3OAWA 1PPPA 3PZ8A 2J5YA 1AYFA 3KYCD 2KC2A 4I6NB 1FRDA 1RFAA 3W67A 2MRPA 1VSNA 3KVWA 3R8FA 1T6BX 1VZ6A 2DAJA 2UUAM 2WXMA 2PE9A 5EZQA 3GLIE 1UBQA 3AEDB 3BOWA 2DCCA 4FHJA 4W9HA 2MJDA 1I42A 1OQQA 1KYIA 4QOZC 1H8CA 2KAJA 2KWDA 1LO5D 3Q6BA 1TT5B 4BKGA 1DEUA 1E9RA 4DR5M 3KWZA 3H7PB 3ERVA 3JR4A 2YJBA 2PVGC 1YN4A 5HKHA 3V6EA 2LHCA 2FO5A 1IXRC 4NC6A 2F5QA 1E7PB 4LRTA 2JRHA 1AWDA 3UGBB 3WANA 1EWMA 2K0PA 1R5LA 5EQTA 4W4UA 1PPDA 2OOBB 3ZDTA 1WGGA 3QARA 1HT2E 1YOVB 3ZDMC 1XXHB 4DV5M 3B08A 1I94M 3BVGA 2GQFA 3GLIB 3U5ZB 2L09A 2WX0A 1PM5A 2JYEA 4TV3A 2KLCA 1YT7A 2BT6A 2Z7JA 4LJ6A 3JAMS 3QIJA 1ZPSA 4P16A 1HQCA 3HHAA 4ANUA 5D6JB 1WYGA 2L8JA 3ECIA 3FC4A 3FUVA 1KLGD 3PRMB 1YMHE 1NDDA 1MPEA 3Q3NC 2KDBA 2ZW0A 1AN8A 1PQSA 1QZEA 4HDOA 4JGHB 4IOIE 1FXTB 2CKHB 4ANXA 4ZYSA 3EC8A 3WXEA 3C0RA 1HTOA 5EE3A 1G71A 2CHGA 3SU8X 3ONSA 3K92A 1JQJC 3VR8B 1ZDVA 1EF1A 3U4EG 4DHZE 1IXZA 3DOAA 3KOWE 1S3SG 1XKGA 2XSZD 3RNCC 3UF8A 1TLOA 3HHYA 1PJQA 4A5UA 3V6CB 4FBJB 4Q7JA 1UNSA 1CS8A 1QQWA 3SYKA 4HL4A 2AL6A 1L2DA 4LJ7A 1YJIA 4HK2A 4MM3A 2FCNA 3ZQ4A 8PCHA 4DDGD 1Q10A 2BF8B 2CJOA 5ITXA 1DKIA 4KO8A 2DCBA 2L00B 4JYAM 1GLOA 1T3QA 2R4JA 3Q8FA 5J2RA 3VDUA 1WXMA 1WM2A 2BKFA 4MSXA 1NLJA 3DVNU 3RNGC 4WAAA 3PHWB 2HJ8A 1NENB 2Y6EA 1F4IA 2JRIB 3GRVA 2V4LA 2EMSA 4NAWB 3U30A 5J94A 4NAMA 2VHFA 3S3QA 2C0YA 3TMPA 3FKEA 2VH2A 2A5YB 4L78A 4AUQC 4ZHOA 2DHRA 2Z4SA 3B7ZA 2FH0A 3O65B 3R3MA 2Y0QA 2QBYB 2MLBA 1VCBA 4Z8XA 3SAUA 4RCOA 4JI6M 1F0ZA 3AV8A 2ARYA 3GLFE 3WHLA 3MTNB 2PKOA 3GP1A 3ZJUA 1I4QA 1WJ6A 3IG8A 4HRSA 5ITTA 3RVWA 2BB5A 4XWTA 1EWCA 1Y56A 2BGFA 1UM8A 2KWUB 2JQGR 2JT4B 2K6QA 3NRZA 2BNKA 2V9HA 1GL6A 1L2NA 2XU3A 4NY0A 4PS7A 2XEPA 2AU1A 3ZUAA 4OELA 3M95A 4NQLB 2D7HA 4MGYE 1YSYA 2PVOD 5DPRA 2I2YA 1PBHA 4Q8HA 2JXXA 3M62B 2G5GX 3LMMA 4GHLA 3WA0A 5GKNA 1N60A 3K9MA 5CVNB 1WJ4A 4DUYM 3P5WA 2DNFA 2LMCA 3AE8B 3ZNHA 1GJTA 4DV1M 2JYTA 3S3RA 2DC9A 4IWOA 5H8YE 4ZYNA 1JR3D 3K8ZA 2JQFR 2M60A 4TQ1A 1GUAB 3BY4A 3GLGE 1G3IA 2KEBA 5FLXS 1VJKA 2DWNA 3Q2AC 3U8ZA 3BYYB 3MHZA 1V1PB 2YEPB 2KQ7A 3N3GA 3BCNA 3DFZA 3VLFB 1Q39A 3QYBA 4MGIE 3MJWA 3BK1A 3B1LX 3U6PA 1M94A 4LTUA 2M0XA 1CVZA 1AECA 4LGMA 4CYEA 2MH8A 3AOEC 2F5OA 4RF1A 3WAOA 4HVBA 4YV8A 4LG2A 1XLNA 3H9DA 2XFSA 3ETRA 2LNHC 4DR4M 2FS1A 2LXAA 1PPNA 4EOYA 3MC0B 3FYDA 3L2AA 4LY6A 1X9YA 3T8MA 2KN4A 5EP2A 4I6PA 4QRGA 4UN2B 2IPKD 3I4YA 4GDLA 4ZRKA 2QP9X 2BJWA 4XGIA 1SE9A 2KX3A 3PZ7A 4WWMA 3HU2A 2Y5BB 4IWPA 2BYTA 1YQ3B 5HHDG 2NPTA 2R18A 1C78A 4AS1A 2LWPA 1QOGA 2UZJA 1GNUA 2YLMA 3NJTA 1E9MA 3MP9A 2EUCA 3TEZA 3EFCA 3H4JA 2JVCA 3R7RA 1EF5A 2O2VA 3K9PB 2GNOA 1JQ4A 1DOIA 1FNWA 2OPFA 5LMUM 2IGDA 4IBJA 1FEHA 4HXDB 2CV0A 2KMCA 3L10B 2C9WB 2KD0A 4DV3M 2KFKB 2HXZA 4PDGA 2MA9B 3A1QA 2DOSA 4GITA 1TIFA 2D7GA 4BBNC 1T6OA 4LJ5A 5FTMA 2ZVOA 2IBIA 3RVVA 4BS5A 5KPRA 1JRPA 3AN1A 3OLMD 3DQVA 1SXJE 4GXBA 3C8YA 1AU3A 1CTEA 2HAKA 3QA8A 1J19A 4JLCA 1MJGM 3QAUA 3APCA 4C7YA 2JTCA 4AQYM 1R2YA 2MCNB 1ZAEA 4CQNA 4RM8A 4DV2M 1Q02A 5ITXE 1WZ3A 2N9KA 1L7YA 2AYOB 2NCNA 3Q69A 3UZUA 4XX5A 1NJGA 3BBZA 1G59A 2WYQA 1TY2A 2K25A 4GUAA 4LZZA 3N1YC 4FIPA 4FADA 3UIPB 4N9F4 2MQJA 1VQ1A 4MGHA 1M4VA 3LXFA 4ICVA 4XK8F 2CEAA 1VEJA 1N5WA 2NR2A 2O6VA 2PEAA 2R2QA 2DC7A 2JY7A 1QDTA 3JVZX 1SXJB 1PFDA 4GC9A 3JYUA 4AW4A 2JZ0A 3KH0A 4W9GA 3HHZA 2APLA 2LVAA 4DR2M 4WH4A 4HDQA 1C4CA 3EUB2 3S2AA 2BW2A 4LJ9A 1TH3A 3V05A 1WR1B 1SGHA 2FNAA 1IFYA 3KVFB 3U2SC 4BZAA 3SMSA 2WDQB 4GLSC 4LF9M 3I3TB 2KA6B 5KHOA 2LHDA 3HM6X 1IBXA 4WJQA 1C79A 2XK5B 2O25A 4GKKM 4GMVA 1J0GA 4ICUA 2ZVNA 3CBKA 1WJ7A 2WQYB 4KT0F 2V3NA 1NL6A 4PP2E 7PCKA 2HCBA 1SNKA 1WX9A 1V8CA 2GHUA 2MP2B 1XD3B 2DC8A 3MORA 2VQEM 4DBGB 5JZEB 1HT1E 2EKEC 3KFUG 1SB3C 3FUWA 2UU9M 1FXIA 1NSFA 3SC3A 2ACTA 2Y5PA 4QRVA 1U5IA 4WWPA 4L23A 1HA5A 2CHQA 3DZDA 3PHXB 4F1SA 2YQZA 2K8CA 3U6MA 5J18A 3QC8B 4C4VA 2XGNA 3LCUA 4YSZB 3FILA 3R66C 3U52E 1E8YA 3ZRCA 4FLHA 5FR3A 1ZMWA 1EU3A 2NBVB 1NYRA 4IUMA 4BOZA 3L28A 4FCWA 3ZCBB 4CGYB 2DAGA 4KDIC 4D80A 3C58A 1IBLM 3ZJVA 2KX0A 2D2QA 4JQWC 4KLNA 3I51A 2MX2A 3VUWA 2LVOC 2ZNVB 3DHGC 1WWTA 5IP4D 2PIAA 1LTMA 4DR7M 4XE0A 2GMIC 1VD2A 1XCQL 2LUMA 4ZRQA 1TY0A 4BOQA 3PSEB 1VDVA 3KS4A 3KSJA 1SIJA 1SF0A 1WHCA 4HJGE 2FNJB 3AOEA 3LJ3A 2R45A 4AKHA 3DVGY 2RMMA 4PS8A 4KODA 1RYJA 2XLJA 2RD0A 4YYQA 1N63A 1LFDA 2UUBM 4GIVA 5FTKA 4E71A 2L83A 4BAXA 1XWIA 1WGYA 3I06A 4HEA1 3K9OB 3AE1B 3RZWC 4H2AA 1ZE3D 3TEYA 2NTSA 3TIXA 2D7EA 4A6QA 3OVZA 4FK5A 2CS4A 4NQKE 1PCIA 1LM8B 3NVZA 4MI7A 4LK0M 2HL7A 3ZNZB 2JZ3B 3C9EA 3BXWA 4HLEA 3QAQA 2F5NA 4BSQA 2G1EA 1T3TA 3H7PA 4P6EA 1TS2A 4HJKA 4QRXA 3ZKJC 1IPGA 2FCMA 2ZJDA 2M19A 4US9A 4RKUF 1OIPA 2DLBA 2EA0A 3VUYA 2FTDA 5MPOA 4G4NA 1R2ZA 2DZLA 4X6HA 2KDFB 5EZSA 1VR9A 1I4XA 3J9CA 1QLBB 1NI2A 5BYSA 3W5UB 4MJSA 4LF7M 2KZSA 4TSSA 5IO9A 3L17A 4P6GA 1GO5A 5D2MB 4E74A 1XXHA 1POPA 4ITKA 2DYOA 2G8JA 3RFZB 3J7AS 3GLIA 5ITQA 1SIFA 2WNMA 2OULA 3H7DA 2Q5WD 2F1GA 3L0WB 3C3EA 4Q8GA 2QCZA 4JN6A
chains in the Genus database with same CATH topology
3VR9B 3GO8A 1TDZA 1BUIC 5C3JB 1FCCC 3PRMA 2WXKA 4TMAB 2F5SA 2F4VM 3ZJTA 3Q8EA 3M0EA 4ZPXA 4JI5M 2QILA 2FOIC 3VKHA 5T8IA 4OVZB 3AEGB 3B9PA 1C4PA 3W31A 4ZHPA 3P42A 4IBEA 3R2TA 3W30A 1ZXIA 5C1BA 3PNVA 3BYTB 3TL4X 2WLBA 1QYRA 2IGGA 4N59A 1NHGC 3J80S 1GOZA 4YTPB 4AKIA 1FCLA 3GB1A 2C98A 4DV4M 4YT0B 2LH0A 2C96A 3W5VB 3D8BA 2WXIA 3AEAB 1SXJC 3PHWA 3GQ3A 3P4PB 1B9RA 2JRIA 1N36M 5G5GA 3KLSX 4RH6A 1ZUD2 3KDSE 5LNK1 3O65A 1H6UA 3SHGB 2QPAA 2QBYA 1KF6B 4X64M 4L4UA 5FSWA 4AZFA 1HEZE 3KP0E 1J5EM 2M5ZA 4D82A 5LMNM 3KS8A 1V1OA 4US8A 2V4IB 1L6UA 1C4AA 4WW0A 2WXLA 5JI2E 4D8BA 3AM9A 2WU2B 1QAOA 1XEEA 1IY0A 1NEKB 3HUIA 3CF0A 3SARA 1IXSB 3SHFA 3NS1A 3FUUA 5C2TB 1ACCA 2VZKD 2ZW1A 4GDKB 4DR3M 4GH9A 3GRYA 5IREB 3AE3B 2JU6X 3PFIA 1SEBD 2CFOA 1NY6A 3A42A 3J81S 3UJNA 1MX0A 3SEBA 2WU5B 1V1PA 4RGNA 4G4OA 3OQCA 2IJ0A 1Z5BA 1UUPA 3NUHB 2XZUA 4IBGA 2ZAOA 1MVKA 1KFYB 3SBJA 4JI8M 4JI4M 1K52A 3AE7B 3VK8A 3GLGA 3TUOA 1TH4A 2X4AA 2ZAMA 4OX9M 1IN4A 4KX6B 1XC8A 3HVDA 3ILKA 1XMQM 4FCTA 5IZ7D 2F5PA 4FXCA 1I4WA 3A46A 1RFKA 1Q3BA 4JXJA 2XF3A 2INNE 2BTWB 3BBAA 3TE6A 2V1CA 1DGGA 3U6SA 1F2RC 4B0EA 5GXGB 2WXNA 4IP3A 3UGJA 4NRWA 4I81A 4PD2A 2V0GA 3HJSA 2Z4RA 2C5RA 4W5WA 1L2BA 3TWLA 5JXVA 2AHMA 2R46A 2PLPA 4XBOA 1FNUA 4QNMA 2PW9A 4UDUC 1KSFX 2J53A 1HR0M 1HNZM 3GPYA 1ZOYB 3KOXE 3FUTA 1IY1A 1FIQA 2DVWB 3AH7A 1D5XC 1CJEA 1J09A 2Z3XA 4GHAA 5HFYA 1KLUD 2JA2A 1SXJA 4LF5M 3VRBB 2ZM6M 2ZBKB 2Y5CA 2LHEA 2JX5A 3HKPA 1VRAB 4L15A 4GMQA 4YSYB 3R2IA 1PVJA 1NNJA 1N5XA 3RPFC 3DWMA 3W2DA 4MT5A 4RGMA 4PCZA 2N9LA 4XDDA 1ZDXA 2Y20A 1FMAD 4ZOHC 3L26A 5KPZA 2YR0A 4RF0A 4CHTB 2INPE 4L2YA 1FFVA 3GPPA 3GLHB 1N75A 3LVVA 1YJJA 3PHXA 1UKFA 1FXAA 4JV5M 2WXPA 4YTNB 1XLOA 4BLCA 3CIRB 2UXBM 4IBDA 4P6VF 2XH9A 2RGOA 1JMLA 3AE2B 2Y0TA 4N58A 5BMIA 4RFBA 1K50A 1MHXA 3L29A 3PVSA 1SJED 3PHUA 1E32A 1DOXA 4DUZM 3KWVA 5H37D 2UUCM 1J7AA 3TQSA 4RNAA 4LRSA 5ITUA 3IAS1 3L4PA 5C18A 1IBMM 7CATA 3FUXA 4JE3B 3SAWA 4A9AA 1TS3A 1S3SA 2MH7A 4C80A 1PJIA 4NOOB 2NTTA 5JI3E 4JPSA 3L25A 1YE9A 3RGSA 3WHKA 1DO2A 3PNYA 3HGIA 3CF6E 3SFEB 1ORYB 2DWQA 2DZNB 1FM0D 4MH0E 1D4BA 5A2QS 4OHJA 3AJIB 3SR6A 1TS5A 1Z6TA 3GPUA 2JSVX 3W1SA 3DWGC 3NVYA 1FNNA 2ON8A 2XSZA 3Q8XA 1L0XB 1BXTA 3R9XB 3I57A 1ZXHA 5ITRA 3ZYYX 3AEBB 4BBAA 2WXRA 3Q8BA 2L32A 3NWLA 5KO3A 3SYLA 3PRPA 2CU3A 1PUTA 2V1UA 4OVZA 2CUZA 2BBCA 1QILA 3PO0A 2VIIA 4A55A 2WXQA 1XF5L 1W5SA 3PT2A 1QKZA 2IGHA 4JI1M 3J27B 1VLBA 4LFAM 2AX5A 3LVWA 4D2KA 3QWLA 4PT5A 5ITYA 1PDXA 4LGYA 4NSRA 4NXNM 1NY5A 4GKJM 4LF4M 4RKXA 4MM3B 2BS4B 2KRKA 4HKQA 1I4RA 2M0AA 2OEDA 5D3DA 4DXGA 2HWKA 1OFFA 3RFWA 1F2RI 4O1NA 2CE7A 3RNVA 1PGXA 3ABVB 2WXJA 2VZKB 1R7RA 4ITQA 5KQ8A 2X8AA 1QZMA 3UK6A 2UXDM 4IJEA 1JROA 1J7KA 1JWMD 1RWSA 3AV0A 2J4XA 4FWGA 4ARIA 3T3OA 2Y21A 2MEKA 1X37A 1L5PA 2GRIA 4YY3M 1JW9D 2K5PA 2DXIA 2YEPF 4YXDB 3FTEA 3AE4B 1IUEA 4LJAA 1IBKM 2RDGA 2EELA 4MGZE 2KW0A 3HU3A 2O5RA 1TS4A 5FTNA 1KH0A 1TH2A 5IWAM 1DGFA 1J7BA 2H89B 1IM2A 1SSNA 5HG2A 2N7JA 3E4RA 2I7NA 2V3PA 1JWBD 2C9CA 3ZH9B 3HVZA 2QCUA 1PJJA 1MU5A 1QQRA 3NBIA 3Q8CA 1DO0A 1Z5CA 1DOYA 3HU1A 3U61B 1C76A 4ZTBA 2HKJA 4IJFA 5KQDA 2BTWA 1D5MC 4CISA 3SMPA 5BYRA 5BPVA 2K22A 4OZAA 4NRVA 3D8LA 3W0LB 1ESFA 4IBCA 3U5ZA 3ZC7B 3ZGZA 3U6LA 3U7ZA 1NYQA 4Q2JA 4QHTA 5TSSA 4KGRA 4XZXA 4M9SA 1CK1A 2WP9B 1K3XA 1N62A 3HRDD 5EXXA 2AGAA 3MTVA 1SXTA 3MJ5A 1GL7A 3BIID 1LV7A 3AEEB 4B7FA 4KGSA 3IT6B 2JXTA 5BMHA 1Z5AA 1I4HA 3IXSA 5EXSA 3AEFB 2DWMA 1R6BX 2FBWB 1P7EA 1IN8A 1OJLA 4HROA 3LQRA 1E9SA 5G5HA 4BOSA 4OZBA 3B2GA 4WIPA 2RPVA 5DYIA 2KRUA 4BB9A 2AQ3B 4JWSC 1DGHB 4ZRPA 2HHHM 4USAA 1EM7A 3KP1E 1KFVA 5I4DA 2C9OA 2SAKA 4I5SA 2ERCA 5IT9S 4TQ0A 1STEA 1E10A 4C7ZA 3GLHA 1WXQA 4B0MA 5BMGA 1OFIA 2W55A 1PYWD 1XHBA 1FO4A 4JI2M 2L52A 3CWIA 4ARCA 3MFGA 3T1YM 1D5ZC 2G9HD 4XWWA 4M0DA 1T5XD 3N9YC 2LWXA 4N6EB 1N33M 2AQ1B 1L4DB 3HHXA 1GVNA 1UWMA 4AG5A 4MGKE 1CQVA 5HI1A 1A70A 3UI3A 4A8XC 4M9XA 3GRRA 2X38A 1ET6A 1IN6A 1G4AE 3TEWA 1L1TA 3SATA 3HWSA 2XZFA 3NVVA 4REZA 2DYMA 1N61A 4DV0M 3EIHA 3O13A 1R7SA 3U6OA 4TUWA 1FRRA 2I38A 4R7GA 2R65A 2QIEB 2R4EA 2XNAC 1FJGM 1GB4A 4BOUA 1NHWC 2KXEA 3J7BA 4OU7A 2P5TA 3SAVA 1EU4A 4A3VB 3FD9A 1N32M 1E94E 3AECB 4QNRA 4JX1C 3EGRA 2WXOA 3K2LA 2R61A 1PGAA 2GI9A 5D3IB 2FUG1 1NNUC 2K47A 4JI0M 2E3TA 5FTLA 2J52A 3U6QA 2LFIA 1EE8A 2D5GA 2XFTA 2TSSA 1AW7A 3TSSA 3OWEB 3NVWA 1B1ZA 2WDRB 4NJCA 4HKZE 3FYCA 1XNRM 2RDHA 1G8PA 3AOGA 2AQ2B 2BU3A 3KXEC 1TKGA 4AQ7A 2QMTA 3SFZA 1SE2A 3GS2A 3H8HA 5E26A 1BMLC 3MK6A 3KOZE 1QT9A 3GQ4A 4IBKA 4Z6YA 2BS2B 4B3SM 5H92C 4LJ8A 5EP1A 4MACA 1RM6C 4IBBA 3T1HM 1HNXM 2KDMA 3T15A 2WXGA 3B21A 3LYYA 3B2FA 1FFUA 1CZPA 2NQ8C 3AFHA 3RGPA 2N0SB 3SFDB 4FD2A 1WRIA 5JZEA 1XNQM 2VQFM 3P1MA 2I7PA 4AG6A 3PXGA 2Y3AA 3J2PB 4YWGG 1VZ7A 2J7NA 1L0YB 2ONQA 1QANA 4LJ4A 3W9CB 3IAM1 2MJ3A 2ZANA 2KACA 1NVID 4B7HA 2W54A 4YHHM 2B76B 1VZ8A 3AE6B 3TPZA 2LXEA 3PSEA 4J3OD 4DV6M 4OZCA 4C56C 3BVZA 1XXGA 2LJIA 2BB6A 3B9JA 2L6OA 3THGA 3GLFB 5KPTA 2HDEA 3W0FA 1K82A 2DBYA 4IBFA 2W3SA 3V3XA 3NZ3A 3FAHA 3FTCA 4X66M 3U60B 3VKGA 3WCQA 3BZDB 3I9V1 2J7QC 2JQRB 2C99A 3T3NA 3U61A 1JALA 1TYGB 3E56A 2K3UA 3A98B 1L4ZB 1XO3A 2RGHA 3GQ5A 2OHFA 2FE8A 3IFUA 1FNVA 4LFCM 5D7GA 3KW6A 3GLGB 1I4GA 2WXFA 4BOPA 2QZ4A 3AL0C 1TDHA 2SEBD 4NZLB 2W3RA 1IGCA 1ROEA 2QEJC 2YFQA 3VDPA 1N78A 2CV2A 1ZQ9A 1YN3A 1QOAA 3Q8AA 1NVMA 1NJFA 3JR5A 4LF6M 1L2CA 4B3RM 2JZPA 2H88B 1SE3A 1UGJA 2E5LM 3IT4B 3AE9B 5EJCA 1K53A 3OTOM 1TKYA 3VFDA 1UWXA 1OQRA 1C1KA 1IQPA 1XCTL 1QVRA 1DGHA 1SBBB 4KKIA 4B08A 2E6XA 2QSDA 1D2NA 1HNWM 3I4VA 3MHVC 1XLQA 3AKZA 2MJEA 3CF2A 5EE9A 1DGJA 2HTME 4GIPA 5EXPA 1GLNA 3RE8A 4B3MM 1D6EC 4D81A 2BJVA 1TZOA 1K51A 4GRIA 3TWMA 3SASA 5BR8M 2WS3B 1I4PA 4JI7M 1XMOM 1JR3A 5E6JA 4DQOC 1YNTE 1F77A 1QAMA 4QOSA 2M56B 4S12A 3GRUA 1DGBA 1L6VA 4WAFA 3M7GA 5BYQA 3KWLA 3LB8C 1YZBA 1IY2A 2G8LA 4FCVA 3M6AA 2Q2EB 1WSPA 4JI3M 3KSXA 1IGDA 2Z8LA 5DNYA 2PMVA 3GP7A 4B3TM 1HZ5A 1W5TA 2R62A 2CJNA 2DWLA 3GPXA 4M0WA 3U6DA 4RGOS 4OW0A 1E0ZA 4FW9A 2J7QA 2NMQA 5AUIA 2FFJA 4LLGM 2JWUA 2J42A 2ACZB 2ICIA 1QAQA 2IDYA 3BOSA 4LFBM 3VK7A 2RKOA 1MI0A 2DZOB 3MP2A 2V6ZM 3VQIA 1SE4A 2K9XA 2X49A 4L16A 3CTWB 3LQQA 1TGUA 4MB7A 3EA6A 3U6EA 1JWAD 1JWSD 3E9SA 1YN5A 4D8IA 1P7FA 4XDCA 2H1RA 2GB1A 1NI3A 4R3DA 4NXMM 4KKJA 1IN7A 4GC5A 1Z59A 1G41A 4GDLB 1TKEA 5F3WA 1YUBA 1C9FA 3KQ4A 4RGTA 1GB1A 3IG5A 4JWUC 2EO2A 3BB7A 4DR6M 3H4MA 4LF8M 3R8BA 1TJEA 3BK2A 3P4SB 5FTJA 1L8QA 3VRAB 1SJHD 2KZUA 3FTDA 2XN9C 4FWDA 2YNMD 2KQ4X 1XLPA 1JCKB 1N77A 3FTFA 4WQMA 4YTMB 2BS3B 4D8EA 1L0VB 4FWHA 2DWZB 1GAQB 5EE0A 1QOFA 5DYGA 1HQYE 3EIEA 4YSXB 2L7HA 1HQRD 1WGKA 4LZJA 2J7OA 1GPXA 1HZ6A 2QJLA 4AI6A 4IDIA 1QF6A 4IIWA 2BTEA 1I7HA 4X62M 1DYQA 4L8RC 4K0KM 1YQ4B 1QOBA 2WDVB 1PGBA 3BWUD 2QENA 4EE2A 1HXYD 1ET9A 1KTKA 4EIWA 4A90A 5EE1A 2KMMA 1SXJD 2L7IA 4IBIA 1FD6A 1E6EB 1IBXB 1J7CA 2PTLA 4I4LA 4G4QA 3TRKA 5EP4A 4IKGA 5AUKA 3AB5A 1N34M 4FVMA 1MHHE 2CHVA 4KHPM 4MH8A 5EXTA 3L27A 4HLQA 4NL4H 1C77A 2OQ4A 4NSOB 4DV7M 4AKGA 1V97A 4G6ZA 1K3WA 3AMZA 2L1AA 3HJQA 3KOYE 3T38A 2WXHA 4QHSA 4G4RA 3P4QB 5FKAC 3AE5B 3P63A 3TEXA 1GKIA 4PDIA 4I8OA 3FILB 5EP3A 5FK9C 4DR1M 3UMMA 4M9ZA 4WURA 3GLFA 8CATA 2UXCM 3BVMA 4X65M 3DA1A 3K1JA 1KRHA 4B7GA 3HJ8A 4II7A 4L1BA 2LEKA 3URYA 3TWKA 1IN5A 1L1ZA 1EWYC 1Q3CA 2Z84A 2EKIA 2W82A 4LCBA 3U60A 1ZP0B 1ENFA 4KGTA 4DXFA 2CV1A 3A45A 1JWUD 2LGIA 3U6CA 3P4RB 1OFHA 3HHWA 1VDDA 3PZ8A 1AYFA 1FRDA 3KVWA 3R8FA 1T6BX 1VZ6A 5EZQA 2UUAM 2WXMA 3AEDB 2MJDA 1OQQA 1KYIA 4QOZC 2KAJA 2KWDA 1LO5D 1E9RA 4DR5M 3JR4A 2PVGC 1YN4A 1IXRC 1E7PB 2F5QA 4LRTA 1AWDA 2K0PA 5EQTA 1HT2E 1XXHB 4DV5M 3BVGA 1I94M 3GLIB 3U5ZB 2L09A 1PM5A 2JYEA 2BT6A 2Z7JA 4LJ6A 3JAMS 1ZPSA 4P16A 1HQCA 1WYGA 3FC4A 3FUVA 1KLGD 1YMHE 1MPEA 2ZW0A 1AN8A 4IOIE 4ZYSA 3C0RA 5EE3A 2CHGA 3K92A 1JQJC 3VR8B 1ZDVA 3U4EG 1IXZA 3DOAA 3KOWE 2XSZD 3HHYA 4A5UA 1UNSA 1QQWA 3SYKA 4HL4A 1L2DA 4LJ7A 1YJIA 3ZQ4A 1Q10A 2CJOA 5ITXA 1DKIA 4KO8A 4JYAM 1T3QA 2R4JA 3Q8FA 3VDUA 1NENB 3GRVA 4NAWB 4NAMA 3TMPA 3FKEA 2A5YB 4L78A 4ZHOA 2DHRA 2Z4SA 2Y0QA 2QBYB 4Z8XA 3SAUA 4RCOA 4JI6M 1F0ZA 3AV8A 3WHLA 2PKOA 3GP1A 3ZJUA 1I4QA 3IG8A 4HRSA 5ITTA 2BB5A 4XWTA 1EWCA 1Y56A 1UM8A 3NRZA 2BNKA 1GL6A 2XEPA 2D7HA 4MGYE 1YSYA 2PVOD 2I2YA 2G5GX 3LMMA 4GHLA 5GKNA 1N60A 4DUYM 2LMCA 3AE8B 3ZNHA 4DV1M 2JYTA 5H8YE 1JR3D 3K8ZA 2M60A 4TQ1A 3BY4A 1G3IA 2KEBA 5FLXS 1VJKA 2DWNA 3BYYB 3MHZA 1V1PB 2YEPB 3DFZA 3VLFB 1Q39A 4MGIE 3BK1A 4LTUA 3U6PA 4LGMA 3AOEC 2F5OA 4RF1A 4LG2A 1XLNA 2XFSA 3ETRA 2LNHC 4DR4M 3MC0B 3FYDA 3L2AA 4LY6A 2KN4A 5EP2A 2IPKD 3I4YA 2QP9X 2BJWA 4XGIA 3PZ7A 4WWMA 3HU2A 2BYTA 1YQ3B 5HHDG 2R18A 1C78A 4AS1A 1QOGA 2UZJA 1E9MA 3MP9A 2EUCA 3TEZA 1JQ4A 1DOIA 1FNWA 2OPFA 5LMUM 2IGDA 4IBJA 1FEHA 4HXDB 2CV0A 4DV3M 4PDGA 2DOSA 4GITA 2D7GA 4LJ5A 5FTMA 5KPRA 1JRPA 3AN1A 1SXJE 3C8YA 3QAUA 4C7YA 2JTCA 4AQYM 1R2YA 1ZAEA 4CQNA 4DV2M 5ITXE 2N9KA 3Q69A 3UZUA 1NJGA 1G59A 1TY2A 4GUAA 4LZZA 4MGHA 1M4VA 3LXFA 2CEAA 1N5WA 1SXJB 1PFDA 4GC9A 4AW4A 3HHZA 4DR2M 4WH4A 1C4CA 3EUB2 2BW2A 4LJ9A 1TH3A 3V05A 2FNAA 3U2SC 3SMSA 2WDQB 4GLSC 4LF9M 2KA6B 2LHDA 1IBXA 1C79A 4GKKM 2WQYB 2V3NA 2HCBA 1V8CA 2VQEM 1HT1E 3KFUG 1SB3C 3FUWA 2UU9M 1FXIA 1NSFA 3SC3A 2Y5PA 4L23A 1HA5A 2CHQA 3DZDA 2YQZA 3U6MA 2XGNA 4YSZB 3FILA 3U52E 5FR3A 1EU3A 1NYRA 4IUMA 4BOZA 3L28A 4FCWA 3ZCBB 4CGYB 4D80A 3C58A 1IBLM 3ZJVA 4KLNA 3I51A 1WWTA 2PIAA 4DR7M 4XE0A 1XCQL 2LUMA 4ZRQA 4BOQA 1TY0A 1VDVA 3KS4A 3KSJA 1SIJA 1SF0A 4HJGE 3AOEA 2R45A 4AKHA 2RMMA 4KODA 1RYJA 2XLJA 1N63A 2UUBM 5FTKA 2L83A 1XWIA 4HEA1 3AE1B 4H2AA 1ZE3D 3TEYA 2NTSA 2D7EA 4A6QA 3NVZA 4MI7A 4LK0M 2HL7A 2F5NA 2G1EA 1T3TA 1TS2A 2M19A 4US9A 2DLBA 2EA0A 5MPOA 4G4NA 1R2ZA 5EZSA 1VR9A 1I4XA 3J9CA 1QLBB 5BYSA 3W5UB 4LF7M 2KZSA 4TSSA 1XXHA 4ITKA 2DYOA 3RFZB 3J7AS 3GLIA 5ITQA 2WNMA 2Q5WD 4JN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P16 A;  4M0W A;  4OW0 A;  4RF1 A;  3E9S A;  2FE8 A;  4MM3 B;  3MJ5 A;  5E6J A;  5KO3 A;  4OVZ A;  4RNA A;  4R3D A;  4OVZ B;  4RF0 A;  4PT5 A;  4WUR A;  3MP2 A;  4REZ A; 
#chains in the Genus database with same CATH topology
 3VR9 B;  3GO8 A;  1TDZ A;  1WX8 A;  1BUI C;  5C3J B;  2BYV E;  1FCC C;  2I1J A;  3IFW B;  1KHQ A;  3PRM A;  4PI3 A;  2WXK A;  4K81 A;  3RUI B;  2BWE S;  2BYE A;  3DHH C;  4FJY A;  4TMA B;  3HWN A;  2WSF F;  2F5S A;  4BKT A;  2F4V M;  3ZJT A;  3Q8E A;  3M0E A;  1CJL A;  1UH6 A;  1JQP A;  4ZPX A;  3GZN I;  4JI5 M;  2QIL A;  2FOI C;  2NVU I;  3VKH A;  3PRP B;  5T8I A;  4OVZ B;  3AEG B;  3B9P A;  1C4P A;  2G3Q B;  2NBU A;  2VDB B;  2LGS A;  3DVN V;  3W31 A;  4ZHP A;  3P42 A;  2G8E A;  4IBE A;  3R2T A;  3V6C A;  3W30 A;  2BVC A;  3RNB C;  1ZXI A;  5C1B A;  1F52 A;  3PNV A;  3BYT B;  4HWI B;  3TL4 X;  2WLB A;  1QYR A;  2IGG A;  3PT2 B;  2K0B X;  5AZF A;  1QXP A;  4KDL B;  4N59 A;  2DZK A;  1NHG C;  3J80 S;  1GOZ A;  4YTP B;  4AKI A;  1FCL A;  3A9J B;  3GB1 A;  2MHJ A;  3ZRF A;  2C98 A;  3PW3 A;  4DV4 M;  4YT0 B;  2LH0 A;  4FHK A;  2C96 A;  2Z59 B;  3IEC A;  3W5V B;  3D8B A;  3W68 A;  1ZGU B;  2WXI A;  3AEA B;  1SXJ C;  3PHW A;  3GQ3 A;  4E3C A;  2DNA A;  3P4P B;  2IPP B;  1B9R A;  2JRI A;  1N36 M;  5G5G A;  3NZU A;  5G55 A;  1WXA A;  4NAW A;  3C19 A;  3KLS X;  3RZF A;  3KSE A;  1V80 A;  4RH6 A;  1ZUD 2;  3KDS E;  4G0N B;  5LNK 1;  3O65 A;  1H6U A;  3SHG B;  3SDL C;  2QPA A;  2QBY A;  3QK0 A;  2DAE A;  4IWQ A;  1KF6 B;  4X64 M;  4L4U A;  5FSW A;  4AZF A;  1TBE A;  1HEZ E;  3KP0 E;  1J5E M;  2M5Z A;  4D82 A;  4WJN A;  5LMN M;  3KS8 A;  1V1O A;  3DBR B;  4US8 A;  5J17 A;  1XQQ A;  2V4I B;  2CIO A;  1R4G A;  1L6U A;  1C4A A;  4WW0 A;  3QCA A;  3OJ4 B;  2WXL A;  4ACF A;  5JI2 E;  4D8B A;  2WU2 B;  3AM9 A;  1QAO A;  2N9P C;  4S0R A;  1XEE A;  2V3S A;  1IY0 A;  2VRR B;  1NEK B;  4K7U A;  5FR6 A;  1YIW A;  3HUI A;  4MZO A;  4CO7 A;  3TCA A;  4Y28 F;  2DEN B;  3CF0 A;  3SAR A;  3KUC B;  1IXS B;  1C3T A;  3SHF A;  2LVO A;  3B74 A;  3NS1 A;  2KK8 A;  3Q8G A;  3FUU A;  5C2T B;  1ACC A;  2VZK D;  2ZW1 A;  4GDK B;  4DR3 M;  4GH9 A;  2NQD B;  3GRY A;  5IRE B;  3AE3 B;  3N1Z C;  2IY0 B;  2JU6 X;  3PFI A;  1HE8 A;  5CHV C;  3H8C A;  5E6O A;  3DBH I;  1SEB D;  2CFO A;  1NY6 A;  3A42 A;  3J81 S;  2HJ1 A;  2FYE A;  4KIK B;  3MMP A;  3TJP A;  1Q1O A;  1GAB A;  3K8U A;  3UJN A;  1MX0 A;  1GEC E;  2FCS A;  3SEB A;  2ZNV C;  2DJG B;  2WU5 B;  1V1P A;  4CJ6 A;  5L95 C;  2FRQ A;  1Q6K A;  4RGN A;  4G4O A;  3OQC A;  2D10 A;  2IJ0 A;  2KLG A;  2KWC A;  1Z5B A;  1KOT A;  1F2B A;  5D94 A;  4W5C A;  2GBN A;  3DBS A;  2KWV B;  2AUZ A;  1UUP A;  3NUH B;  2XZU A;  4IBG A;  1WMH B;  2KKC A;  2FAZ A;  2ZAO A;  1MVK A;  4HPP A;  1KFY B;  4M0W B;  2BQQ A;  4F8C B;  3PNR A;  3USV A;  4AJW A;  2PJH A;  1TTE A;  3SBJ A;  3KYD D;  4JI8 M;  4JI4 M;  1K52 A;  2DAF A;  3AE7 B;  2P86 A;  3VK8 A;  1XXH E;  3GLG A;  3TUO A;  1TH4 A;  2P0R A;  4K3C A;  2X4A A;  2ZAM A;  1UZX B;  2QHO B;  2DC6 A;  4OX9 M;  1IN4 A;  1WR6 E;  4BQV A;  4KX6 B;  1XC8 A;  3HVD A;  4FN2 A;  3ILK A;  2D11 A;  1XMQ M;  2IYD B;  4FCT A;  4GGQ A;  5IZ7 D;  2F5P A;  4LDT D;  4FXC A;  3UQA A;  1VJV A;  1I4W A;  1WM3 A;  3A46 A;  2JY6 B;  1RFK A;  1Q3B A;  4JXJ A;  2XF3 A;  2INN E;  2NQI A;  3KX1 A;  2BTW B;  3RUL A;  3WXG A;  3BBA A;  3TE6 A;  2V1C A;  4HXD A;  1DGG A;  3U6S A;  3RYT A;  3DDC B;  1F2R C;  2KZR A;  3B7N A;  3WAL A;  5GXG B;  4A3P A;  4B0E A;  2KFK A;  2QQ8 A;  3VH3 B;  2WXN A;  4ANV A;  4IP3 A;  3UGJ A;  4NRW A;  4I81 A;  2MBQ A;  4PD2 A;  2KHH A;  2V0G A;  4IC7 B;  3HJS A;  3LXS A;  5FPW A;  1S4V A;  1V5T A;  4B95 A;  2Z4R A;  4KZ0 A;  3HHI A;  2C5R A;  4W5W A;  2J0J A;  1L2B A;  3ALB A;  3B0A A;  3IBE A;  3TWL A;  5JXV A;  2AHM A;  2R46 A;  2PLP A;  4XBO A;  1FNU A;  4QNM A;  2L0T A;  2RSU A;  2E03 A;  2HH5 A;  3K24 A;  4AWJ A;  1DV0 A;  2PW9 A;  1Q0W B;  4UDU C;  1KSF X;  2J53 A;  1HR0 M;  2AYO A;  1HNZ M;  3GPY A;  1ZOY B;  3KOX E;  3QT4 A;  3FUT A;  5CTR C;  1IY1 A;  1FIQ A;  2DVW B;  2KAN A;  3L08 A;  3PDF A;  3AH7 A;  3PPA A;  1CV8 A;  1D5X C;  4G50 A;  1CJE A;  1J09 A;  2Z3X A;  4GHA A;  4EFO A;  1MG4 A;  5HFY A;  1KLU D;  1RU3 A;  2JA2 A;  4NJ6 A;  1SXJ A;  2GFO A;  4LF5 M;  3VRB B;  2ZM6 M;  4XR7 A;  2ZBK B;  4LJP B;  2Y5C A;  2LHE A;  2JX5 A;  2LTU A;  1BT0 A;  3HKP A;  3SD5 A;  3PLV A;  3L16 A;  4II2 B;  4DHJ D;  1VRA B;  1YK7 A;  1WR1 A;  4L15 A;  4GMQ A;  2M17 A;  3N32 A;  3I3T A;  4YSY B;  9PAP A;  2QC8 A;  4N8W A;  1NB3 A;  3R2I A;  4FA6 A;  1PVJ A;  3RD2 A;  1NNJ A;  1N5X A;  3RPF C;  2XK5 A;  2XEW A;  3DWM A;  3W2D A;  4CDD B;  1VEK A;  4MT5 A;  4RGM A;  3ZVV A;  4PCZ A;  2N9L A;  2E00 A;  4XDD A;  1WYW B;  3A9K B;  4EZJ A;  1ZDX A;  2Y20 A;  4XYC A;  3QHT A;  1FMA D;  1ICF A;  4ZOH C;  1PJT A;  3L26 A;  1NV8 A;  5EDS A;  4QBB A;  1A5R A;  2MP2 A;  5KPZ A;  1KFU L;  2YR0 A;  2AYN A;  5IN7 A;  1D0M A;  4RF0 A;  4CHT B;  2INP E;  4L2Y A;  1PGY A;  4R71 A;  2LHG A;  1FFV A;  3GPP A;  2Z0D B;  2JNH A;  3GLH B;  1N75 A;  4I07 A;  3LVV A;  1YJJ A;  2O6V D;  4FJV B;  4L6V 6;  3ZTC A;  4PK1 A;  3PHX A;  2BWE A;  1UKF A;  1FXA A;  4JV5 M;  2WXP A;  4PS3 A;  4YTN B;  1MEG A;  1XLO A;  2PE6 B;  3VAW A;  3Q14 C;  4BLC A;  3CIR B;  2UXB M;  2DAI A;  2O6X A;  1P3Q Q;  4IBD A;  4P6V F;  2EJS A;  2KTF A;  2XH9 A;  2RGO A;  4PYZ A;  5CHV A;  1JML A;  3AE2 B;  2Y0T A;  2L3Z A;  4N58 A;  5BMI A;  3M99 A;  4RFB A;  3L54 A;  1K50 A;  1MHX A;  1V49 A;  3L29 A;  3O0U A;  3PVS A;  1QDQ A;  1SJE D;  2IY1 B;  3PHU A;  1E32 A;  2WSC F;  2NQA A;  1E7U A;  3WAM A;  2RR9 A;  1DOX A;  3EHV A;  3LDZ E;  1EO6 A;  2WGS A;  1WX7 A;  2YJC A;  1EFU B;  4DUZ M;  2DZM A;  1D0K A;  1TZ1 A;  3KWV A;  3O1G A;  5H37 D;  2UUC M;  2GBJ A;  2KDI A;  1J7A A;  3TQS A;  4RNA A;  3N20 C;  4LRS A;  4G3O A;  4IG7 B;  5ITU A;  2ZCB A;  3IAS 1;  3NBX X;  1V86 A;  3L4P A;  3KW5 B;  3VTW A;  1XT9 B;  2MWS B;  5C18 A;  5CHF A;  1BVS A;  1IBM M;  2BDZ A;  5CVM A;  7CAT A;  4W9J A;  4DK5 A;  3GOE A;  1GC6 A;  3OF8 A;  3FUX A;  2YJ9 A;  2D3A A;  4JE3 B;  2DKL A;  3SAW A;  4A9A A;  1TS3 A;  3HX3 A;  1QUS A;  1S3S A;  2MH7 A;  2WBF X;  3NS8 A;  4C80 A;  1PJI A;  1MJD A;  4NOO B;  2NTT A;  5JI3 E;  1E7V A;  4JPS A;  4P7I A;  1TU6 A;  1C7Y A;  2H7J A;  3X23 A;  3L25 A;  4CZW A;  2LGX A;  1YE9 A;  2LVP C;  3RGS A;  1PJS A;  5DCN A;  3WHK A;  1DO2 A;  3PNY A;  3HGI A;  3E21 A;  1JB0 F;  2GBM A;  3CST A;  3CF6 E;  3SFE B;  1ORY B;  1VG5 A;  2DWQ A;  2ZEQ A;  2DZN B;  2OZ2 A;  1FM0 D;  4MH0 E;  1PRB A;  1V6E A;  1D4B A;  3DBL I;  2EKK A;  5A2Q S;  4OHJ A;  3AJI B;  3SR6 A;  1TS5 A;  3GCB A;  1Z6T A;  3GPU A;  2JSV X;  4I04 A;  3W1S A;  1Z2M A;  3DWG C;  3NVY A;  1FNN A;  5LXH A;  2ON8 A;  2XSZ A;  3Q8X A;  1L0X B;  1EWL A;  1BXT A;  3R9X B;  3I57 A;  1ZXH A;  3P5U A;  1YD8 U;  2OP3 A;  5ITR A;  3ZYY X;  3AEB B;  4BBA A;  2WXR A;  3Q8B A;  2L32 A;  3OIS A;  1RRB A;  3NWL A;  5KO3 A;  3SYL A;  2UYZ B;  3PRP A;  2CU3 A;  1PUT A;  3JSV B;  3WXF A;  2V1U A;  3E46 A;  1WGD A;  1STF E;  4OVZ A;  1I35 A;  2G3Q A;  2CUZ A;  2BBC A;  1QIL A;  3PO0 A;  2VII A;  4DMY A;  5BO4 B;  2IO1 B;  2D3B A;  4EZK A;  4KVG B;  4LNI A;  3ZXR A;  4A55 A;  2WXQ A;  1XF5 L;  1GCB A;  1W5S A;  2M4N A;  3PT2 A;  1XB2 B;  5LLI A;  1QKZ A;  2N7E A;  3PTF C;  2IGH A;  5EF4 A;  2KNV A;  2W9N A;  4JI1 M;  1S1Q B;  3J27 B;  3DHI C;  1KFX L;  2PAD A;  1VLB A;  2HTH A;  3QSD A;  4LFA M;  2XU4 A;  2AX5 A;  3LVW A;  4D2K A;  2L2D A;  3MC9 A;  3QWL A;  4PT5 A;  5ITY A;  1GG3 A;  1PDX A;  4F1I A;  3B7Q A;  3IOQ A;  1WI0 A;  4LGY A;  4NSR A;  4NXN M;  1NY5 A;  4GKJ M;  4LF4 M;  4BOS C;  3JW0 X;  3OG5 A;  2CB5 A;  2KT7 A;  2LD9 A;  4RKX A;  3HHM A;  5DPT A;  3N4C A;  4MM3 B;  2BS4 B;  2KRK A;  3T6P A;  1YX6 B;  2KDE B;  4HKQ A;  1I4R A;  2M0A A;  2OED A;  5D3D A;  4DXG A;  2HWK A;  2KMA A;  1OFF A;  2G6D A;  4QAY A;  3RFW A;  1F2R I;  4O1N A;  3D6S A;  2CE7 A;  3P5V A;  3RNV A;  1PGX A;  2XU1 A;  3ABV B;  2KNA A;  2WXJ A;  4I05 A;  2VZK B;  1R7R A;  3ZNG C;  4ITQ A;  2OJW A;  4YYU A;  1WZ0 A;  5KQ8 A;  2G4D B;  2K8B A;  2CHW A;  3MHH A;  2X8A A;  2KTR B;  1QZM A;  3PV1 A;  3UK6 A;  2DEN A;  2UXD M;  4IJE A;  1JRO A;  5C1Z A;  1J7K A;  2JWS A;  1JWM D;  4EEW A;  2LGY A;  1RWS A;  1QOL A;  4ANW A;  3AV0 A;  2J4X A;  1K8R B;  1NO1 A;  4FWG A;  4JIO U;  4ARI A;  3T3O A;  5L8R F;  2Y21 A;  4IM2 A;  2MEK A;  2K6B A;  1WH3 A;  2MBB B;  2CHZ A;  1X37 A;  1L5P A;  2MW5 A;  2LRW A;  2GRI A;  4ZRJ A;  1WGH A;  1YVB A;  4YY3 M;  4KIK A;  1T43 A;  3HK0 A;  3NHE B;  1JW9 D;  2NBW B;  4XZ4 A;  2YJ2 A;  2K5P A;  2DXI A;  3QQ8 B;  3A33 B;  3I63 C;  2YEP F;  4YXD B;  3FTE A;  3AE4 B;  5TR5 A;  2FUD A;  1IUE A;  2KVR A;  4LJA A;  1IBK M;  2B1N A;  2RDG A;  2EEL A;  3CSF A;  3DVG X;  4MGZ E;  2B1M A;  4A3O A;  2KW0 A;  3HU3 A;  2O5R A;  3N3K B;  1TS4 A;  1WMH A;  2KJ6 A;  5AEK B;  4M01 A;  4DMX A;  1NV9 A;  5FTN A;  4ANR A;  1KH0 A;  3Q3J A;  1TL9 A;  4YL8 A;  1TH2 A;  4YVA A;  5IWA M;  1DGF A;  1J7B A;  1WRD B;  2H89 B;  1IM2 A;  1SSN A;  5HG2 A;  1WIV A;  5JA7 A;  2N7J A;  2DAM A;  2LJ5 A;  3E4R A;  4LDT B;  2I7N A;  1YX5 B;  2V3P A;  1EWO A;  1JWB D;  3H8B A;  2L05 A;  2C9C A;  5DPS A;  3ZH9 B;  2LVP A;  2QHO A;  2LRU A;  3HVZ A;  2QCU A;  1PJJ A;  1BGO A;  4WJP A;  1MU5 A;  1QQR A;  3CH2 X;  5IOI A;  3NBI A;  3Q8C A;  1DO0 A;  1V9J A;  3HM3 A;  2PBH A;  1Z5C A;  1DOY A;  3HU1 A;  1ZW7 A;  4WWO A;  3U61 B;  1C76 A;  4ZTB A;  2JY6 A;  2HKJ A;  2O01 F;  4IJF A;  1U9Q X;  4HPL B;  5KQD A;  3Q3F A;  2BTW A;  1D5M C;  3MHS A;  1E90 A;  4CIS A;  3SMP A;  5BYR A;  5BPV A;  2K22 A;  2OOB A;  4NRV A;  2LZ6 A;  4OZA A;  1IYF A;  3D8L A;  3W0L B;  2HE7 A;  1ESF A;  4IM3 A;  4IBC A;  2IZV B;  4HEO A;  2KC1 A;  2R9O A;  3U5Z A;  2DYB A;  3ZC7 B;  3ZGZ A;  3U6L A;  3U7Z A;  2NQG A;  1NYQ A;  1ZCM A;  4Q2J A;  1O0E A;  4QHT A;  2DZY A;  5TSS A;  1AU2 A;  3KFQ A;  4KGR A;  4N79 A;  4XZX A;  4M9S A;  1YJ1 A;  1CK1 A;  2RDB C;  2NPT B;  2WP9 B;  3PS6 A;  1K3X A;  1N62 A;  3HRD D;  3BPM A;  5EXX A;  2AGA A;  1D0L A;  1P9D U;  3ZTD A;  3MTV A;  1SXT A;  3MJ5 A;  1GL7 A;  2LVQ A;  1MN3 A;  3BII D;  2O2V B;  1LV7 A;  1ZKH A;  3VDZ A;  3AEE B;  3U8E A;  1R4N I;  2ASQ A;  2JZ1 A;  4B7F A;  4KGS A;  1EIJ A;  4AXM A;  1C1Y B;  2J0M A;  2AEH A;  3IT6 B;  2JXT A;  5BMH A;  3NOB A;  1Z5A A;  3LW5 F;  1I4H A;  3IXS A;  3UIN B;  4DHJ B;  5EXS A;  3AEF B;  4FJC A;  2K1F A;  3AU5 A;  4ZRI A;  4HWY A;  2DWM A;  1R6B X;  2FBW B;  1P7E A;  1MFW A;  2KJH B;  1IN8 A;  1OJL A;  3ML9 A;  2LXC A;  1ISN A;  4HRO A;  4I6L B;  3LQR A;  2C7M B;  1P0R A;  1E9S A;  5G5H A;  4BOS A;  3M3J A;  4IW0 A;  3AI5 A;  4OZB A;  3B2G A;  1GC7 A;  2FT2 A;  2ZPN A;  4WIP A;  3N1X C;  2RPV A;  3D32 A;  5DYI A;  3APF A;  2KRU A;  4BB9 A;  3AUL A;  2AQ3 B;  4JWS C;  2QNJ A;  3L13 A;  1CSB B;  1DGH B;  3ZXV A;  5A24 A;  1AYV A;  3B89 A;  3A9K A;  1JR3 E;  1UEL A;  4NPN A;  4ZRP A;  2DI0 A;  2LVN C;  2HHH M;  4USA A;  3HY5 A;  1EM7 A;  3QJZ A;  3KP1 E;  4KV2 A;  3RMK C;  1KFV A;  5I4D A;  2DZI A;  2C9O A;  3EFU A;  3GE3 C;  3I04 M;  2SAK A;  4I5S A;  2ERC A;  3MTN A;  5IT9 S;  4TQ0 A;  2KHW B;  1STE A;  4KSK C;  2K9D A;  1OIZ A;  1E10 A;  4C7Z A;  1AIP C;  3GLH A;  1WXQ A;  1OKS A;  2WHI A;  4B0M A;  5BMG A;  1OFI A;  2FUH B;  4W9L A;  5JH5 C;  2W55 A;  1PYW D;  2JF5 A;  2VH1 A;  1XHB A;  2M8S A;  4JI2 M;  1FO4 A;  1LQB A;  2L52 A;  2VHS A;  3CWI A;  5EGW A;  4ARC A;  3MFG A;  3T1Y M;  1CUK A;  1D5Z C;  2G9H D;  4M0D A;  4XWW A;  1T5X D;  3N9Y C;  1PPO A;  2PNS A;  2LWX A;  2N4F A;  4N6E B;  1N33 M;  2AQ1 B;  4PP1 A;  1V33 A;  1L4D B;  2FRA A;  2WZJ A;  3HHX A;  1GVN A;  5C23 A;  1UWM A;  4AG5 A;  2X8X X;  4MGK E;  1CQV A;  5JH3 A;  2MGW A;  2KOX A;  5HI1 A;  2JUJ A;  2BPS A;  3VVW B;  1AAR A;  1A70 A;  1CB5 A;  3UI3 A;  4FJZ A;  2G4S A;  4A8X C;  4M9X A;  3GRR A;  1ET6 A;  2X38 A;  1NQC A;  1IN6 A;  1G4A E;  3TEW A;  1L1T A;  3SAT A;  2FCQ A;  4LNF A;  4C4V B;  2D3G A;  2PRE A;  1MS6 A;  4ZUX U;  3TNX A;  3HWS A;  3ZUN A;  2E01 A;  2XZF A;  3IHP C;  2A5U A;  2MBE A;  1R4N B;  4P1B C;  3NVV A;  1FH0 A;  3DF0 A;  2GOW A;  2WWZ A;  3GZN B;  4REZ A;  2DYM A;  3BIN A;  1N61 A;  1AUA A;  3WIM A;  4DV0 M;  4MSM B;  5JHA A;  5DFL A;  3F5V A;  3EIH A;  3O13 A;  4LCD E;  1BQI A;  1R7S A;  3U6O A;  2J7Q B;  4TUW A;  4BKS A;  2KYW A;  1WIA A;  1TF0 B;  1FRR A;  2I38 A;  4R7G A;  3BPF A;  2R65 A;  2QIE B;  2QSF X;  2R4E A;  2JY8 A;  2LAS A;  3P5X A;  1F2C A;  1T0S C;  1FJG M;  2XNA C;  4HCN B;  2MRO B;  1GB4 A;  4BOU A;  3AU4 A;  1NHW C;  2KXE A;  3J7B A;  1OGW A;  4CHK A;  2Y5B A;  4OU7 A;  3CMM B;  1ME3 A;  3OJ3 A;  2P5T A;  3SAV A;  1EU4 A;  2YVC A;  1AYW A;  4N4Z A;  1VEG A;  4A3V B;  3FD9 A;  1N32 M;  4GEW A;  2D3C A;  3K9P A;  1E94 E;  4AOF A;  3AEC B;  1BY8 A;  4PAD A;  4QNR A;  4JX1 C;  4W9I A;  1CMX B;  3RNF C;  3CBJ A;  3EGR A;  2WXO A;  3K2L A;  1Y08 A;  1GJZ A;  3VTV A;  2R61 A;  3N30 A;  1AU4 A;  2Z0E B;  1PGA A;  2GI9 A;  5D3I B;  3DPD A;  2VF7 A;  2BWB A;  3QWZ B;  2FUG 1;  3I01 M;  1NNU C;  3QYE A;  4P1C C;  2K47 A;  4JI0 M;  2E3T A;  2L76 A;  5FTL A;  2J52 A;  5CX3 A;  1E8Z A;  3U6Q A;  1EE8 A;  2LFI A;  2D5G A;  2XFT A;  3JSV A;  2TSS A;  1AW7 A;  1OTR B;  1KHP A;  4X57 B;  3TSS A;  3BC3 A;  4MJS B;  3W1S C;  2RRU A;  3OWE B;  3NVW A;  1B1Z A;  2WDR B;  4NJC A;  1WF9 A;  4HKZ E;  3FYC A;  1XNR M;  2RDH A;  2L0F A;  2KO3 A;  3IG3 A;  1G8P A;  3AOG A;  1WY8 A;  2AQ2 B;  2BU3 A;  3KXE C;  2P7U A;  1TKG A;  2ATO A;  3RT3 B;  4AQ7 A;  3HIZ A;  2QMT A;  3SFZ A;  2GLS A;  1SE2 A;  1UFZ A;  3EEC A;  4QH6 A;  3GS2 A;  3H8H A;  5E26 A;  1BML C;  3MK6 A;  3KOZ E;  1EF7 A;  4G11 A;  1QT9 A;  3GQ4 A;  4LNK A;  4IBK A;  2NS5 A;  3DBH B;  3VUX A;  4Z6Y A;  3CH3 X;  2BS2 B;  2N1W A;  4B3S M;  5H92 C;  4LJ8 A;  2ZCC A;  5KHQ A;  1WE7 A;  3GLH E;  2N7D A;  5EP1 A;  4MAC A;  4M8N A;  1RM6 C;  3OF9 A;  4IBB A;  3T1H M;  1IWD A;  2C5L C;  5IAA C;  1HNX M;  2KDM A;  4WJO A;  3IUT A;  3T15 A;  2WXG A;  3B21 A;  3HD3 A;  2N35 A;  3LYY A;  3B2F A;  1FFU A;  2QDF A;  1MG8 A;  1N6Z A;  1F29 A;  2DX5 B;  2RPQ A;  1CZP A;  5CHW A;  1Z5S B;  2NQ8 C;  3AFH A;  1Q5W B;  3RGP A;  1NB5 A;  3B79 A;  2N0S B;  3HZJ A;  2MJ5 B;  4EZL A;  2HD5 B;  1HTQ A;  3SFD B;  1ATK A;  4FD2 A;  1WRI A;  2AL3 A;  3FE3 A;  4DBG A;  5JZE A;  1Y8R C;  3CGW A;  1XNQ M;  2VQF M;  2DAK A;  3P1M A;  2R6F A;  1A5T A;  1D3Z A;  1UF0 A;  2I7P A;  4DHZ B;  1V92 A;  2KTR A;  4AG6 A;  3NZS A;  3PVL A;  3RNA C;  3OVX A;  3PXG A;  4MEM A;  5G2N A;  2MSE D;  2Y3A A;  4EKU A;  3J2P B;  4YWG G;  3F75 A;  4BVU C;  1VZ7 A;  1P98 A;  2G7Y A;  1OAO C;  2J7N A;  1L0Y B;  5E6N A;  2ONQ A;  2IO2 B;  1QAN A;  4LJ4 A;  4KSL C;  2UWQ A;  3DOW A;  1OEY A;  3MC8 A;  3W9C B;  2ZAN A;  2MJ3 A;  3IAM 1;  2KAC A;  1NVI D;  4B7H A;  2CU1 A;  2ZZP B;  3PRE A;  2R44 A;  3I5J C;  1HJP A;  2W54 A;  1X1M A;  4YHH M;  2R0I A;  3NHE A;  2KQS A;  5AZH A;  3IHP A;  2B76 B;  2FQ9 A;  1VZ8 A;  3AE6 B;  4GB9 A;  3TPZ A;  1WGN A;  3LCV B;  2LXE A;  3PSE A;  1KJT A;  4DV6 M;  4J3O D;  4OZC A;  4C56 C;  3BVZ A;  4B6W A;  2EMT A;  2WDT B;  3E1Z B;  4G54 A;  1AU0 A;  1XXG A;  4K7S A;  2LJI A;  2BB6 A;  2Z8Y M;  3N3K A;  3B9J A;  1QUT A;  2L6O A;  4KLB A;  3THG A;  3PZD A;  2R9M A;  3GLF B;  3K9O A;  5KPT A;  1EWP A;  2HDE A;  4KZC A;  3DCG A;  1QMY A;  2N9E B;  3W0F A;  1K82 A;  2DBY A;  3V76 A;  2KFJ A;  4MZS A;  4IBF A;  2B3T A;  2W3S A;  3V3X A;  3NZ3 A;  1K3B B;  3FAH A;  4K7C A;  3FTC A;  2UU7 A;  4X66 M;  2LGD A;  3U60 B;  3VKG A;  3WCQ A;  4P17 A;  2G45 B;  3BZD B;  3APD A;  3I9V 1;  2J7Q C;  2DJF B;  4LNN A;  2JQR B;  2C99 A;  3T3N A;  3U61 A;  1JAL A;  1ZMV A;  1TYG B;  3E56 A;  1TTN A;  2K3U A;  3A98 B;  1L4Z B;  1XO3 A;  4AP4 C;  2RGH A;  4BBN F;  3GQ5 A;  2OHF A;  2XU5 A;  4GOC A;  2FE8 A;  1F2A A;  2ZTD A;  3IFU A;  2GBK A;  1FNV A;  1QDR A;  4AJY B;  3H89 A;  3KW9 A;  4LJO B;  4LFC M;  5D7G A;  3KW6 A;  3GLG B;  4W9C A;  1I4G A;  2WXF A;  3RCZ A;  4BOP A;  2QZ4 A;  3C3D A;  3AL0 C;  4M8M A;  3U7D A;  1TDH A;  3RI7 C;  2SEB D;  3KUD B;  4HPM B;  2DHZ A;  4IM0 A;  4NZL B;  2W3R A;  2BWF A;  4DWF A;  4CIZ A;  1IGC A;  2FIF A;  4K1R B;  1ROE A;  2QEJ C;  2YFQ A;  3KWB X;  3VDP A;  4YYV A;  1N78 A;  3ZIM A;  3F92 A;  3V6E B;  2K39 A;  2JXN A;  2CV2 A;  4G3X B;  1ZIV A;  3PBH A;  1ZQ9 A;  2RGF A;  1YN3 A;  1BP4 A;  1QOA A;  4HCP B;  3VTU A;  3Q8A A;  3X0W A;  2YJ8 A;  1NVM A;  1ITO A;  1NJF A;  2R9F A;  3JR5 A;  1TGZ B;  1J8C A;  4LF6 M;  1RLF A;  2DHY A;  1L2C A;  4GN1 A;  4II3 B;  3MHS D;  4B3R M;  2JZP A;  3ZNI D;  5L83 A;  2H88 B;  2VF8 A;  1SE3 A;  1V81 A;  1UGJ A;  2R6N A;  4W5B A;  1Y8G A;  2KXJ A;  1PXV A;  2JWZ A;  2XBB C;  1CPJ A;  3A9J A;  3C9P A;  2E5L M;  4W9F A;  3IT4 B;  2L4F A;  5EJC A;  3AE9 B;  1K53 A;  3OTO M;  1TKY A;  3C0R B;  3VFD A;  5PAD A;  1UWX A;  1OQR A;  1V2Y A;  1WGR A;  3TBL D;  1C1K A;  1IQP A;  1XCT L;  4W9K A;  1QVR A;  2L4E A;  2K6D B;  1LGR A;  1DGH A;  1SBB B;  4XGA B;  4MSQ B;  3SHQ A;  1YLA A;  4B08 A;  4KKI A;  2E6X A;  2QSD A;  4URK A;  5K16 A;  1T0Y A;  1D2N A;  1PAD A;  1HNW M;  2LVQ D;  3I4V A;  3MHV C;  2WSE F;  2DCA A;  1XLQ A;  2KVZ A;  3AKZ A;  2MJE A;  2OO9 A;  1MIR A;  3CF2 A;  4K3B A;  5EE9 A;  2DZZ A;  1AYU A;  1DGJ A;  2KN5 A;  1MEM A;  2HTM E;  4GIP A;  5EXP A;  1GLN A;  4GSW A;  4MEL A;  3RE8 A;  4B3M M;  3UIO B;  1PE6 A;  1D6E C;  4D81 A;  4C00 A;  2BJV A;  4ZDV A;  1MDW A;  4WWN A;  1TZO A;  1Y4H A;  1OQY A;  1K51 A;  4GRI A;  3TWM A;  3SAS A;  5BR8 M;  2MR9 A;  2WS3 B;  1I4P A;  4JI7 M;  1XMO M;  4YYR A;  1JR3 A;  4JL9 A;  3TMP B;  5E6J A;  1UBI A;  1IXS A;  1KXR A;  1V34 A;  3PRZ A;  4DQO C;  5E6P A;  3GE8 C;  1YNT E;  1F77 A;  2PPH A;  1QAM A;  4QOS A;  2BYF A;  4S12 A;  2M56 B;  2REX A;  4GDK A;  4M02 A;  3GRU A;  4M00 A;  1DGB A;  1L6V A;  1T0R C;  4WAF A;  1GMY A;  3M7G A;  5BYQ A;  3KWL A;  3LB8 C;  1YZB A;  3DBL B;  1U9W A;  2HHN A;  4XUI A;  1IY2 A;  1WE6 A;  3QJ3 A;  2JPH A;  3Q3M C;  2G8L A;  4FCV A;  1R4M I;  2CR5 A;  1U9X A;  2C7H A;  1H4R A;  1WXV A;  2KNZ A;  3M6A A;  2Q2E B;  1WSP A;  4JI3 M;  5LXI B;  3ENE A;  3Q3O C;  3BWK A;  5IKC M;  1P1A A;  1YK8 A;  3KSX A;  1IGD A;  2Z8L A;  5CVO B;  5DNY A;  2B3A A;  2PMV A;  2N9X A;  4B9K A;  1E8W A;  3GP7 A;  4CDE B;  1HZ5 A;  4B3T M;  4WQO B;  1W5T A;  2R62 A;  2CJN A;  4TKN A;  4X6I A;  2DWL A;  1T0Q C;  4YYW A;  1KM7 A;  3GPX A;  4M0W A;  3U6D A;  3ZNH B;  1DF0 A;  4RGO S;  4OW0 A;  1ZV1 A;  1E0Z A;  4FW9 A;  2J7Q A;  2NMQ A;  5AUI A;  2FFJ A;  3IVF A;  4LLG M;  2JWU A;  2J42 A;  1JRU A;  2ACZ B;  3ML8 A;  2ICI A;  2KJR A;  1E8X A;  3H7S A;  1WGL A;  1QAQ A;  3BY4 B;  3VFK A;  2IDY A;  3BOS A;  2K8H A;  1IP9 A;  4LFB M;  3VK7 A;  2RKO A;  1MI0 A;  2DZO B;  3MP2 A;  2V6Z M;  2CP8 A;  3VQI A;  1SE4 A;  2K9X A;  2M1M A;  2X49 A;  1ME4 A;  2FID A;  5IA7 A;  4L16 A;  3CTW B;  1FPY A;  3LQQ A;  1E5W A;  1TGU A;  4MB7 A;  3EA6 A;  3U6E A;  1JWA D;  2DZJ A;  3PLU A;  1OAI A;  1JWS D;  3E9S A;  3NG0 A;  1YN5 A;  1KLV A;  2LUE A;  4D8I A;  4YYS A;  1P7F A;  4XDC A;  2H1R A;  4TUU A;  3DBR I;  2EKF A;  2GB1 A;  2IO0 B;  3VHT C;  1NI3 A;  4R3D A;  1SG9 A;  4NXM M;  4KKJ A;  1IN7 A;  3FRH A;  4GC5 A;  1Z59 A;  2E02 A;  1G41 A;  4GDL B;  1TKE A;  5F3W A;  1YUB A;  1C9F A;  3KQ4 A;  1LXD A;  2CWB A;  4RGT A;  2L7R A;  1GB1 A;  1F1H A;  4WA6 A;  3M63 B;  2MBO A;  3IG5 A;  4JWU C;  4BKS D;  2KDL A;  2EO2 A;  1OTR A;  3BB7 A;  4CDC B;  4WP2 A;  4DR6 M;  3H4M A;  4LF8 M;  1GJS A;  1TJE A;  3R8B A;  4BPV A;  3BK2 A;  4GU2 A;  1AIM A;  3P4S B;  5FTJ A;  3ZQJ A;  2V1Y A;  1L8Q A;  3VRA B;  1SJH D;  2KZU A;  3ZO5 B;  4ASW C;  3RN9 C;  3FTD A;  2LI5 A;  5F02 A;  2KNB A;  2XN9 C;  1UGM A;  1A6R A;  4NJ7 A;  3RNE C;  3A1Q B;  4FWD A;  2YNM D;  2KQ4 X;  3LFY A;  2AIM A;  1XLP A;  2H5X A;  2IBI B;  3AXC A;  1WXS A;  3NY5 A;  2F7D A;  1VDL A;  3WAP A;  1JCK B;  2R9C A;  2JUO A;  1N77 A;  2BDL A;  3FTF A;  4WQM A;  2GBR A;  4YTM B;  4MDK E;  3V61 A;  4NNJ B;  1R4M B;  2BS3 B;  4D8E A;  2AVW A;  1L0V B;  4FWH A;  2DWZ B;  1GAQ B;  5EE0 A;  2CHX A;  1QOF A;  5DYG A;  5DPW A;  1HQY E;  4W9D A;  3EIE A;  1SP4 B;  4YSX B;  3V60 A;  2L7H A;  5GMV A;  1NPZ A;  1HQR D;  3VXW A;  4RMA A;  1WGK A;  4LZJ A;  4XC2 A;  2J7O A;  1GPX A;  1OEY J;  1YQB A;  1HZ6 A;  2QJL A;  4A20 A;  4AI6 A;  4IDI A;  1QF6 A;  4IIW A;  2BTE A;  1I7H A;  4K7W A;  4X62 M;  1DYQ A;  4L8R C;  4K0K M;  2ZTC A;  1YQ4 B;  2MBH A;  2O6V B;  1QOB A;  3A4R A;  2WDV B;  3P2B A;  1PGB A;  3BWU D;  2QEN A;  4RY2 A;  2WX1 A;  2HD5 A;  1ZMU A;  4EE2 A;  2N1V A;  1P3Q U;  4OEM A;  1TR8 A;  1HXY D;  2C7N B;  4J6I A;  4S17 A;  1ET9 A;  2DCD A;  2D07 B;  2OJR A;  1KTK A;  4EIW A;  1F9J A;  1EUV B;  4A90 A;  2AWT A;  5EE1 A;  3ZLZ A;  4F7Z A;  3IEJ A;  2KMM A;  1SXJ D;  2L7I A;  4AXL A;  4RM9 A;  4IBI A;  1FD6 A;  1E6E B;  1IBX B;  1J7C A;  3H6S A;  2PTL A;  2OOA A;  4I4L A;  4G4Q A;  3IMA A;  2J0K A;  3QX1 A;  2AUX A;  3TRK A;  3H6N A;  5EP4 A;  4IKG A;  3IV2 A;  5AUK A;  1U9V A;  3AB5 A;  4LNO A;  1THE A;  1N34 M;  4FVM A;  1MHH E;  2HWJ A;  2IO3 B;  2CHV A;  3R7Q A;  4KHP M;  2IND C;  4MH8 A;  5EXT A;  3L27 A;  4HLQ A;  4NL4 H;  2INC C;  2C60 A;  2R9N A;  6PAD A;  2AS8 A;  5CHT A;  1C77 A;  2OQ4 A;  4NSO B;  4F2L A;  4DV7 M;  3KUZ A;  4AKG A;  4CDF B;  1UD7 A;  2BKR B;  1RAX A;  4G6Z A;  1K3W A;  1V97 A;  2I1K A;  3AMZ A;  2JP7 A;  2L1A A;  3HJQ A;  3KOY E;  3T38 A;  1M6D A;  1CQD A;  3W1Y A;  2LBC A;  4DDI D;  2WXH A;  1MHW A;  3H1U A;  4QHS A;  1U4A A;  3TL5 A;  4G4R A;  3P4Q B;  5FKA C;  3AE5 B;  3P63 A;  3AI8 A;  3TEX A;  3KKU A;  1GKI A;  4PDI A;  1YAL A;  3FKY A;  2JY5 A;  4I8O A;  2CRU A;  5EP3 A;  3FIL B;  1HUC B;  4X6J A;  5FK9 C;  4DR1 M;  3UMM A;  4M9Z A;  4WUR A;  3GLF A;  2R2O A;  8CAT A;  4BS6 A;  2UXC M;  3BVM A;  3A4S C;  4IUM B;  3ZW3 A;  4BOZ B;  4X65 M;  3DA1 A;  3K1J A;  1KRH A;  4B7G A;  2A4Z A;  3HJ8 A;  4II7 A;  1WJU A;  3PGE A;  3RVX A;  4L1B A;  2LEK A;  3URY A;  4OVV A;  3TWK A;  4W9E A;  5JHB A;  1IN5 A;  5AZG A;  3T9L A;  1L1Z A;  1PIP A;  1EWY C;  3UQB A;  1Q3C A;  2Z84 A;  2EKI A;  2W82 A;  4LCB A;  3U60 A;  1V5O A;  1ZP0 B;  4FUL A;  1ENF A;  4OVU A;  3V62 A;  1G6J A;  4KGT A;  4DXF A;  2ZPY A;  3FRI A;  1WFY A;  4EUT A;  2CV1 A;  3A45 A;  1WJN A;  1JWU D;  2JZZ A;  3U6C A;  2LGI A;  3P4R B;  1OFH A;  3HHW A;  4DXA B;  4PYU A;  4BFR A;  1NBF C;  1VDD A;  3VH4 B;  3OAW A;  1PPP A;  3PZ8 A;  2J5Y A;  1AYF A;  3KYC D;  2KC2 A;  4I6N B;  1FRD A;  1RFA A;  3W67 A;  2MRP A;  1VSN A;  3KVW A;  3R8F A;  1T6B X;  1VZ6 A;  2DAJ A;  2UUA M;  2WXM A;  2PE9 A;  5EZQ A;  3GLI E;  1UBQ A;  3AED B;  3BOW A;  2DCC A;  4FHJ A;  4W9H A;  2MJD A;  1I42 A;  1OQQ A;  1KYI A;  4QOZ C;  1H8C A;  2KAJ A;  2KWD A;  1LO5 D;  3Q6B A;  1TT5 B;  4BKG A;  1DEU A;  1E9R A;  4DR5 M;  3KWZ A;  3H7P B;  3ERV A;  3JR4 A;  2YJB A;  2PVG C;  1YN4 A;  5HKH A;  3V6E A;  2LHC A;  2FO5 A;  1IXR C;  4NC6 A;  2F5Q A;  1E7P B;  4LRT A;  2JRH A;  1AWD A;  3UGB B;  3WAN A;  1EWM A;  2K0P A;  1R5L A;  5EQT A;  4W4U A;  1PPD A;  2OOB B;  3ZDT A;  1WGG A;  3QAR A;  1HT2 E;  1YOV B;  3ZDM C;  1XXH B;  4DV5 M;  3B08 A;  1I94 M;  3BVG A;  2GQF A;  3GLI B;  3U5Z B;  2L09 A;  2WX0 A;  1PM5 A;  2JYE A;  4TV3 A;  2KLC A;  1YT7 A;  2BT6 A;  2Z7J A;  4LJ6 A;  3JAM S;  3QIJ A;  1ZPS A;  4P16 A;  1HQC A;  3HHA A;  4ANU A;  5D6J B;  1WYG A;  2L8J A;  3ECI A;  3FC4 A;  3FUV A;  1KLG D;  3PRM B;  1YMH E;  1NDD A;  1MPE A;  3Q3N C;  2KDB A;  2ZW0 A;  1AN8 A;  1PQS A;  1QZE A;  4HDO A;  4JGH B;  4IOI E;  1FXT B;  2CKH B;  4ANX A;  4ZYS A;  3EC8 A;  3WXE A;  3C0R A;  1HTO A;  5EE3 A;  1G71 A;  2CHG A;  3SU8 X;  3ONS A;  3K92 A;  1JQJ C;  3VR8 B;  1ZDV A;  1EF1 A;  3U4E G;  4DHZ E;  1IXZ A;  3DOA A;  3KOW E;  1S3S G;  1XKG A;  2XSZ D;  3RNC C;  3UF8 A;  1TLO A;  3HHY A;  1PJQ A;  4A5U A;  3V6C B;  4FBJ B;  4Q7J A;  1UNS A;  1CS8 A;  1QQW A;  3SYK A;  4HL4 A;  2AL6 A;  1L2D A;  4LJ7 A;  1YJI A;  4HK2 A;  4MM3 A;  2FCN A;  3ZQ4 A;  8PCH A;  4DDG D;  1Q10 A;  2BF8 B;  2CJO A;  5ITX A;  1DKI A;  4KO8 A;  2DCB A;  2L00 B;  4JYA M;  1GLO A;  1T3Q A;  2R4J A;  3Q8F A;  5J2R A;  3VDU A;  1WXM A;  1WM2 A;  2BKF A;  4MSX A;  1NLJ A;  3DVN U;  3RNG C;  4WAA A;  3PHW B;  2HJ8 A;  1NEN B;  2Y6E A;  1F4I A;  2JRI B;  3GRV A;  2V4L A;  2EMS A;  4NAW B;  3U30 A;  5J94 A;  4NAM A;  2VHF A;  3S3Q A;  2C0Y A;  3TMP A;  3FKE A;  2VH2 A;  2A5Y B;  4L78 A;  4AUQ C;  4ZHO A;  2DHR A;  2Z4S A;  3B7Z A;  2FH0 A;  3O65 B;  3R3M A;  2Y0Q A;  2QBY B;  2MLB A;  1VCB A;  4Z8X A;  3SAU A;  4RCO A;  4JI6 M;  1F0Z A;  3AV8 A;  2ARY A;  3GLF E;  3WHL A;  3MTN B;  2PKO A;  3GP1 A;  3ZJU A;  1I4Q A;  1WJ6 A;  3IG8 A;  4HRS A;  5ITT A;  3RVW A;  2BB5 A;  4XWT A;  1EWC A;  1Y56 A;  2BGF A;  1UM8 A;  2KWU B;  2JQG R;  2JT4 B;  2K6Q A;  3NRZ A;  2BNK A;  2V9H A;  1GL6 A;  1L2N A;  2XU3 A;  4NY0 A;  4PS7 A;  2XEP A;  2AU1 A;  3ZUA A;  4OEL A;  3M95 A;  4NQL B;  2D7H A;  4MGY E;  1YSY A;  2PVO D;  5DPR A;  2I2Y A;  1PBH A;  4Q8H A;  2JXX A;  3M62 B;  2G5G X;  3LMM A;  4GHL A;  3WA0 A;  5GKN A;  1N60 A;  3K9M A;  5CVN B;  1WJ4 A;  4DUY M;  3P5W A;  2DNF A;  2LMC A;  3AE8 B;  3ZNH A;  1GJT A;  4DV1 M;  2JYT A;  3S3R A;  2DC9 A;  4IWO A;  5H8Y E;  4ZYN A;  1JR3 D;  3K8Z A;  2JQF R;  2M60 A;  4TQ1 A;  1GUA B;  3BY4 A;  3GLG E;  1G3I A;  2KEB A;  5FLX S;  1VJK A;  2DWN A;  3Q2A C;  3U8Z A;  3BYY B;  3MHZ A;  1V1P B;  2YEP B;  2KQ7 A;  3N3G A;  3BCN A;  3DFZ A;  3VLF B;  1Q39 A;  3QYB A;  4MGI E;  3MJW A;  3BK1 A;  3B1L X;  3U6P A;  1M94 A;  4LTU A;  2M0X A;  1CVZ A;  1AEC A;  4LGM A;  4CYE A;  2MH8 A;  3AOE C;  2F5O A;  4RF1 A;  3WAO A;  4HVB A;  4YV8 A;  4LG2 A;  1XLN A;  3H9D A;  2XFS A;  3ETR A;  2LNH C;  4DR4 M;  2FS1 A;  2LXA A;  1PPN A;  4EOY A;  3MC0 B;  3FYD A;  3L2A A;  4LY6 A;  1X9Y A;  3T8M A;  2KN4 A;  5EP2 A;  4I6P A;  4QRG A;  4UN2 B;  2IPK D;  3I4Y A;  4GDL A;  4ZRK A;  2QP9 X;  2BJW A;  4XGI A;  1SE9 A;  2KX3 A;  3PZ7 A;  4WWM A;  3HU2 A;  2Y5B B;  4IWP A;  2BYT A;  1YQ3 B;  5HHD G;  2NPT A;  2R18 A;  1C78 A;  4AS1 A;  2LWP A;  1QOG A;  2UZJ A;  1GNU A;  2YLM A;  3NJT A;  1E9M A;  3MP9 A;  2EUC A;  3TEZ A;  3EFC A;  3H4J A;  2JVC A;  3R7R A;  1EF5 A;  2O2V A;  3K9P B;  2GNO A;  1JQ4 A;  1DOI A;  1FNW A;  2OPF A;  5LMU M;  2IGD A;  4IBJ A;  1FEH A;  4HXD B;  2CV0 A;  2KMC A;  3L10 B;  2C9W B;  2KD0 A;  4DV3 M;  2KFK B;  2HXZ A;  4PDG A;  2MA9 B;  3A1Q A;  2DOS A;  4GIT A;  1TIF A;  2D7G A;  4BBN C;  1T6O A;  4LJ5 A;  5FTM A;  2ZVO A;  2IBI A;  3RVV A;  4BS5 A;  5KPR A;  1JRP A;  3AN1 A;  3OLM D;  3DQV A;  1SXJ E;  4GXB A;  3C8Y A;  1AU3 A;  1CTE A;  2HAK A;  3QA8 A;  1J19 A;  4JLC A;  1MJG M;  3QAU A;  3APC A;  4C7Y A;  2JTC A;  4AQY M;  1R2Y A;  2MCN B;  1ZAE A;  4CQN A;  4RM8 A;  4DV2 M;  1Q02 A;  5ITX E;  1WZ3 A;  2N9K A;  1L7Y A;  2AYO B;  2NCN A;  3Q69 A;  3UZU A;  4XX5 A;  1NJG A;  3BBZ A;  1G59 A;  2WYQ A;  1TY2 A;  2K25 A;  4GUA A;  4LZZ A;  3N1Y C;  4FIP A;  4FAD A;  3UIP B;  4N9F 4;  2MQJ A;  1VQ1 A;  4MGH A;  1M4V A;  3LXF A;  4ICV A;  4XK8 F;  2CEA A;  1VEJ A;  1N5W A;  2NR2 A;  2O6V A;  2PEA A;  2R2Q A;  2DC7 A;  2JY7 A;  1QDT A;  3JVZ X;  1SXJ B;  1PFD A;  4GC9 A;  3JYU A;  4AW4 A;  2JZ0 A;  3KH0 A;  4W9G A;  3HHZ A;  2APL A;  2LVA A;  4DR2 M;  4WH4 A;  4HDQ A;  1C4C A;  3EUB 2;  3S2A A;  2BW2 A;  4LJ9 A;  1TH3 A;  3V05 A;  1WR1 B;  1SGH A;  2FNA A;  1IFY A;  3KVF B;  3U2S C;  4BZA A;  3SMS A;  2WDQ B;  4GLS C;  4LF9 M;  3I3T B;  2KA6 B;  5KHO A;  2LHD A;  3HM6 X;  1IBX A;  4WJQ A;  1C79 A;  2XK5 B;  2O25 A;  4GKK M;  4GMV A;  1J0G A;  4ICU A;  2ZVN A;  3CBK A;  1WJ7 A;  2WQY B;  4KT0 F;  2V3N A;  1NL6 A;  4PP2 E;  7PCK A;  2HCB A;  1SNK A;  1WX9 A;  1V8C A;  2GHU A;  2MP2 B;  1XD3 B;  2DC8 A;  3MOR A;  2VQE M;  4DBG B;  5JZE B;  1HT1 E;  2EKE C;  3KFU G;  1SB3 C;  3FUW A;  2UU9 M;  1FXI A;  1NSF A;  3SC3 A;  2ACT A;  2Y5P A;  4QRV A;  1U5I A;  4WWP A;  4L23 A;  1HA5 A;  2CHQ A;  3DZD A;  3PHX B;  4F1S A;  2YQZ A;  2K8C A;  3U6M A;  5J18 A;  3QC8 B;  4C4V A;  2XGN A;  3LCU A;  4YSZ B;  3FIL A;  3R66 C;  3U52 E;  1E8Y A;  3ZRC A;  4FLH A;  5FR3 A;  1ZMW A;  1EU3 A;  2NBV B;  1NYR A;  4IUM A;  4BOZ A;  3L28 A;  4FCW A;  3ZCB B;  4CGY B;  2DAG A;  4KDI C;  4D80 A;  3C58 A;  1IBL M;  3ZJV A;  2KX0 A;  2D2Q A;  4JQW C;  4KLN A;  3I51 A;  2MX2 A;  3VUW A;  2LVO C;  2ZNV B;  3DHG C;  1WWT A;  5IP4 D;  2PIA A;  1LTM A;  4DR7 M;  4XE0 A;  2GMI C;  1VD2 A;  1XCQ L;  2LUM A;  4ZRQ A;  1TY0 A;  4BOQ A;  3PSE B;  1VDV A;  3KS4 A;  3KSJ A;  1SIJ A;  1SF0 A;  1WHC A;  4HJG E;  2FNJ B;  3AOE A;  3LJ3 A;  2R45 A;  4AKH A;  3DVG Y;  2RMM A;  4PS8 A;  4KOD A;  1RYJ A;  2XLJ A;  2RD0 A;  4YYQ A;  1N63 A;  1LFD A;  2UUB M;  4GIV A;  5FTK A;  4E71 A;  2L83 A;  4BAX A;  1XWI A;  1WGY A;  3I06 A;  4HEA 1;  3K9O B;  3AE1 B;  3RZW C;  4H2A A;  1ZE3 D;  3TEY A;  2NTS A;  3TIX A;  2D7E A;  4A6Q A;  3OVZ A;  4FK5 A;  2CS4 A;  4NQK E;  1PCI A;  1LM8 B;  3NVZ A;  4MI7 A;  4LK0 M;  2HL7 A;  3ZNZ B;  2JZ3 B;  3C9E A;  3BXW A;  4HLE A;  3QAQ A;  2F5N A;  4BSQ A;  2G1E A;  1T3T A;  3H7P A;  4P6E A;  1TS2 A;  4HJK A;  4QRX A;  3ZKJ C;  1IPG A;  2FCM A;  2ZJD A;  2M19 A;  4US9 A;  4RKU F;  1OIP A;  2DLB A;  2EA0 A;  3VUY A;  2FTD A;  5MPO A;  4G4N A;  1R2Z A;  2DZL A;  4X6H A;  2KDF B;  5EZS A;  1VR9 A;  1I4X A;  3J9C A;  1QLB B;  1NI2 A;  5BYS A;  3W5U B;  4MJS A;  4LF7 M;  2KZS A;  4TSS A;  5IO9 A;  3L17 A;  4P6G A;  1GO5 A;  5D2M B;  4E74 A;  1XXH A;  1POP A;  4ITK A;  2DYO A;  2G8J A;  3RFZ B;  3J7A S;  3GLI A;  5ITQ A;  1SIF A;  2WNM A;  2OUL A;  3H7D A;  2Q5W D;  2F1G A;  3L0W B;  3C3E A;  4Q8G A;  2QCZ A;  4JN6 A; 
#chains in the Genus database with same CATH homology
 3VR9 B;  3GO8 A;  1TDZ A;  1BUI C;  5C3J B;  1FCC C;  3PRM A;  2WXK A;  4TMA B;  2F5S A;  2F4V M;  3ZJT A;  3Q8E A;  3M0E A;  4ZPX A;  4JI5 M;  2QIL A;  2FOI C;  3VKH A;  5T8I A;  4OVZ B;  3AEG B;  3B9P A;  1C4P A;  3W31 A;  4ZHP A;  3P42 A;  4IBE A;  3R2T A;  3W30 A;  1ZXI A;  5C1B A;  3PNV A;  3BYT B;  3TL4 X;  2WLB A;  1QYR A;  2IGG A;  4N59 A;  1NHG C;  3J80 S;  1GOZ A;  4YTP B;  4AKI A;  1FCL A;  3GB1 A;  2C98 A;  4DV4 M;  4YT0 B;  2LH0 A;  2C96 A;  3W5V B;  3D8B A;  2WXI A;  3AEA B;  1SXJ C;  3PHW A;  3GQ3 A;  3P4P B;  1B9R A;  2JRI A;  1N36 M;  5G5G A;  3KLS X;  4RH6 A;  1ZUD 2;  3KDS E;  5LNK 1;  3O65 A;  1H6U A;  3SHG B;  2QPA A;  2QBY A;  1KF6 B;  4X64 M;  4L4U A;  5FSW A;  4AZF A;  1HEZ E;  3KP0 E;  1J5E M;  2M5Z A;  4D82 A;  5LMN M;  3KS8 A;  1V1O A;  4US8 A;  2V4I B;  1L6U A;  1C4A A;  4WW0 A;  2WXL A;  5JI2 E;  4D8B A;  3AM9 A;  2WU2 B;  1QAO A;  1XEE A;  1IY0 A;  1NEK B;  3HUI A;  3CF0 A;  3SAR A;  1IXS B;  3SHF A;  3NS1 A;  3FUU A;  5C2T B;  1ACC A;  2VZK D;  2ZW1 A;  4GDK B;  4DR3 M;  4GH9 A;  3GRY A;  5IRE B;  3AE3 B;  2JU6 X;  3PFI A;  1SEB D;  2CFO A;  1NY6 A;  3A42 A;  3J81 S;  3UJN A;  1MX0 A;  3SEB A;  2WU5 B;  1V1P A;  4RGN A;  4G4O A;  3OQC A;  2IJ0 A;  1Z5B A;  1UUP A;  3NUH B;  2XZU A;  4IBG A;  2ZAO A;  1MVK A;  1KFY B;  3SBJ A;  4JI8 M;  4JI4 M;  1K52 A;  3AE7 B;  3VK8 A;  3GLG A;  3TUO A;  1TH4 A;  2X4A A;  2ZAM A;  4OX9 M;  1IN4 A;  4KX6 B;  1XC8 A;  3HVD A;  3ILK A;  1XMQ M;  4FCT A;  5IZ7 D;  2F5P A;  4FXC A;  1I4W A;  3A46 A;  1RFK A;  1Q3B A;  4JXJ A;  2XF3 A;  2INN E;  2BTW B;  3BBA A;  3TE6 A;  2V1C A;  1DGG A;  3U6S A;  1F2R C;  4B0E A;  5GXG B;  2WXN A;  4IP3 A;  3UGJ A;  4NRW A;  4I81 A;  4PD2 A;  2V0G A;  3HJS A;  2Z4R A;  2C5R A;  4W5W A;  1L2B A;  3TWL A;  5JXV A;  2AHM A;  2R46 A;  2PLP A;  4XBO A;  1FNU A;  4QNM A;  2PW9 A;  4UDU C;  1KSF X;  2J53 A;  1HR0 M;  1HNZ M;  3GPY A;  1ZOY B;  3KOX E;  3FUT A;  1IY1 A;  1FIQ A;  2DVW B;  3AH7 A;  1D5X C;  1CJE A;  1J09 A;  2Z3X A;  4GHA A;  5HFY A;  1KLU D;  2JA2 A;  1SXJ A;  4LF5 M;  3VRB B;  2ZM6 M;  2ZBK B;  2Y5C A;  2LHE A;  2JX5 A;  3HKP A;  1VRA B;  4L15 A;  4GMQ A;  4YSY B;  3R2I A;  1PVJ A;  1NNJ A;  1N5X A;  3RPF C;  3DWM A;  3W2D A;  4MT5 A;  4RGM A;  4PCZ A;  2N9L A;  4XDD A;  1ZDX A;  2Y20 A;  1FMA D;  4ZOH C;  3L26 A;  5KPZ A;  2YR0 A;  4RF0 A;  4CHT B;  2INP E;  4L2Y A;  1FFV A;  3GPP A;  3GLH B;  1N75 A;  3LVV A;  1YJJ A;  3PHX A;  1UKF A;  1FXA A;  4JV5 M;  2WXP A;  4YTN B;  1XLO A;  4BLC A;  3CIR B;  2UXB M;  4IBD A;  4P6V F;  2XH9 A;  2RGO A;  1JML A;  3AE2 B;  2Y0T A;  4N58 A;  5BMI A;  4RFB A;  1K50 A;  1MHX A;  3L29 A;  3PVS A;  1SJE D;  3PHU A;  1E32 A;  1DOX A;  4DUZ M;  3KWV A;  5H37 D;  2UUC M;  1J7A A;  3TQS A;  4RNA A;  4LRS A;  5ITU A;  3IAS 1;  3L4P A;  5C18 A;  1IBM M;  7CAT A;  3FUX A;  4JE3 B;  3SAW A;  4A9A A;  1TS3 A;  1S3S A;  2MH7 A;  4C80 A;  1PJI A;  4NOO B;  2NTT A;  5JI3 E;  4JPS A;  3L25 A;  1YE9 A;  3RGS A;  3WHK A;  1DO2 A;  3PNY A;  3HGI A;  3CF6 E;  3SFE B;  1ORY B;  2DWQ A;  2DZN B;  1FM0 D;  4MH0 E;  1D4B A;  5A2Q S;  4OHJ A;  3AJI B;  3SR6 A;  1TS5 A;  1Z6T A;  3GPU A;  2JSV X;  3W1S A;  3DWG C;  3NVY A;  1FNN A;  2ON8 A;  2XSZ A;  3Q8X A;  1L0X B;  1BXT A;  3R9X B;  3I57 A;  1ZXH A;  5ITR A;  3ZYY X;  3AEB B;  4BBA A;  2WXR A;  3Q8B A;  2L32 A;  3NWL A;  5KO3 A;  3SYL A;  3PRP A;  2CU3 A;  1PUT A;  2V1U A;  4OVZ A;  2CUZ A;  2BBC A;  1QIL A;  3PO0 A;  2VII A;  4A55 A;  2WXQ A;  1XF5 L;  1W5S A;  3PT2 A;  1QKZ A;  2IGH A;  4JI1 M;  3J27 B;  1VLB A;  4LFA M;  2AX5 A;  3LVW A;  4D2K A;  3QWL A;  4PT5 A;  5ITY A;  1PDX A;  4LGY A;  4NSR A;  4NXN M;  1NY5 A;  4GKJ M;  4LF4 M;  4RKX A;  4MM3 B;  2BS4 B;  2KRK A;  4HKQ A;  1I4R A;  2M0A A;  2OED A;  5D3D A;  4DXG A;  2HWK A;  1OFF A;  3RFW A;  1F2R I;  4O1N A;  2CE7 A;  3RNV A;  1PGX A;  3ABV B;  2WXJ A;  2VZK B;  1R7R A;  4ITQ A;  5KQ8 A;  2X8A A;  1QZM A;  3UK6 A;  2UXD M;  4IJE A;  1JRO A;  1J7K A;  1JWM D;  1RWS A;  3AV0 A;  2J4X A;  4FWG A;  4ARI A;  3T3O A;  2Y21 A;  2MEK A;  1X37 A;  1L5P A;  2GRI A;  4YY3 M;  1JW9 D;  2K5P A;  2DXI A;  2YEP F;  4YXD B;  3FTE A;  3AE4 B;  1IUE A;  4LJA A;  1IBK M;  2RDG A;  2EEL A;  4MGZ E;  2KW0 A;  3HU3 A;  2O5R A;  1TS4 A;  5FTN A;  1KH0 A;  1TH2 A;  5IWA M;  1DGF A;  1J7B A;  2H89 B;  1IM2 A;  1SSN A;  5HG2 A;  2N7J A;  3E4R A;  2I7N A;  2V3P A;  1JWB D;  2C9C A;  3ZH9 B;  3HVZ A;  2QCU A;  1PJJ A;  1MU5 A;  1QQR A;  3NBI A;  3Q8C A;  1DO0 A;  1Z5C A;  1DOY A;  3HU1 A;  3U61 B;  1C76 A;  4ZTB A;  2HKJ A;  4IJF A;  5KQD A;  2BTW A;  1D5M C;  4CIS A;  3SMP A;  5BYR A;  5BPV A;  2K22 A;  4OZA A;  4NRV A;  3D8L A;  3W0L B;  1ESF A;  4IBC A;  3U5Z A;  3ZC7 B;  3ZGZ A;  3U6L A;  3U7Z A;  1NYQ A;  4Q2J A;  4QHT A;  5TSS A;  4KGR A;  4XZX A;  4M9S A;  1CK1 A;  2WP9 B;  1K3X A;  1N62 A;  3HRD D;  5EXX A;  2AGA A;  3MTV A;  1SXT A;  3MJ5 A;  1GL7 A;  3BII D;  1LV7 A;  3AEE B;  4B7F A;  4KGS A;  3IT6 B;  2JXT A;  5BMH A;  1Z5A A;  1I4H A;  3IXS A;  5EXS A;  3AEF B;  2DWM A;  1R6B X;  2FBW B;  1P7E A;  1IN8 A;  1OJL A;  4HRO A;  3LQR A;  1E9S A;  5G5H A;  4BOS A;  4OZB A;  3B2G A;  4WIP A;  2RPV A;  5DYI A;  2KRU A;  4BB9 A;  2AQ3 B;  4JWS C;  1DGH B;  4ZRP A;  2HHH M;  4USA A;  1EM7 A;  3KP1 E;  1KFV A;  5I4D A;  2C9O A;  2SAK A;  4I5S A;  2ERC A;  5IT9 S;  4TQ0 A;  1STE A;  1E10 A;  4C7Z A;  3GLH A;  1WXQ A;  4B0M A;  5BMG A;  1OFI A;  2W55 A;  1PYW D;  1XHB A;  1FO4 A;  4JI2 M;  2L52 A;  3CWI A;  4ARC A;  3MFG A;  3T1Y M;  1D5Z C;  2G9H D;  4XWW A;  4M0D A;  1T5X D;  3N9Y C;  2LWX A;  4N6E B;  1N33 M;  2AQ1 B;  1L4D B;  3HHX A;  1GVN A;  1UWM A;  4AG5 A;  4MGK E;  1CQV A;  5HI1 A;  1A70 A;  3UI3 A;  4A8X C;  4M9X A;  3GRR A;  2X38 A;  1ET6 A;  1IN6 A;  1G4A E;  3TEW A;  1L1T A;  3SAT A;  3HWS A;  2XZF A;  3NVV A;  4REZ A;  2DYM A;  1N61 A;  4DV0 M;  3EIH A;  3O13 A;  1R7S A;  3U6O A;  4TUW A;  1FRR A;  2I38 A;  4R7G A;  2R65 A;  2QIE B;  2R4E A;  2XNA C;  1FJG M;  1GB4 A;  4BOU A;  1NHW C;  2KXE A;  3J7B A;  4OU7 A;  2P5T A;  3SAV A;  1EU4 A;  4A3V B;  3FD9 A;  1N32 M;  1E94 E;  3AEC B;  4QNR A;  4JX1 C;  3EGR A;  2WXO A;  3K2L A;  2R61 A;  1PGA A;  2GI9 A;  5D3I B;  2FUG 1;  1NNU C;  2K47 A;  4JI0 M;  2E3T A;  5FTL A;  2J52 A;  3U6Q A;  2LFI A;  1EE8 A;  2D5G A;  2XFT A;  2TSS A;  1AW7 A;  3TSS A;  3OWE B;  3NVW A;  1B1Z A;  2WDR B;  4NJC A;  4HKZ E;  3FYC A;  1XNR M;  2RDH A;  1G8P A;  3AOG A;  2AQ2 B;  2BU3 A;  3KXE C;  1TKG A;  4AQ7 A;  2QMT A;  3SFZ A;  1SE2 A;  3GS2 A;  3H8H A;  5E26 A;  1BML C;  3MK6 A;  3KOZ E;  1QT9 A;  3GQ4 A;  4IBK A;  4Z6Y A;  2BS2 B;  4B3S M;  5H92 C;  4LJ8 A;  5EP1 A;  4MAC A;  1RM6 C;  4IBB A;  3T1H M;  1HNX M;  2KDM A;  3T15 A;  2WXG A;  3B21 A;  3LYY A;  3B2F A;  1FFU A;  1CZP A;  2NQ8 C;  3AFH A;  3RGP A;  2N0S B;  3SFD B;  4FD2 A;  1WRI A;  5JZE A;  1XNQ M;  2VQF M;  3P1M A;  2I7P A;  4AG6 A;  3PXG A;  2Y3A A;  3J2P B;  4YWG G;  1VZ7 A;  2J7N A;  1L0Y B;  2ONQ A;  1QAN A;  4LJ4 A;  3W9C B;  3IAM 1;  2MJ3 A;  2ZAN A;  2KAC A;  1NVI D;  4B7H A;  2W54 A;  4YHH M;  2B76 B;  1VZ8 A;  3AE6 B;  3TPZ A;  2LXE A;  3PSE A;  4J3O D;  4DV6 M;  4OZC A;  4C56 C;  3BVZ A;  1XXG A;  2LJI A;  2BB6 A;  3B9J A;  2L6O A;  3THG A;  3GLF B;  5KPT A;  2HDE A;  3W0F A;  1K82 A;  2DBY A;  4IBF A;  2W3S A;  3V3X A;  3NZ3 A;  3FAH A;  3FTC A;  4X66 M;  3U60 B;  3VKG A;  3WCQ A;  3BZD B;  3I9V 1;  2J7Q C;  2JQR B;  2C99 A;  3T3N A;  3U61 A;  1JAL A;  1TYG B;  3E56 A;  2K3U A;  3A98 B;  1L4Z B;  1XO3 A;  2RGH A;  3GQ5 A;  2OHF A;  2FE8 A;  3IFU A;  1FNV A;  4LFC M;  5D7G A;  3KW6 A;  3GLG B;  1I4G A;  2WXF A;  4BOP A;  2QZ4 A;  3AL0 C;  1TDH A;  2SEB D;  4NZL B;  2W3R A;  1IGC A;  1ROE A;  2QEJ C;  2YFQ A;  3VDP A;  1N78 A;  2CV2 A;  1ZQ9 A;  1YN3 A;  1QOA A;  3Q8A A;  1NVM A;  1NJF A;  3JR5 A;  4LF6 M;  1L2C A;  4B3R M;  2JZP A;  2H88 B;  1SE3 A;  1UGJ A;  2E5L M;  3IT4 B;  3AE9 B;  5EJC A;  1K53 A;  3OTO M;  1TKY A;  3VFD A;  1UWX A;  1OQR A;  1C1K A;  1IQP A;  1XCT L;  1QVR A;  1DGH A;  1SBB B;  4KKI A;  4B08 A;  2E6X A;  2QSD A;  1D2N A;  1HNW M;  3I4V A;  3MHV C;  1XLQ A;  3AKZ A;  2MJE A;  3CF2 A;  5EE9 A;  1DGJ A;  2HTM E;  4GIP A;  5EXP A;  1GLN A;  3RE8 A;  4B3M M;  1D6E C;  4D81 A;  2BJV A;  1TZO A;  1K51 A;  4GRI A;  3TWM A;  3SAS A;  5BR8 M;  2WS3 B;  1I4P A;  4JI7 M;  1XMO M;  1JR3 A;  5E6J A;  4DQO C;  1YNT E;  1F77 A;  1QAM A;  4QOS A;  2M56 B;  4S12 A;  3GRU A;  1DGB A;  1L6V A;  4WAF A;  3M7G A;  5BYQ A;  3KWL A;  3LB8 C;  1YZB A;  1IY2 A;  2G8L A;  4FCV A;  3M6A A;  2Q2E B;  1WSP A;  4JI3 M;  3KSX A;  1IGD A;  2Z8L A;  5DNY A;  2PMV A;  3GP7 A;  4B3T M;  1HZ5 A;  1W5T A;  2R62 A;  2CJN A;  2DWL A;  3GPX A;  4M0W A;  3U6D A;  4RGO S;  4OW0 A;  1E0Z A;  4FW9 A;  2J7Q A;  2NMQ A;  5AUI A;  2FFJ A;  4LLG M;  2JWU A;  2J42 A;  2ACZ B;  2ICI A;  1QAQ A;  2IDY A;  3BOS A;  4LFB M;  3VK7 A;  2RKO A;  1MI0 A;  2DZO B;  3MP2 A;  2V6Z M;  3VQI A;  1SE4 A;  2K9X A;  2X49 A;  4L16 A;  3CTW B;  3LQQ A;  1TGU A;  4MB7 A;  3EA6 A;  3U6E A;  1JWA D;  1JWS D;  3E9S A;  1YN5 A;  4D8I A;  1P7F A;  4XDC A;  2H1R A;  2GB1 A;  1NI3 A;  4R3D A;  4NXM M;  4KKJ A;  1IN7 A;  4GC5 A;  1Z59 A;  1G41 A;  4GDL B;  1TKE A;  5F3W A;  1YUB A;  1C9F A;  3KQ4 A;  4RGT A;  1GB1 A;  3IG5 A;  4JWU C;  2EO2 A;  3BB7 A;  4DR6 M;  3H4M A;  4LF8 M;  3R8B A;  1TJE A;  3BK2 A;  3P4S B;  5FTJ A;  1L8Q A;  3VRA B;  1SJH D;  2KZU A;  3FTD A;  2XN9 C;  4FWD A;  2YNM D;  2KQ4 X;  1XLP A;  1JCK B;  1N77 A;  3FTF A;  4WQM A;  4YTM B;  2BS3 B;  4D8E A;  1L0V B;  4FWH A;  2DWZ B;  1GAQ B;  5EE0 A;  1QOF A;  5DYG A;  1HQY E;  3EIE A;  4YSX B;  2L7H A;  1HQR D;  1WGK A;  4LZJ A;  2J7O A;  1GPX A;  1HZ6 A;  2QJL A;  4AI6 A;  4IDI A;  1QF6 A;  4IIW A;  2BTE A;  1I7H A;  4X62 M;  1DYQ A;  4L8R C;  4K0K M;  1YQ4 B;  1QOB A;  2WDV B;  1PGB A;  3BWU D;  2QEN A;  4EE2 A;  1HXY D;  1ET9 A;  1KTK A;  4EIW A;  4A90 A;  5EE1 A;  2KMM A;  1SXJ D;  2L7I A;  4IBI A;  1FD6 A;  1E6E B;  1IBX B;  1J7C A;  2PTL A;  4I4L A;  4G4Q A;  3TRK A;  5EP4 A;  4IKG A;  5AUK A;  3AB5 A;  1N34 M;  4FVM A;  1MHH E;  2CHV A;  4KHP M;  4MH8 A;  5EXT A;  3L27 A;  4HLQ A;  4NL4 H;  1C77 A;  2OQ4 A;  4NSO B;  4DV7 M;  4AKG A;  1V97 A;  4G6Z A;  1K3W A;  3AMZ A;  2L1A A;  3HJQ A;  3KOY E;  3T38 A;  2WXH A;  4QHS A;  4G4R A;  3P4Q B;  5FKA C;  3AE5 B;  3P63 A;  3TEX A;  1GKI A;  4PDI A;  4I8O A;  3FIL B;  5EP3 A;  5FK9 C;  4DR1 M;  3UMM A;  4M9Z A;  4WUR A;  3GLF A;  8CAT A;  2UXC M;  3BVM A;  4X65 M;  3DA1 A;  3K1J A;  1KRH A;  4B7G A;  3HJ8 A;  4II7 A;  4L1B A;  2LEK A;  3URY A;  3TWK A;  1IN5 A;  1L1Z A;  1EWY C;  1Q3C A;  2Z84 A;  2EKI A;  2W82 A;  4LCB A;  3U60 A;  1ZP0 B;  1ENF A;  4KGT A;  4DXF A;  2CV1 A;  3A45 A;  1JWU D;  2LGI A;  3U6C A;  3P4R B;  1OFH A;  3HHW A;  1VDD A;  3PZ8 A;  1AYF A;  1FRD A;  3KVW A;  3R8F A;  1T6B X;  1VZ6 A;  5EZQ A;  2UUA M;  2WXM A;  3AED B;  2MJD A;  1OQQ A;  1KYI A;  4QOZ C;  2KAJ A;  2KWD A;  1LO5 D;  1E9R A;  4DR5 M;  3JR4 A;  2PVG C;  1YN4 A;  1IXR C;  1E7P B;  2F5Q A;  4LRT A;  1AWD A;  2K0P A;  5EQT A;  1HT2 E;  1XXH B;  4DV5 M;  3BVG A;  1I94 M;  3GLI B;  3U5Z B;  2L09 A;  1PM5 A;  2JYE A;  2BT6 A;  2Z7J A;  4LJ6 A;  3JAM S;  1ZPS A;  4P16 A;  1HQC A;  1WYG A;  3FC4 A;  3FUV A;  1KLG D;  1YMH E;  1MPE A;  2ZW0 A;  1AN8 A;  4IOI E;  4ZYS A;  3C0R A;  5EE3 A;  2CHG A;  3K92 A;  1JQJ C;  3VR8 B;  1ZDV A;  3U4E G;  1IXZ A;  3DOA A;  3KOW E;  2XSZ D;  3HHY A;  4A5U A;  1UNS A;  1QQW A;  3SYK A;  4HL4 A;  1L2D A;  4LJ7 A;  1YJI A;  3ZQ4 A;  1Q10 A;  2CJO A;  5ITX A;  1DKI A;  4KO8 A;  4JYA M;  1T3Q A;  2R4J A;  3Q8F A;  3VDU A;  1NEN B;  3GRV A;  4NAW B;  4NAM A;  3TMP A;  3FKE A;  2A5Y B;  4L78 A;  4ZHO A;  2DHR A;  2Z4S A;  2Y0Q A;  2QBY B;  4Z8X A;  3SAU A;  4RCO A;  4JI6 M;  1F0Z A;  3AV8 A;  3WHL A;  2PKO A;  3GP1 A;  3ZJU A;  1I4Q A;  3IG8 A;  4HRS A;  5ITT A;  2BB5 A;  4XWT A;  1EWC A;  1Y56 A;  1UM8 A;  3NRZ A;  2BNK A;  1GL6 A;  2XEP A;  2D7H A;  4MGY E;  1YSY A;  2PVO D;  2I2Y A;  2G5G X;  3LMM A;  4GHL A;  5GKN A;  1N60 A;  4DUY M;  2LMC A;  3AE8 B;  3ZNH A;  4DV1 M;  2JYT A;  5H8Y E;  1JR3 D;  3K8Z A;  2M60 A;  4TQ1 A;  3BY4 A;  1G3I A;  2KEB A;  5FLX S;  1VJK A;  2DWN A;  3BYY B;  3MHZ A;  1V1P B;  2YEP B;  3DFZ A;  3VLF B;  1Q39 A;  4MGI E;  3BK1 A;  4LTU A;  3U6P A;  4LGM A;  3AOE C;  2F5O A;  4RF1 A;  4LG2 A;  1XLN A;  2XFS A;  3ETR A;  2LNH C;  4DR4 M;  3MC0 B;  3FYD A;  3L2A A;  4LY6 A;  2KN4 A;  5EP2 A;  2IPK D;  3I4Y A;  2QP9 X;  2BJW A;  4XGI A;  3PZ7 A;  4WWM A;  3HU2 A;  2BYT A;  1YQ3 B;  5HHD G;  2R18 A;  1C78 A;  4AS1 A;  1QOG A;  2UZJ A;  1E9M A;  3MP9 A;  2EUC A;  3TEZ A;  1JQ4 A;  1DOI A;  1FNW A;  2OPF A;  5LMU M;  2IGD A;  4IBJ A;  1FEH A;  4HXD B;  2CV0 A;  4DV3 M;  4PDG A;  2DOS A;  4GIT A;  2D7G A;  4LJ5 A;  5FTM A;  5KPR A;  1JRP A;  3AN1 A;  1SXJ E;  3C8Y A;  3QAU A;  4C7Y A;  2JTC A;  4AQY M;  1R2Y A;  1ZAE A;  4CQN A;  4DV2 M;  5ITX E;  2N9K A;  3Q69 A;  3UZU A;  1NJG A;  1G59 A;  1TY2 A;  4GUA A;  4LZZ A;  4MGH A;  1M4V A;  3LXF A;  2CEA A;  1N5W A;  1SXJ B;  1PFD A;  4GC9 A;  4AW4 A;  3HHZ A;  4DR2 M;  4WH4 A;  1C4C A;  3EUB 2;  2BW2 A;  4LJ9 A;  1TH3 A;  3V05 A;  2FNA A;  3U2S C;  3SMS A;  2WDQ B;  4GLS C;  4LF9 M;  2KA6 B;  2LHD A;  1IBX A;  1C79 A;  4GKK M;  2WQY B;  2V3N A;  2HCB A;  1V8C A;  2VQE M;  1HT1 E;  3KFU G;  1SB3 C;  3FUW A;  2UU9 M;  1FXI A;  1NSF A;  3SC3 A;  2Y5P A;  4L23 A;  1HA5 A;  2CHQ A;  3DZD A;  2YQZ A;  3U6M A;  2XGN A;  4YSZ B;  3FIL A;  3U52 E;  5FR3 A;  1EU3 A;  1NYR A;  4IUM A;  4BOZ A;  3L28 A;  4FCW A;  3ZCB B;  4CGY B;  4D80 A;  3C58 A;  1IBL M;  3ZJV A;  4KLN A;  3I51 A;  1WWT A;  2PIA A;  4DR7 M;  4XE0 A;  1XCQ L;  2LUM A;  4ZRQ A;  4BOQ A;  1TY0 A;  1VDV A;  3KS4 A;  3KSJ A;  1SIJ A;  1SF0 A;  4HJG E;  3AOE A;  2R45 A;  4AKH A;  2RMM A;  4KOD A;  1RYJ A;  2XLJ A;  1N63 A;  2UUB M;  5FTK A;  2L83 A;  1XWI A;  4HEA 1;  3AE1 B;  4H2A A;  1ZE3 D;  3TEY A;  2NTS A;  2D7E A;  4A6Q A;  3NVZ A;  4MI7 A;  4LK0 M;  2HL7 A;  2F5N A;  2G1E A;  1T3T A;  1TS2 A;  2M19 A;  4US9 A;  2DLB A;  2EA0 A;  5MPO A;  4G4N A;  1R2Z A;  5EZS A;  1VR9 A;  1I4X A;  3J9C A;  1QLB B;  5BYS A;  3W5U B;  4LF7 M;  2KZS A;  4TSS A;  1XXH A;  4ITK A;  2DYO A;  3RFZ B;  3J7A S;  3GLI A;  5ITQ A;  2WNM A;  2Q5W D;  4JN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...