4R3DA

Crystal structure of mers coronavirus papain like protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
324
structure length
319
Chain Sequence
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Middle East Respiratory Syndrome Coronavirus Papain-like Protease and Its Complex with an Inhibitor
rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
molecule keywords Non-structural protein 3
total genus 82
structure length 319
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08715 Viral_protease Papain like viral protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4r3dA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4r3dA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4r3dA03
4RF0A 3MJ5A 3E9SA 4RF1A 4REZA 4PT5A 4OVZB 4OVZA 4P16A 5E6JA 4M0WA 5KO3A 3MP2A 4MM3B 4R3DA 4RNAA 4OW0A 4WURA 2FE8A
chains in the Genus database with same CATH superfamily
2Y0QA 4XDCA 3RNEC 4HK2A 1V92A 1BY8A 2UWQA 3K8ZA 3DPDA 1G71A 1GLNA 1JR3A 1YN5A 4KKIA 4B0EA 2VIIA 3QX1A 3PHWB 4KODA 2F5SA 2IO1B 4M0WA 2FQ9A 1VZ7A 3KX1A 1NB5A 2C9WB 3H4JA 3MTNB 5E6NA 3JSVA 5CHTA 2MBHA 2IGGA 1J0GA 1HQCA 1VQ1A 2Z8YM 1D3ZA 2R9OA 3KS8A 4WWMA 3O13A 3ZC7B 1X1MA 2FUDA 1EWPA 1UKFA 2DNFA 3FTDA 1E8XA 1C9FA 2KWUB 3D6SA 2V6ZM 1FXAA 1KF6B 1UNSA 2IZVB 3HM6X 3KP1E 3ZIMA 4ANRA 4L23A 5EXSA 2NTTA 2ZCCA 1QZEA 4P6GA 1ICFA 3V3XA 1ZXIA 2J7NA 1OTRA 4IJEA 4M9XA 1P7EA 5H8YE 4FWGA 1PGBA 2JYEA 1GAQB 1SIJA 5DPWA 3TRKA 1EO6A 4NXNM 1ZMVA 2KZUA 5HG2A 2NS5A 2PKOA 1WJUA 2IJ0A 1PCIA 2KRUA 1OAIA 3ZVVA 6PADA 2Z3XA 1I4PA 2GBJA 2ZEQA 4B3TM 3KS4A 4DV4M 1JWMD 5EE3A 3ZNGC 2G4DB 1DGHB 3IAM1 2KFKA 2M0XA 4HXDA 4LNFA 5DCNA 3AEAB 1S1QB 2HL7A 1RU3A 4BBNC 4HKZE 1CUKA 2JNHA 1FXTB 4I6LB 2DZNB 3SMSA 4DQOC 2KDLA 2L4FA 2LJ5A 1WFYA 2VH2A 2GFOA 4KDLB 1QVRA 2ZW0A 4FHJA 1Y4HA 3W67A 3TQSA 4YTMB 3I57A 4K7SA 4QRGA 1TTNA 2M4NA 4YL8A 2CE7A 1KFYB 3PS6A 1AARA 1LO5D 2BF8B 2TSSA 5IWAM 4B08A 2JY8A 5EE9A 2INCC 2UYZB 4JWUC 4WH4A 1ZIVA 2XU5A 4LRSA 1N63A 1WX7A 4I6PA 4DUYM 4HROA 4BS5A 1WF9A 1J8CA 2VQFM 1MPEA 4K3CA 2N1VA 2BTEA 2A5YB 2R65A 2L05A 4W9JA 2AWTA 2D3AA 2KJ6A 2CHQA 3IXSA 5FLXS 4DHZB 3RUIB 2D3GA 4C80A 1IFYA 2BS4B 3R9XB 3PZDA 3PRPB 4NOOB 5EP4A 4ZTBA 1D0KA 3PPAA 1U4AA 4F2LA 4NRVA 4NJCA 3QWLA 2Y0TA 3PT2A 2L8JA 1YMHE 2WXFA 3KUZA 3CMMB 2NQDB 5ITYA 4LG2A 1OQQA 3SFZA 3VQIA 2ZTDA 3ETRA 3B7NA 1I4GA 4LZJA 4M0WB 2X8AA 4QNRA 4RKUF 1M6DA 3SFDB 2LD9A 1WR1B 2AU1A 4FWHA 1P3QU 1FMAD 4CJ6A 4M8MA 2QBYB 2JZ1A 2BYFA 4PS8A 2JY5A 4LGMA 1YT7A 5LNK1 1U9QX 3RNFC 2ZW1A 3QIJA 2BJWA 1XEEA 3BBZA 2JUOA 1IUEA 1SXJE 4BQVA 2BNKA 2ZAOA 1N78A 2KWVB 4NJ6A 4AP4C 1WJ7A 5FSWA 2LJIA 1UFZA 1GOZA 4B7HA 3FILB 3RULA 3GCBA 5D7GA 3MTVA 1UH6A 4KIKA 1GECE 3DVGY 2HWKA 2SAKA 4ARIA 1N5XA 2ACZB 4OZAA 1Q5WB 1TF0B 1VZ8A 3HGIA 3APFA 4TSSA 4HPPA 2Y6EA 4W5CA 3GRYA 1G8PA 4KO8A 3SEBA 2ATOA 2Z4RA 4DK5A 1K3BB 4NSRA 1HNXM 4AUQC 3Q3MC 4N6EB 4BOPA 1IN8A 2LVNC 1W5TA 3L08A 3B74A 3SC3A 4FCVA 3E46A 1SEBD 1V9JA 3GS2A 5J17A 4CIZA 3DBSA 1Q10A 3PZ7A 4KHPM 1QAMA 1MVKA 2BQQA 3V60A 4RF0A 3E21A 5BMHA 3KH0A 1QQRA 1ZDXA 1ZXHA 3T9LA 1UBQA 2J0KA 1L6UA 4M8NA 3PBHA 3NG0A 2MRPA 4G0NB 5F3WA 5GXGB 1WIVA 2APLA 1I4XA 4YT0B 4TQ1A 4DDID 4DV0M 2DKLA 2K22A 4GXBA 4RGTA 2KACA 3RNBC 4DXAB 1Z2MA 4WQMA 2KNAA 3Q3NC 1WE7A 4YVAA 2D3CA 2BTWA 2HDEA 1TS2A 3Q2AC 1ATKA 4B3SM 2GBMA 3QJZA 3KYDD 1XMOM 2WXHA 3OG5A 1C3TA 2ACTA 3AEBB 3PLVA 3TEXA 1AYWA 2J5YA 3HJSA 3OAWA 2WGSA 1WGHA 3QQ8B 4JYAM 1L6VA 1DEUA 3QJ3A 2INNE 1WMHB 4ICVA 3MJ5A 1J5EM 2L0FA 2L7RA 2J7QB 3AE1B 1F2CA 4DV7M 4ITKA 1VD2A 4BOZB 2G8EA 1YE9A 3RI7C 4LJPB 1WYGA 2IGDA 4CHTB 1GJZA 2DC6A 3Q3FA 3GLIE 3JSVB 4G4NA 2RPVA 5KQ8A 2HTHA 1RYJA 2H88B 2MLBA 2UUCM 1WGDA 5CHWA 3RNCC 2MCNB 1CJLA 1GL7A 3X0WA 1Q6KA 2AVWA 1FRDA 1OQRA 4II7A 4LRTA 4FWDA 2P0RA 4X6IA 3M6AA 1DYQA 4L8RC 1QZMA 2PNSA 4GU2A 3O65B 2L2DA 5KPRA 3O0UA 4LJ4A 3TWKA 3GLGE 1N61A 2K0PA 4DMXA 1GG3A 1V5TA 3D8BA 3R66C 2KJRA 5GKNA 3GRRA 1NHWC 4EIWA 2J52A 3NY5A 4DXGA 4LFBM 4I5SA 1WZ3A 3TEZA 2F7DA 2G8JA 3BPMA 1HZ6A 1ZP0B 1THEA 3QT4A 2ZM6M 1E10A 3K9MA 1EU4A 3LXFA 2FCSA 4F1IA 4IP3A 4ANWA 2YFQA 2DWNA 4BKSD 2KO3A 1I42A 1F2RC 5HFYA 3QCAA 1F2RI 2IPKD 2CHXA 4M01A 5CHVC 1WYWB 3W1SC 1MG4A 4DHJD 2F4VM 2A5UA 4B6WA 3ZLZA 5EQTA 5JZEA 2LZ6A 3UINB 5KO3A 3TMPA 4L2YA 1EE8A 4ZOHC 1SG9A 4II3B 3VAWA 3TEYA 2WP9B 2WXOA 1A6RA 5FTNA 1SGHA 4AI6A 3AB5A 3AFHA 3PFIA 2OP3A 4P6EA 3F92A 3B2FA 1ZMUA 1Z5BA 1YD8U 2LGSA 1SNKA 3NJTA 4YXDB 1V8CA 5BYSA 1XXGA 4IG7B 3CH3X 5EXPA 3T1YM 2R18A 1R4NI 3RGPA 3K8UA 1WY8A 1SF0A 2HD5B 1E8YA 1DGFA 1GC7A 3BBAA 2Y20A 1C1YB 3I06A 4YSZB 4Z8XA 4AW4A 3CTWB 3K1JA 2XZUA 4XE0A 1R7SA 1XLQA 4K1RB 2X4AA 1T6BX 4PYZA 5C2TB 3AEGB 2D2QA 3I04M 4IUMA 2K5PA 4KVGB 4PT5A 2DZZA 3FAHA 1F77A 2BKRB 4B7FA 3Q14C 1OFHA 1QANA 1LM8B 4LF9M 5BMGA 4AWJA 1C4AA 3KSEA 4EEWA 2FO5A 1ACCA 4D8EA 2A4ZA 4R3DA 3IG8A 4LNKA 4G6ZA 3FTFA 3PNVA 2C5LC 1K50A 1MU5A 4P16A 1NQCA 5FK9C 3GPXA 3X23A 3TBLD 2AYOA 1D0LA 3U30A 3RCZA 4XWWA 3W0LB 4RCOA 5TSSA 1NL6A 1F2AA 4X57B 2WHIA 1V1PA 3E9SA 4RF1A 3AL0C 1T0QC 2ZPNA 3OJ4B 1D0MA 1XF5L 1Q02A 2VF8A 1HZ5A 2LHGA 2JQFR 3GLHB 2WDVB 2KDEB 3WA0A 3L17A 2B3AA 4XDDA 4OVZB 5IP4D 3V76A 4LJ9A 3GP7A 2KZSA 1EUVB 3NRZA 4IM0A 2MWSB 5C3JB 1N77A 1AU0A 2D07B 4NRWA 2FCMA 2QBYA 4ZYNA 5IZ7D 3ZTDA 3S3QA 3U6DA 3HHIA 3KWBX 1FFUA 2HWJA 4WWNA 2KTRA 1M4VA 1VDDA 3U52E 1YNTE 2GI9A 2R61A 1J09A 4IBFA 1XLNA 2KFJA 4RGOS 1Z59A 2MJDA 2ONQA 2PLPA 3KQ4A 2L6OA 4RM9A 1HQRD 3IEJA 3SU8X 2G1EA 2EJSA 1KXRA 2ZTCA 2DYMA 1I4HA 2GB1A 4JXJA 2BT6A 4X62M 2L09A 1QUSA 2K25A 4IIWA 4XGIA 2FOIC 2MEKA 1A5RA 3SDLC 2UXBM 4M9ZA 2OQ4A 3GLFB 2IGHA 2CS4A 1SIFA 4BKTA 2DX5B 3AE4B 4US9A 1EF7A 3I51A 4QH6A 1T0SC 1QOAA 4JI0M 3ZYYX 2DLBA 3M95A 3DOWA 4YYVA 3IG5A 3TWMA 3KOXE 1EF5A 1J7BA 3BY4B 2JZ0A 3L10B 3APDA 4FCTA 4JI5M 1YOVB 4ANXA 1N5WA 1JR3D 4WA6A 3BOWA 2ZBKB 1NYRA 2KC2A 5ITQA 4JI2M 3AE7B 3DA1A 1KYIA 3ZXRA 3P5UA 4HJKA 5BR8M 4LLGM 1QF6A 4LCBA 2CU1A 2ASQA 4PDGA 1V34A 4JL9A 4CDDB 5A24A 2N7JA 2DAIA 1EWLA 1QQWA 4MZOA 3RNAC 3CBKA 1IBKM 4LNNA 2EKKA 1V1PB 3DBRB 1OIZA 4GOCA 4P1BC 4LJ8A 2J7OA 4Q7JA 1C76A 1PJIA 4DDGD 3U6MA 1C1KA 5C1BA 4WWPA 1OKSA 2Y5PA 2JY6A 4JQWC 3K9OA 2RSUA 2DZJA 1MN3A 1C79A 2QHOA 1Q1OA 1VZ6A 2BU3A 4XBOA 3HK0A 4GMQA 2IY0B 3M63B 2DYOA 1QDTA 5D3DA 1JQPA 4DV1M 2INPE 3WHLA 4MGIE 4N58A 4HVBA 2CHWA 3FD9A 4HL4A 2QIEB 4A3PA 3R7QA 3UGBB 2MROB 3MHSD 4W5WA 2ZAMA 1OQYA 1C7YA 1R7RA 5CVOB 1UGMA 1XD3B 1RLFA 3PHUA 3VLFB 3W68A 4KX6B 1E7PB 3KOZE 3LQQA 1JCKB 1P7FA 1SBBB 2NBUA 2NR2A 4W9HA 2PW9A 2JXXA 3H7PA 3E4RA 3BXWA 3Q3OC 1ZQ9A 3BVZA 4DR5M 4PD2A 1ZPSA 1YQ3B 1TY0A 4KDIC 2DWQA 3NZ3A 5LXHA 2JWUA 2E3TA 2ON8A 3ZO5B 3U61A 3BVGA 2IDYA 5JXVA 1WXQA 2KYWA 2JYTA 2BWBA 3ZJVA 3V6CA 2P5TA 2JZ3B 3ML9A 2NQ8C 3T3OA 4EKUA 1SSNA 1R5LA 4M02A 1SXJA 2GBNA 4KSLC 2X49A 3SMPA 1FEHA 1JMLA 4AG5A 3B89A 1CK1A 3N3KB 2XSZD 1KH0A 1LQBA 4I81A 3A4SC 5G5HA 5IAAC 4XZXA 2DOSA 4G4OA 2RMMA 3PRZA 3F5VA 3KFUG 3T6PA 3U6LA 3A42A 2MBBB 4W9KA 5FTJA 2DHZA 1PRBA 1F0ZA 3UJNA 3L28A 4ZHOA 3U6CA 5JA7A 3P5XA 2VRRB 1OJLA 1ET9A 1L0YB 2RGFA 5C23A 2V1UA 4BOZA 3HZJA 1T5XD 1PQSA 5KHOA 5ITXA 4II2B 4ANVA 1RWSA 4GITA 3VDPA 3AE5B 3U2SC 1AU3A 2K6BA 2FH0A 4JN6A 2R45A 3LXSA 4RKXA 3GLFA 2KVRA 2DC8A 1YSYA 1FD6A 2JSVX 1WGLA 1B9RA 2BB6A 1VRAB 5G5GA 3HWSA 4OZCA 1JRUA 3BWKA 2XK5B 2R9CA 3PRMA 1JWSD 2V3SA 3FUTA 1CTEA 1E9RA 3KSXA 4M0DA 2BWFA 4DHZE 4CO7A 4LFAM 1TR8A 2M0AA 3GRVA 4FCWA 5F02A 3A1QB 4GLSC 4C56C 1YLAA 3P4PB 1U9XA 2CHVA 2DJGB 3PLUA 4JIOU 1HTOA 2KNZA 2FT2A 4GHAA 3RGSA 2Y3AA 3MFGA 2HHNA 4BVUC 2PE9A 3P2BA 2K9XA 1AIMA 3IT4B 4XWTA 1X9YA 2BVCA 4X6HA 3SHGB 4WQOB 3K2LA 1JRPA 5EP2A 2AYOB 2HH5A 3IFWB 1NSFA 4GC5A 4L4UA 2PMVA 4L78A 4PP2E 2WXPA 2KANA 4PK1A 1Q0WB 1E32A 1DOXA 4NC6A 1Q3BA 1ZUD2 1DV0A 1OTRB 1GJTA 3VR8B 3F75A 2F1GA 1VCBA 2LNHC 1GVNA 2VF7A 1R6BX 3TWLA 1XMQM 1CQDA 3EIEA 2R9MA 1D2NA 1WX8A 2DYBA 2NMQA 3SARA 4ANUA 1WWTA 4UN2B 1Y8GA 1J7AA 2K39A 1MJDA 2JU6X 3GPUA 1YN4A 3H1UA 4JI3M 1ZOYB 5HI1A 2WXMA 4GIVA 3HJ8A 3A98B 4ZHPA 3KSJA 3U8EA 2JPHA 2QZ4A 4ITQA 3L29A 2J0MA 4HJGE 4L15A 3DOAA 2UUAM 2QEJC 3ZKJC 3R8BA 3LVVA 3NVWA 3A33B 4A9AA 4GHLA 4K0KM 3H6NA 1WGNA 4P1CC 2RD0A 4RM8A 2CV0A 2F5QA 4WW0A 3I4YA 1C4PA 3U4EG 4FLHA 3MP2A 4LF6M 3AULA 1ZMWA 4MM3B 1OEYA 2ERCA 4AJYB 4ZDVA 1V49A 4FJYA 4QRXA 1FNVA 2V0GA 1KSFX 5CVMA 3IG3A 1Y56A 2V1CA 5EXXA 1QYRA 2KLCA 3J2PB 4FK5A 4AXLA 4BOQA 1T3TA 3UGJA 3M62B 3VHTC 3GOEA 2CRUA 2O01F 1G3IA 2FRQA 1XXHE 3P4SB 3FUWA 2JTCA 2C60A 3DVNU 1UF0A 2W9NA 2CEAA 2ZCBA 1IY1A 1CMXB 1EF1A 2MW5A 3T15A 1IBLM 4YYSA 2XLJA 1ITOA 1NNUC 4MEMA 3KWLA 5KQDA 3P4QB 3PT2B 5HHDG 4HEOA 1WR1A 4FJVB 2WDTB 1P3QQ 4L6V6 2ZJDA 3ALBA 2FRAA 1QOGA 2WDQB 1EWYC 4KZ0A 3LVWA 2DZMA 2R46A 3TMPB 3DBLB 3K9PB 2LUEA 3WXEA 2VDBB 4IC7B 1FO4A 5H37D 2DAKA 2JY7A 4C7YA 1E8ZA 3HHXA 3L4PA 3PREA 2JF5A 1O0EA 1V5OA 2Z0DB 5LLIA 3FKEA 4FIPA 1DGBA 4BOUA 4WJNA 3RT3B 1XO3A 2BDZA 3L16A 4N59A 1FM0D 3PO0A 3OWEB 1AWDA 1NHGC 4LNOA 2CIOA 2CV2A 1RAXA 3W31A 2JWZA 5L8RF 4MGYE 4NAWA 1T43A 2PREA 4AXMA 1MDWA 2JXNA 4ZRPA 1TKGA 2WZJA 5DFLA 2W3SA 2UXCM 4B7GA 3DFZA 3EUB2 1QOLA 2RDBC 2L76A 4LNIA 1WMHA 3WALA 2W54A 1XLPA 3WAMA 3RPFC 2KXJA 1WGKA 4FA6A 1GLOA 1SXTA 2FTDA 3CF2A 4B3RM 1WGYA 4JWSC 2DJFB 2E00A 2N0SB 4LZZA 3H7DA 4RFBA 4NY0A 3NS1A 2Z7JA 1POPA 4NSOB 2LH0A 4BZAA 4KLNA 3VTUA 3R2TA 2V4IB 3ZNHB 2DI0A 1UZXB 5K16A 3DBLI 4B3MM 1L2BA 1TH4A 2NBVB 3FKYA 3NZSA 3AV8A 1IN5A 2PADA 2K9DA 1PXVA 3MTNA 3PV1A 4HDOA 1WRIA 3TUOA 3IAS1 3C19A 4R7GA 2CV1A 4LF5M 1D5MC 3AOEA 3HHZA 4Q2JA 1GC6A 3B2GA 2L0TA 3PHWA 2LEKA 2MA9B 2OULA 3VUXA 2NQAA 4IKGA 4S17A 4DV3M 1AW7A 1L0VB 3J7AS 1OFIA 2KA6B 2XSZA 2H1RA 2BYEA 3GLIA 1C4CA 5JH5C 2EA0A 1MFWA 4K81A 3KOYE 1P1AA 4LGYA 1E7UA 4TV3A 1YQ4B 1YK7A 1MIRA 4KGRA 2GLSA 4JE3B 2JWSA 4LJAA 5KHQA 1ORYB 2JVCA 1AYFA 2LVQA 3BPFA 3CIRB 1PDXA 2JX5A 2REXA 2MJEA 2YJ8A 2BW2A 3LYYA 1SJHD 3DCGA 1TBEA 2F5OA 1WGRA 3C3DA 1L1ZA 1IPGA 2DENB 3FILA 4P17A 3VTVA 3FUXA 3AM9A 4LF7M 3VH4B 1VSNA 4HCNB 1ZAEA 4BKSA 1S4VA 2IBIB 2HJ1A 3HM3A 4S0RA 2G5GX 4MGZE 1FIQA 3K24A 1E7VA 1XWIA 2AL3A 2CWBA 1TH3A 1LGRA 2H5XA 4DUZM 2QP9X 2EMSA 4BFRA 3B79A 1VDVA 2I38A 1WJ4A 4N4ZA 3JVZX 5FTLA 2XH9A 1IQPA 4GDLB 4TMAB 3SHFA 2V3PA 4A3OA 2XN9C 3HX3A 5BYRA 3WCQA 4N9F4 3UF8A 4ZRJA 1S3SA 3OISA 1NEKB 2WQYB 1L7YA 4B95A 5J94A 3K9PA 3PVLA 3NZUA 2P86A 2XZFA 4RY2A 3CSFA 2GNOA 2NVUI 1TT5B 5EJCA 4A8XC 1BP4A 2XEWA 2ZNVC 2V3NA 3DDCB 2IBIA 1IXSA 3VVWB 3TEWA 5E6OA 4KT0F 1IGCA 3EA6A 2HCBA 3D32A 4GKKM 1FJGM 2F5NA 1D6EC 4ICUA 4QHTA 2C0YA 4MACA 2PEAA 2YVCA 4REZA 1UM8A 3GLGA 1PJJA 1N60A 2MBOA 3PZ8A 2KDMA 2D7GA 3V62A 4C4VB 3W5VB 4A55A 4LTUA 3I01M 3JR4A 3ZDTA 3OQCA 2MHJA 3MC9A 2LVQD 1AUAA 4MI7A 2FIFA 3HJQA 2L52A 3B7QA 3GLIB 2PE6B 4FHKA 4ZPXA 5FR6A 3AV0A 3A9JB 4EZLA 5MPOA 5ITUA 2R4EA 1MG8A 4D2KA 4M9SA 2BWES 1CQVA 4JI1M 2YJ9A 2EKIA 3AI8A 4W5BA 2XFSA 1V1OA 2WX1A 3TCAA 5J2RA 3SYKA 2BPSA 1BXTA 4W9CA 4XK8F 1QLBB 2R9FA 3ZGZA 1VEKA 2R44A 2LGYA 2HXZA 4IBGA 1PVJA 2GOWA 2D7HA 2KVZA 3L2AA 4FBJB 2L00B 1F4IA 3ML8A 5IOIA 2H7JA 2R6FA 3HKPA 2RGHA 3PVSA 1N75A 4URKA 1HT1E 1TTEA 2J7QC 2DENA 2BDLA 3HU3A 1TU6A 3I5JC 3KUCB 1A5TA 1WXVA 1TL9A 3P5WA 3CF6E 2R2OA 1NJFA 1V86A 2I1JA 3W2DA 2Y5BB 1GJSA 3A9JA 1NI3A 2L7IA 4YYWA 2O2VB 1F29A 1V33A 3V6EA 3RFWA 2WXLA 4I4LA 2JY6B 3AE2B 2UUBM 2NPTB 3P63A 2RR9A 3R7RA 2LVOA 3HHWA 3A1QA 3BCNA 2MSED 2X8XX 3GO8A 3LDZE 4J6IA 1UBIA 5BO4B 1ZCMA 3OVXA 2QSFX 2PVOD 3TIXA 3MHZA 4H2AA 3TL5A 1TGUA 2JZZA 3A4RA 1CPJA 4JI4M 3MJWA 2D5GA 1MS6A 4AKHA 1UELA 2NBWB 4MJSB 2MX2A 1AIPC 1FRRA 4OU7A 4G4RA 2FCQA 4TQ0A 2HHHM 4XGAB 1MHHE 4X6JA 3AMZA 4FADA 2BS3B 4LJ6A 1WI0A 1QOBA 4YYUA 2R62A 4BOSA 1DF0A 2WXNA 1LFDA 1WH3A 3GLGB 4MH0E 3I3TB 4F8CB 3NHEA 2KTFA 2DZLA 1IY2A 2VQEM 2WNMA 3SR6A 1XCTL 3WIMA 4HCPB 3KVWA 1KM7A 2FIDA 1VJKA 2JQRB 5EZQA 4YTNB 1XLOA 4DR7M 3HVDA 1CV8A 3U5ZB 1KLVA 2QENA 5LMNM 4PADA 4OZBA 2KWDA 1TZOA 5DYIA 2AHMA 1RFKA 2AUXA 2UZJA 3W30A 1GB4A 1DO2A 2KTRB 3L54A 1XQQA 3NVVA 2L7HA 5CVNB 1QAQA 3EIHA 4F1SA 1E8WA 5JI2E 2E6XA 5BYQA 2KDBA 4JI8M 1K8RB 1IBMM 2KT7A 4KV2A 1I7HA 2GQFA 1ROEA 2KX0A 1PUTA 1YJIA 2WS3B 3H89A 2KEBA 4G3OA 5JH3A 1K51A 3R8FA 2ZVNA 1GABA 2XEPA 1NBFC 3V6CB 4YSXB 3ZH9B 2B1NA 3FRHA 1KTKA 3IVFA 3BIID 3GZNB 2CKHB 4P6VF 5D6JB 1R2ZA 3ZDMC 4A6QA 3RNVA 4MH8A 1YJ1A 3OJ3A 3IHPC 2Y5BA 5DNYA 1HNWM 2XNAC 2R0IA 3FUUA 1HNZM 4DV6M 1NY6A 4Y28F 2EKEC 2DNAA 4DR3M 1N33M 1AU2A 1I94M 3H7SA 5G2NA 1K53A 3DZDA 2AUZA 1TIFA 2K8HA 4GB9A 2I7NA 3OLMD 3ONSA 1MEMA 1XKGA 2L1AA 2PPHA 1XXHA 3VRAB 1QUTA 1F9JA 5E6JA 3WAOA 3PXGA 4W9IA 3H4MA 2BKFA 1V2YA 1FPYA 1SE4A 2MQJA 4IDIA 3AN1A 4CQNA 1KFXL 4E3CA 1TDZA 4RNAA 1HA5A 3D8LA 3ECIA 3W9CB 3C8YA 2DVWB 1KFVA 5IKCM 1J7KA 1QXPA 2BBCA 2OOBA 2JZPA 3EC8A 3AEFB 2Q2EB 3DWMA 1ME4A 4RMAA 2K8BA 2JRIA 1JALA 4X66M 1W5SA 2G7YA 4D8BA 2CUZA 2FNAA 3C0RB 3JW0X 4G50A 3VKGA 2KD0A 3M99A 3MORA 1A70A 3AE6B 2C7NB 3VK7A 2KNVA 5LMUM 1G41A 1K3WA 1BGOA 4DR2M 1Y8RC 4IJFA 5IN7A 2XK5A 2J42A 5DPRA 3P1MA 1AYVA 3IV2A 5FPWA 2LVAA 4MGKE 1RM6C 1BQIA 1NDDA 1YALA 4BB9A 4GEWA 5PADA 2KN5A 2MH8A 4FW9A 4C4VA 3CF0A 2N4FA 4MZSA 4BOSC 2E5LM 2N9XA 3VDUA 1MHXA 2KW0A 3PDFA 1NYQA 5EP1A 4LF4M 4PP1A 5EXTA 3JR5A 2UU9M 1L2NA 3U6QA 2M56B 1UGJA 1D4BA 2OZ2A 2DAJA 2UU7A 3N30A 1PE6A 2XGNA 1QAOA 1T6OA 5AUKA 2WDRB 2KQ7A 2YJBA 7CATA 2WSEF 3LJ3A 1MX0A 1TS3A 3GP1A 2HTME 1UUPA 3BINA 2E02A 3AE9B 2LHDA 1DOYA 3A9KB 2MR9A 3N3KA 3Q8CA 3OVZA 3KFQA 4GDLA 4IBBA 2DCDA 2WBFX 2BJVA 1PPDA 4XC2A 2NQIA 5TR5A 4Z6YA 4GDKB 2JQGR 3KOWE 1R4MB 3B0AA 2IY1B 1UWMA 2N7EA 3TPZA 1OIPA 2LGDA 2LUMA 2AS8A 2Z59B 3BYTB 2FUG1 1PGYA 3ZJUA 4YYQA 3AKZA 2DC7A 2LHEA 4W9LA 9PAPA 4HDQA 1YN3A 3IBEA 2LXCA 3O1GA 4M00A 2N9EB 1T0YA 2ARYA 3B9JA 2PBHA 2BWEA 1R4NB 3P42A 1IP9A 4N8WA 4QBBA 3DHIC 2K6QA 1IN6A 4ZRKA 2C5RA 3DVGX 2XU3A 1R4GA 3GE3C 4G11A 1TLOA 3U60B 4B9KA 3E1ZB 3GLFE 3N3GA 1IN7A 2NPTA 2LGXA 3KXEC 2IO2B 2KOXA 3NVZA 4FN2A 4NQLB 4AZFA 5L83A 4PDIA 1E9MA 4LK0M 2DZYA 4US8A 3A46A 2CB5A 1TYGB 4I04A 1TDHA 3B1LX 1ZW7A 1I4QA 1TH2A 1IBXA 4GIPA 2KRKA 4IWQA 4IW0A 1WR6E 2Z4SA 4NAMA 3M3JA 3ZXVA 3SBJA 1N36M 3H8CA 1XT9B 4DBGB 4MGHA 1SJED 1E9SA 2KLGA 4KGSA 2KC1A 3WANA 2ZANA 3N9YC 3IUTA 3QSDA 3W1SA 3SD5A 2K0BX 1Y08A 1KLUD 3FC4A 3USVA 2LXEA 4NAWB 5LXIB 3BY4A 3UZUA 1NY5A 2M60A 3J81S 3IMAA 2JA2A 3GB1A 2HE7A 4NNJB 3VR9B 3ZTCA 2MGWA 2CP8A 4OX9M 2QJLA 4YWGG 2JRHA 4LJ5A 2O6VB 4HLQA 1GL6A 3NBIA 1UD7A 4LJOB 3IT6B 4N79A 2ZZPB 1STEA 2OOAA 3CGWA 1ZDVA 1GCBA 5EGWA 4GN1A 5EE0A 5JHAA 1LTMA 5IO9A 2D10A 3GQ4A 2BS2B 3PRMB 1FNWA 1FH0A 2G8LA 1BVSA 3NHEB 1KHQA 5ITXE 5EDSA 3ABVB 2G4SA 4IBDA 1XNQM 3TE6A 1QKZA 1NO1A 4UDUC 1WE6A 5IT9S 2QPAA 2I7PA 1VLBA 3UIPB 2YLMA 2LI5A 4E74A 5FTMA 2R4JA 1HXYD 2M8SA 2VZKB 2XU1A 4CDEB 2FUHB 3EFCA 1YVBA 4DR1M 5G55A 1N62A 2YJCA 4I05A 2J0JA 2Y5CA 3ENEA 4JLCA 3FTCA 2HAKA 3U6OA 4IM2A 4PYUA 1PJTA 5EP3A 2V4LA 1SE3A 1OEYJ 3GE8C 5D94A 3DF0A 2AQ3B 2RDGA 2CHZA 3KW9A 3MHSA 4IWOA 3P5VA 4OVZA 2I1KA 2K47A 2I2YA 2D11A 4IBIA 3MC0B 1PPPA 2QQ8A 4WJOA 1E90A 4DXFA 2VHFA 3AOGA 2B76B 1TS4A 3DBHI 3GRUA 2Z0EB 2RGOA 2DZIA 3VFKA 3FRIA 2J4XA 3Q3JA 3RN9C 2WSCF 2WWZA 1QILA 2NQGA 1XXHB 1QDRA 3KWVA 3UQBA 2OOBB 2N9LA 3U8ZA 1KJTA 2C7HA 1CS8A 3UQAA 1IXRC 4EFOA 3N1ZC 3AI5A 1ZV1A 2JP7A 1VG5A 3LMMA 1BUIC 2OPFA 3QC8B 2CJOA 2Y21A 4RGNA 4HEA1 3H7PB 3AU4A 4WJQA 2EUCA 1PPNA 2KN4A 2FNJB 3TSSA 3Q8GA 3VUWA 1SXJD 1JWBD 2EO2A 1XNRM 2RRUA 3C0RA 1CSBB 3K9OB 4CYEA 4W4UA 3DHGC 3B21A 4BPVA 1HEZE 2JUJA 3H8BA 4DV2M 2KNBA 1HTQA 2YQZA 3LCVB 1ZGUB 1HJPA 4MM3A 1WHCA 2HD5A 3N1XC 1IBXB 1BMLC 1YK8A 3U6SA 1Z5CA 1WSPA 3IFUA 3THGA 5IREB 4A90A 3U6EA 2L83A 3ZNID 4XR7A 1PYWD 4ZYSA 3HUIA 1VDLA 3R2IA 2WXJA 2GHUA 5D2MB 2C7MB 3I63C 1H8CA 1KOTA 1BT0A 3AEDB 1C78A 1KRHA 1EWOA 3LQRA 2IO3B 3MP9A 2FYEA 1SB3C 5CHFA 1KHPA 4A5UA 2FS1A 3DHHC 3MHHA 2KHHA 2N7DA 2W55A 4HPLB 4AQ7A 1XCQL 1CB5A 3NS8A 1QMYA 4EZJA 2G45B 2PIAA 2O6XA 2Z8LA 4NJ7A 3BVMA 3QWZB 2LHCA 1YZBA 1WIAA 1IYFA 2QCZA 4MSMB 1PFDA 3RE8A 1Q39A 3J7BA 3VTWA 4GRIA 4D81A 3A9KA 1IGDA 2PTLA 2HKJA 2LBCA 3DBRI 2LTUA 5EF4A 4HLEA 2HJ8A 4AQYM 4IBJA 4LF8M 3HRDD 3Q8FA 1PBHA 5ITTA 1TJEA 4J3OD 4JX1C 1XC8A 2OJWA 4TKNA 2YEPB 4KKJA 1B1ZA 2RDHA 3PGEA 4ZRQA 5DPTA 5AZGA 4B0MA 2KDIA 1HE8A 1E0ZA 5J18A 2XBBC 3H6SA 3MHVC 3N32A 1L5PA 1NPZA 3ZJTA 5C18A 1EIJA 2FCNA 3U6PA 3SATA 2SEBD 4X65M 2IO0B 5AUIA 4ZUXU 2QILA 1YJJA 2FBWB 3FYDA 1CJEA 3I4VA 2DAMA 5L95C 2FAZA 3RFZB 2QMTA 4YSYB 4Q8GA 1EWMA 4I8OA 2FFJA 2N35A 4CZWA 4DBGA 1FNUA 1DO0A 1G4AE 1H6UA 2LRUA 4HKQA 4QNMA 1JB0F 1DKIA 2KQSA 3ZQ4A 3H9DA 5CX3A 2KKCA 4DMYA 3UK6A 2MBEA 3AXCA 4NXMM 4XYCA 3AJIB 5DPSA 1J19A 1AU4A 3ZUAA 3SHQA 3RYTA 1P98A 4ZRIA 2KJHB 4KGTA 3FYCA 3CSTA 1WXMA 4Q8HA 2XU4A 4K3BA 3CBJA 3DVNV 3GLHE 3VFDA 4RGMA 2DZOB 1KLGD 3BWUD 3PW3A 2M5ZA 3T38A 2AX5A 2KXEA 3C58A 8CATA 1L0XB 1WX9A 4ASWC 1SP4B 4RH6A 4R71A 2X38A 1WGGA 3KVFB 3T1HM 1GUAB 5HKHA 2VZKD 2Q5WD 4X64M 2M1MA 4CHKA 3MC8A 3H8HA 1IY0A 4K7WA 8PCHA 2DCBA 2DCAA 1L4DB 2CU3A 3PTFC 2LWXA 4HPMB 4IOIE 2MP2B 1S3SG 4MSQB 3MMPA 2CR5A 2ZVOA 3J80S 2J53A 2NTSA 2WXQA 2B3TA 3FE3A 3Q8XA 1VEGA 1RFAA 3Q8BA 4OEMA 4BBNF 1MHWA 4QOSA 4MT5A 3BB7A 2LVOC 3CWIA 4DHJB 4JPSA 4FXCA 1VEJA 3UI3A 3KDSE 5CTRC 1WZ0A 3BC3A 5C1ZA 4I07A 2L4EA 3AOEC 3ZCBB 3GQ3A 1R4MI 2B1MA 3C3EA 4EE2A 5D3IB 4YV8A 1PGAA 1TKEA 3J9CA 4A3VB 1VJVA 2AYNA 2R9NA 2N1WA 2CHGA 2PJHA 3HIZA 2RKOA 3OF8A 1Z5AA 4AG6A 4KIKB 3VK8A 4S12A 1WJ6A 4GDKA 2G3QA 3SAUA 3GZNI 3L27A 1ISNA 1IM2A 1Q3CA 3LCUA 1ET6A 4LDTB 1MJGM 4WP2A 3PNRA 2WSFF 2RPQA 3Q69A 5FKAC 3HU1A 1PJSA 3LB8C 2C9CA 3I9V1 3SAWA 4FJZA 1JQJC 2EELA 3RVVA 3KYCD 2YJ2A 3RZWC 2DBYA 1C77A 4G3XB 1K82A 2QCUA 2IPPB 4OVUA 1PGXA 4EOYA 2AGAA 2W82A 4IBKA 1N34M 2GRIA 1NENB 1E94E 2YNMD 1L2CA 1F52A 2LVPA 3EFUA 1TZ1A 2E01A 3NBXX 1LV7A 4K7UA 1D5XC 1SE2A 2XF3A 3NVYA 2WU2B 4GKJM 2MJ5B 3MK6A 3ERVA 1PJQA 4WWOA 1EM7A 2LGIA 2OHFA 4DV5M 3FTEA 4GSWA 4BKGA 4OW0A 2DAEA 5AZHA 3WAPA 1OAOC 2WYQA 2OJRA 3L26A 1WM2A 2VH1A 3QAQA 2QDFA 3SASA 1ENFA 4FJCA 5KPTA 1L4ZB 2KDFB 2K3UA 1MI0A 3DQVA 1FFVA 2EKFA 3URYA 5JHBA 3TNXA 4OELA 4KZCA 2DWLA 2WXRA 2WXIA 2DHYA 2LFIA 2AL6A 1TY2A 2J7QA 1IN4A 3KP0E 1VR9A 2CFOA 4IWPA 3V61A 4WAAA 1J7CA 5FTKA 2DAFA 4G4QA 2C9OA 1EFUB 2O6VA 1DGHA 2O2VA 1CZPA 4NL4H 4MJSA 1JW9D 4ARCA 4AJWA 1NVID 2AQ2B 4F7ZA 2KMCA 3L0WB 1K52A 4QAYA 2OO9A 1QDQA 3QYEA 4QRVA 4D8IA 3HY5A 2GBRA 3SYLA 3V6EB 1HQYE 1N6ZA 1X37A 4YY3M 3NOBA 4C00A 1JQ4A 4P7IA 4W9DA 1NNJA 1WM3A 1E5WA 3RVWA 4BBAA 2NCNA 4GUAA 5EZSA 2K1FA 2QSDA 1JWUD 1GNUA 3B08A 4BS6A 1PADA 1T0RC 2KFKB 4HXDB 3KW5B 4L16A 4MELA 4GH9A 3AECB 1GMYA 4MSXA 3WXFA 2KQ4X 3P4RB 3WHKA 3QYBA 1NJGA 2LXAA 4HRSA 4I6NB 3OF9A 4JI7M 4CGYB 3KKUA 3U7DA 1R2YA 4IM3A 4XZ4A 3ZNZB 5IA7A 2DWZB 2QHOB 3ZNHA 2MH7A 3KLSX 4WURA 3C9PA 4LJ7A 3W1YA 4FD2A 1LXDA 5GMVA 3SFEB 1U5IA 4O1NA 4LFCM 2DCCA 5DYGA 1YX5B 3BZDB 2C99A 2DHRA 3RZFA 1U9WA 3IOQA 3ZRFA 1I4WA 1IXZA 1NV8A 3NWLA 3VDZA 2KWCA 3SAVA 3W0FA 4W9GA 1L2DA 4KLBA 2M17A 1DGGA 4D82A 2FE8A 2YR0A 2L32A 2V1YA 4TUUA 4C7ZA 4EZKA 1ESFA 3QK0A 1IXSB 1G6JA 2YEPF 5BMIA 4G54A 1WRDB 2IYDB 3EHVA 1D5ZC 1FCLA 1NV9A 2BGFA 2KMAA 2M19A 5JZEB 1ZE3D 5EE1A 3QHTA 4KSKC 1TKYA 4PS7A 4FULA 2F5PA 1EU3A 1XB2B 3N20C 3ILKA 4DR6M 3W5UB 3I3TA 2K8CA 4MDKE 3N4CA 2O25A 2DWMA 2DXIA 4OVVA 3GPPA 4L1BA 4AS1A 2N9PC 3QA8A 4LDTD 1G59A 3TL4X 3Q8AA 4CISA 1WJNA 3KUDB 4JI6M 1I35A 2DC9A 3EGRA 5AZFA 1U9VA 4ACFA 3EECA 1ME3A 5BPVA 4CDFB 2QC8A 3PHXB 1P0RA 1HUCB 3HHYA 3U5ZA 2Z84A 3HHMA 3KWZA 2BB5A 1T3QA 3WXGA 3LFYA 2PVGC 4CDCB 3J27B 4FVMA 2O5RA 4AKIA 3HVZA 3R3MA 4OHJA 1L8QA 2MJ3A 1V80A 3RD2A 4WIPA 5H92C 4GMVA 1N32M 3ZQJA 4IBCA 3T3NA 1MEGA 1HR0M 1NVMA 3U61B 2ICIA 3VH3B 3JYUA 1DGJA 2KX3A 5I4DA 1I4RA 3PRPA 4QHSA 1GO5A 1XHBA 1P9DU 1AN8A 2BYVE 3DBHB 1WXAA 2AIMA 1Z6TA 2BYTA 1EWCA 1ZKHA 3BK1A 3E56A 1UWXA 1TGZB 5E6PA 2V9HA 3AEEB 3C9EA 2AQ1B 3BYYB 4XX5A 2LASA 2WXGA 1NI2A 4A20A 5KPZA 4BLCA 2JRIB 3AE8B 2JXTA 4QOZC 3N1YC 4W9EA 2O6VD 4BAXA 3CH2X 4JV5M 2WU5B 1SXJC 2GMIC 3GLHA 3DWGC 2XFTA 4NQKE 1OGWA 2LMCA 2ZNVB 3QAUA 2CJNA 1GB1A 4NZLB 4TUWA 4WAFA 3FUVA 2BTWB 2R6NA 3JAMS 2JT4B 2LRWA 3VKHA 1L1TA 3B7ZA 4NPNA 1PPOA 2R2QA 2E03A 3PSEB 4W9FA 2KAJA 3T8MA 3APCA 3L25A 2C98A 2MP2A 4YYRA 3HU2A 2DAGA 3RNGC 1V6EA 2W3RA 2P7UA 3UIOB 3HHAA 1AECA 3U60A 2LWPA 4XUIA 2UXDM 1H4RA 4AOFA 3HWNA 2ZPYA 2H89B 5T8IA 1FXIA 1WXSA 1GPXA 1NB3A 2L3ZA 4EUTA 5CHVA 4IUMB 1V97A 3TJPA 4DR4M 3L13A 4D80A 3PNYA 4HWYA 3BOSA 3AH7A 4LCDE 3ZW3A 3GPYA 4AKGA 3IECA 1JR3E 3VRBB 1CVZA 2WXKA 1Z5SB 3B9PA 3A45A 3PSEA 3K92A 1F2BA 2G9HD 3KW6A 2KHWB 4PCZA 1JWAD 3LW5F 1YIWA 2DZKA 2D7EA 4YTPB 2INDC 7PCKA 1QOFA 3AU5A 2WLBA 4LY6A 3PHXA 3ZRCA 3BK2A 2N9KA 2WX0A 3VXWA 4K7CA 1PIPA 2LVPC 4BSQA 3NUHB 1HT2E 3IHPA 3HD3A 2QNJA 1GKIA 1QT9A 1V81A 3M0EA 4GC9A 3Q6BA 1IWDA 1STFE 3UMMA 3U7ZA 4E71A 1KFUL 4PI3A 3RVXA 2VHSA 2MBQA 1PM5A 3S2AA 1YX6B 4YHHM 1TS5A 3RMKC 2KK8A 4IBEA 1M94A 2G6DA 3ZUNA 3QARA 3GQ5A 3AE3B 4GGQA 2AEHA 2C96A 3VUYA 1NLJA 4HWIB 2K6DB 1E6EB 2OEDA 5FR3A 1YUBA 2KMMA 5A2QS 4USAA 1JROA 2EMTA 4PS3A 3V05A 5JI3E 5ITRA 3Q8EA 4MB7A 1SE9A 1OFFA 2D3BA 2G3QB 3OTOM 1FNNA 1SXJB 3M7GA 4JGHB 1FCCC 1AYUA 4WJPA 1F1HA 2GBKA 4DWFA 5E26A 5AEKB 1K3XA 1YQBA 1RRBA 3O65A 3S3RA 2KZRA 1DOIA
chains in the Genus database with same CATH topology
2Y0QA 4XDCA 3K8ZA 1GLNA 1JR3A 1YN5A 4KKIA 4B0EA 2VIIA 4KODA 2F5SA 4M0WA 1VZ7A 2IGGA 1HQCA 3KS8A 4WWMA 3O13A 3ZC7B 1UKFA 3FTDA 1C9FA 2V6ZM 1FXAA 1KF6B 1UNSA 3KP1E 4L23A 5EXSA 2NTTA 3V3XA 1ZXIA 2J7NA 4IJEA 4M9XA 1P7EA 5H8YE 4FWGA 1PGBA 2JYEA 1GAQB 1SIJA 3TRKA 4NXNM 2KZUA 5HG2A 2PKOA 2IJ0A 2KRUA 2Z3XA 1I4PA 4B3TM 3KS4A 4DV4M 1JWMD 5EE3A 1DGHB 3IAM1 3AEAB 2HL7A 4HKZE 2DZNB 3SMSA 4DQOC 1QVRA 2ZW0A 3TQSA 4YTMB 3I57A 2CE7A 1KFYB 1LO5D 2TSSA 5IWAM 4B08A 5EE9A 4JWUC 4WH4A 4LRSA 1N63A 4DUYM 4HROA 2VQFM 1MPEA 2BTEA 2A5YB 2R65A 2CHQA 3IXSA 5FLXS 4C80A 2BS4B 3R9XB 4NOOB 5EP4A 4ZTBA 4NRVA 4NJCA 3QWLA 2Y0TA 3PT2A 2WXFA 1YMHE 5ITYA 4LG2A 1OQQA 3SFZA 3VQIA 3ETRA 1I4GA 4LZJA 2X8AA 4QNRA 3SFDB 4FWHA 1FMAD 2QBYB 4LGMA 5LNK1 2ZW1A 2BJWA 1XEEA 1IUEA 1SXJE 2BNKA 2ZAOA 1N78A 5FSWA 2LJIA 1GOZA 4B7HA 3FILB 5D7GA 3MTVA 2HWKA 2SAKA 4ARIA 1N5XA 2ACZB 4OZAA 1VZ8A 3HGIA 4TSSA 3GRYA 1G8PA 4KO8A 3SEBA 2Z4RA 4NSRA 1HNXM 4N6EB 4BOPA 1IN8A 1W5TA 3SC3A 4FCVA 1SEBD 3GS2A 3PZ7A 1Q10A 4KHPM 1QAMA 1MVKA 4RF0A 5BMHA 1QQRA 1ZDXA 1ZXHA 1L6UA 5GXGB 5F3WA 1I4XA 4YT0B 4TQ1A 4DV0M 2K22A 4RGTA 2KACA 4WQMA 2BTWA 2HDEA 1TS2A 4B3SM 1XMOM 2WXHA 3AEBB 3TEXA 3HJSA 4JYAM 1L6VA 2INNE 3MJ5A 1J5EM 3AE1B 4DV7M 4ITKA 1YE9A 1WYGA 2IGDA 4CHTB 4G4NA 2RPVA 5KQ8A 1RYJA 2H88B 2UUCM 1GL7A 1FRDA 1OQRA 4II7A 4LRTA 4FWDA 3M6AA 1DYQA 4L8RC 1QZMA 5KPRA 4LJ4A 3TWKA 1N61A 2K0PA 3D8BA 5GKNA 3GRRA 1NHWC 4EIWA 2J52A 4DXGA 4LFBM 4I5SA 3TEZA 1HZ6A 1ZP0B 2ZM6M 1E10A 1EU4A 3LXFA 4IP3A 2YFQA 2DWNA 1F2RC 5HFYA 1F2RI 2IPKD 2F4VM 5EQTA 5JZEA 5KO3A 3TMPA 4L2YA 1EE8A 4ZOHC 3TEYA 2WP9B 2WXOA 5FTNA 4AI6A 3AB5A 3AFHA 3PFIA 3B2FA 1Z5BA 4YXDB 1V8CA 5BYSA 1XXGA 5EXPA 3T1YM 2R18A 3RGPA 1SF0A 1DGFA 3BBAA 2Y20A 4YSZB 4Z8XA 4AW4A 3CTWB 4XE0A 3K1JA 2XZUA 1R7SA 1XLQA 2X4AA 1T6BX 5C2TB 3AEGB 4IUMA 2K5PA 4PT5A 3FAHA 1F77A 4B7FA 1OFHA 1QANA 4LF9M 5BMGA 1C4AA 1ACCA 4D8EA 4R3DA 3IG8A 4G6ZA 3FTFA 3PNVA 1K50A 1MU5A 4P16A 5FK9C 3GPXA 4XWWA 3W0LB 4RCOA 5TSSA 1V1PA 3E9SA 4RF1A 3AL0C 1XF5L 1HZ5A 3GLHB 2WDVB 4XDDA 4OVZB 4LJ9A 3GP7A 2KZSA 3NRZA 5C3JB 1N77A 4NRWA 2QBYA 5IZ7D 3U6DA 1FFUA 1M4VA 1VDDA 3U52E 1YNTE 2GI9A 2R61A 1J09A 4IBFA 1XLNA 4RGOS 1Z59A 2ONQA 3KQ4A 2MJDA 2PLPA 2L6OA 1HQRD 2G1EA 2DYMA 1I4HA 2GB1A 4JXJA 2BT6A 4X62M 2L09A 4IIWA 4XGIA 2FOIC 2MEKA 2UXBM 4M9ZA 2OQ4A 3GLFB 2IGHA 3AE4B 4US9A 3I51A 1QOAA 4JI0M 3ZYYX 2DLBA 3IG5A 3TWMA 3KOXE 1J7BA 4FCTA 4JI5M 1N5WA 1JR3D 2ZBKB 1NYRA 5ITQA 4JI2M 3AE7B 3DA1A 1KYIA 5BR8M 4LLGM 1QF6A 4LCBA 4PDGA 2N7JA 1QQWA 1IBKM 1V1PB 4LJ8A 2J7OA 1C76A 1PJIA 3U6MA 1C1KA 5C1BA 2Y5PA 1C79A 1VZ6A 2BU3A 4XBOA 4GMQA 2DYOA 5D3DA 4DV1M 2INPE 3WHLA 4MGIE 4N58A 3FD9A 4HL4A 2QIEB 4W5WA 2ZAMA 1R7RA 3PHUA 3VLFB 4KX6B 1E7PB 3KOZE 3LQQA 1JCKB 1P7FA 1SBBB 2PW9A 3E4RA 1ZQ9A 3BVZA 4DR5M 4PD2A 1ZPSA 1YQ3B 1TY0A 2DWQA 3NZ3A 2JWUA 2E3TA 2ON8A 3U61A 3BVGA 2IDYA 5JXVA 1WXQA 2JYTA 3ZJVA 2P5TA 2NQ8C 3T3OA 1SSNA 1SXJA 2X49A 3SMPA 1FEHA 1JMLA 4AG5A 1CK1A 2XSZD 1KH0A 4I81A 5G5HA 4XZXA 2DOSA 4G4OA 2RMMA 3KFUG 3U6LA 3A42A 5FTJA 1F0ZA 3UJNA 3L28A 4ZHOA 3U6CA 1OJLA 1ET9A 1L0YB 2V1UA 4BOZA 1T5XD 5ITXA 1RWSA 4GITA 3VDPA 3AE5B 3U2SC 4JN6A 2R45A 4RKXA 3GLFA 1YSYA 1FD6A 2JSVX 1B9RA 2BB6A 1VRAB 5G5GA 3HWSA 4OZCA 3PRMA 1JWSD 3FUTA 1E9RA 3KSXA 4M0DA 4LFAM 2M0AA 3GRVA 4FCWA 4GLSC 4C56C 3P4PB 2CHVA 4GHAA 3RGSA 2Y3AA 3MFGA 2K9XA 3IT4B 4XWTA 3SHGB 3K2LA 1JRPA 5EP2A 1NSFA 4GC5A 4L4UA 2PMVA 4L78A 2WXPA 1E32A 1DOXA 1Q3BA 1ZUD2 3VR8B 1GVNA 2LNHC 3TWLA 1R6BX 1XMQM 3EIEA 1D2NA 2NMQA 3SARA 1WWTA 1J7AA 2JU6X 3GPUA 1YN4A 4JI3M 1ZOYB 5HI1A 2WXMA 3HJ8A 3A98B 4ZHPA 3KSJA 2QZ4A 4ITQA 3L29A 4HJGE 4L15A 3DOAA 2UUAM 2QEJC 3R8BA 3LVVA 3NVWA 4A9AA 4GHLA 4K0KM 2CV0A 2F5QA 4WW0A 3I4YA 1C4PA 3U4EG 3MP2A 4LF6M 4MM3B 2ERCA 1FNVA 2V0GA 1KSFX 1Y56A 2V1CA 5EXXA 1QYRA 3J2PB 4BOQA 1T3TA 3UGJA 1G3IA 3P4SB 3FUWA 2JTCA 2CEAA 1IY1A 3T15A 1IBLM 2XLJA 1NNUC 3KWLA 5KQDA 3P4QB 5HHDG 1QOGA 2WDQB 1EWYC 3LVWA 2R46A 1FO4A 5H37D 4C7YA 3HHXA 3L4PA 3FKEA 1DGBA 4BOUA 1XO3A 4N59A 1FM0D 3PO0A 3OWEB 1AWDA 1NHGC 2CV2A 3W31A 4MGYE 4ZRPA 1TKGA 2W3SA 2UXCM 4B7GA 3DFZA 3EUB2 2W54A 1XLPA 3RPFC 1WGKA 1SXTA 3CF2A 4B3RM 4JWSC 2N0SB 4LZZA 4RFBA 3NS1A 2Z7JA 4NSOB 2LH0A 4KLNA 3R2TA 2V4IB 4B3MM 1L2BA 1TH4A 3AV8A 1IN5A 1WRIA 3TUOA 3IAS1 4R7GA 2CV1A 4LF5M 1D5MC 3AOEA 3HHZA 4Q2JA 3PHWA 3B2GA 2LEKA 4IKGA 4DV3M 1AW7A 1L0VB 3J7AS 1OFIA 2KA6B 2XSZA 2H1RA 3GLIA 1C4CA 2EA0A 3KOYE 4LGYA 1YQ4B 4KGRA 4JE3B 4LJAA 1ORYB 1AYFA 3CIRB 1PDXA 2JX5A 2MJEA 3LYYA 2BW2A 1SJHD 2F5OA 1L1ZA 3FILA 3FUXA 3AM9A 4LF7M 1ZAEA 2G5GX 4MGZE 1FIQA 1XWIA 1TH3A 4DUZM 2QP9X 1VDVA 2I38A 5FTLA 2XH9A 1IQPA 4GDLB 4TMAB 3SHFA 2V3PA 2XN9C 5BYRA 3WCQA 1S3SA 1NEKB 2WQYB 2XZFA 4A8XC 5EJCA 2V3NA 3TEWA 1IGCA 3EA6A 2HCBA 4GKKM 1FJGM 2F5NA 1D6EC 4QHTA 4MACA 4REZA 1UM8A 3GLGA 1PJJA 1N60A 3PZ8A 2KDMA 2D7GA 3W5VB 4A55A 4LTUA 3JR4A 3OQCA 4MI7A 3HJQA 2L52A 3GLIB 4ZPXA 3AV0A 5MPOA 5ITUA 2R4EA 4D2KA 4M9SA 1CQVA 4JI1M 2EKIA 2XFSA 1V1OA 3SYKA 1BXTA 1QLBB 3ZGZA 4IBGA 1PVJA 2D7HA 3L2AA 3HKPA 2RGHA 3PVSA 1N75A 2J7QC 1HT1E 3HU3A 3CF6E 1NJFA 3W2DA 1NI3A 2L7IA 3RFWA 2WXLA 4I4LA 3AE2B 2UUBM 3P63A 3HHWA 3GO8A 2PVOD 3MHZA 4H2AA 1TGUA 4JI4M 2D5GA 4AKHA 1FRRA 4OU7A 4G4RA 4TQ0A 2HHHM 1MHHE 3AMZA 2BS3B 4LJ6A 1QOBA 2R62A 4BOSA 2WXNA 3GLGB 4MH0E 1IY2A 2VQEM 2WNMA 3SR6A 1XCTL 3KVWA 1VJKA 2JQRB 5EZQA 4YTNB 1XLOA 4DR7M 3HVDA 3U5ZB 2QENA 5LMNM 4OZBA 2KWDA 1TZOA 5DYIA 2AHMA 1RFKA 2UZJA 3W30A 1GB4A 1DO2A 3NVVA 2L7HA 1QAQA 3EIHA 5JI2E 2E6XA 5BYQA 4JI8M 1IBMM 1I7HA 1ROEA 1PUTA 1YJIA 2WS3B 2KEBA 3R8FA 1K51A 4YSXB 2XEPA 3ZH9B 1KTKA 3BIID 4P6VF 1R2ZA 4A6QA 3RNVA 4MH8A 5DNYA 1HNWM 2XNAC 3FUUA 1HNZM 4DV6M 1NY6A 4DR3M 1N33M 1I94M 1K53A 3DZDA 2I7NA 2L1AA 1XXHA 3VRAB 5E6JA 3PXGA 3H4MA 1SE4A 4IDIA 3AN1A 4CQNA 1TDZA 4RNAA 1HA5A 3D8LA 3W9CB 3C8YA 2DVWB 1KFVA 1J7KA 2BBCA 2JZPA 3AEFB 2Q2EB 3DWMA 2JRIA 1JALA 4X66M 1W5SA 4D8BA 2CUZA 2FNAA 3VKGA 1A70A 3AE6B 3VK7A 5LMUM 1G41A 1K3WA 4DR2M 4IJFA 2J42A 3P1MA 4MGKE 1RM6C 4BB9A 4FW9A 3CF0A 2E5LM 3VDUA 1MHXA 2KW0A 1NYQA 5EP1A 4LF4M 5EXTA 3JR5A 2UU9M 3U6QA 2M56B 1UGJA 1D4BA 2XGNA 1QAOA 5AUKA 2WDRB 7CATA 1MX0A 1TS3A 3GP1A 2HTME 1UUPA 3AE9B 2LHDA 1DOYA 3Q8CA 4IBBA 2BJVA 4Z6YA 4GDKB 3KOWE 1UWMA 3TPZA 2LUMA 3BYTB 2FUG1 3ZJUA 3AKZA 2LHEA 1YN3A 3B9JA 3P42A 1IN6A 2C5RA 3U60B 1IN7A 3KXEC 3NVZA 4AZFA 4PDIA 1E9MA 4LK0M 4US8A 3A46A 1TYGB 1TDHA 1I4QA 1TH2A 1IBXA 4GIPA 2KRKA 2Z4SA 4NAMA 3SBJA 1N36M 4MGHA 1SJED 1E9SA 4KGSA 2ZANA 3N9YC 3W1SA 1KLUD 3FC4A 2LXEA 4NAWB 3BY4A 3UZUA 1NY5A 2M60A 3J81S 2JA2A 3GB1A 3VR9B 4OX9M 2QJLA 4YWGG 4LJ5A 4HLQA 1GL6A 3NBIA 3IT6B 1STEA 1ZDVA 5EE0A 3GQ4A 2BS2B 1FNWA 2G8LA 5ITXE 3ABVB 4IBDA 4UDUC 3TE6A 1XNQM 1QKZA 5IT9S 2QPAA 2I7PA 1VLBA 5FTMA 2R4JA 1HXYD 2VZKB 4DR1M 1N62A 2Y5CA 3FTCA 3U6OA 5EP3A 1SE3A 2AQ3B 2RDGA 4OVZA 2I2YA 2K47A 4IBIA 3MC0B 4DXFA 3AOGA 2B76B 1TS4A 3GRUA 2RGOA 2J4XA 1QILA 1XXHB 3KWVA 2N9LA 1IXRC 3LMMA 1BUIC 2OPFA 2CJOA 2Y21A 4RGNA 4HEA1 2EUCA 2KN4A 3TSSA 1SXJD 1JWBD 2EO2A 1XNRM 3C0RA 3B21A 1HEZE 4DV2M 2YQZA 1IBXB 1BMLC 3U6SA 1Z5CA 1WSPA 3IFUA 3THGA 5IREB 4A90A 3U6EA 2L83A 1PYWD 4ZYSA 3HUIA 3R2IA 2WXJA 3AEDB 1C78A 1KRHA 3LQRA 3MP9A 1SB3C 4A5UA 2W55A 4AQ7A 1XCQL 2PIAA 2Z8LA 3BVMA 1YZBA 1PFDA 3RE8A 1Q39A 3J7BA 4GRIA 4D81A 1IGDA 2PTLA 2HKJA 4AQYM 4IBJA 4LF8M 3HRDD 3Q8FA 4JX1C 4J3OD 5ITTA 1TJEA 1XC8A 2YEPB 4KKJA 1B1ZA 2RDHA 4ZRQA 4B0MA 1E0ZA 3MHVC 1L5PA 3ZJTA 5C18A 3U6PA 3SATA 2SEBD 4X65M 5AUIA 2QILA 1YJJA 2FBWB 3FYDA 1CJEA 3I4VA 3RFZB 2QMTA 4YSYB 4I8OA 2FFJA 1FNUA 1DO0A 1G4AE 1H6UA 4HKQA 4QNMA 1DKIA 3ZQ4A 3UK6A 4NXMM 3AJIB 4KGTA 3FYCA 3VFDA 4RGMA 2DZOB 1KLGD 3BWUD 2M5ZA 3T38A 2AX5A 2KXEA 3C58A 8CATA 1L0XB 4RH6A 2X38A 3T1HM 2VZKD 2Q5WD 4X64M 3H8HA 1IY0A 1L4DB 2CU3A 2LWXA 4IOIE 3J80S 2J53A 2NTSA 2WXQA 3Q8XA 3Q8BA 4QOSA 4MT5A 3BB7A 3CWIA 4JPSA 4FXCA 3UI3A 3KDSE 3AOEC 3ZCBB 3GQ3A 4EE2A 5D3IB 1PGAA 1TKEA 3J9CA 4A3VB 2CHGA 2RKOA 1Z5AA 4AG6A 3VK8A 4S12A 3SAUA 3L27A 1IM2A 1Q3CA 1ET6A 3Q69A 5FKAC 3HU1A 3LB8C 2C9CA 3I9V1 3SAWA 1JQJC 2EELA 2DBYA 1C77A 1K82A 2QCUA 1PGXA 2AGAA 2W82A 4IBKA 1N34M 2GRIA 1NENB 1E94E 2YNMD 1L2CA 1LV7A 1D5XC 1SE2A 2XF3A 3NVYA 2WU2B 4GKJM 3MK6A 1EM7A 2LGIA 2OHFA 4DV5M 3FTEA 4OW0A 3L26A 3SASA 1ENFA 5KPTA 1L4ZB 2K3UA 1MI0A 1FFVA 3URYA 2DWLA 2WXRA 2WXIA 2LFIA 1TY2A 2J7QA 1IN4A 3KP0E 1VR9A 2CFOA 1J7CA 5FTKA 4G4QA 2C9OA 1DGHA 1CZPA 4NL4H 1JW9D 4ARCA 1NVID 2AQ2B 1K52A 4D8IA 3SYLA 1HQYE 1X37A 4YY3M 1JQ4A 1NNJA 4BBAA 4GUAA 5EZSA 2QSDA 1JWUD 4HXDB 4L16A 4GH9A 3AECB 2KQ4X 3P4RB 3WHKA 1NJGA 4HRSA 4JI7M 4CGYB 1R2YA 2DWZB 3ZNHA 2MH7A 3KLSX 4WURA 4LJ7A 4FD2A 3SFEB 4O1NA 4LFCM 5DYGA 3BZDB 2C99A 2DHRA 1I4WA 1IXZA 3NWLA 3SAVA 3W0FA 1L2DA 1DGGA 4D82A 2FE8A 2YR0A 2L32A 4C7ZA 1ESFA 1IXSB 2YEPF 5BMIA 1D5ZC 1FCLA 2M19A 1ZE3D 5EE1A 1TKYA 2F5PA 1EU3A 3W5UB 3ILKA 4DR6M 2DWMA 2DXIA 3GPPA 4L1BA 4AS1A 1G59A 3TL4X 3Q8AA 4CISA 4JI6M 3EGRA 5BPVA 3HHYA 3U5ZA 2Z84A 2BB5A 1T3QA 2PVGC 4FVMA 3J27B 2O5RA 3HVZA 4AKIA 4OHJA 1L8QA 2MJ3A 4WIPA 5H92C 1N32M 4IBCA 3T3NA 1HR0M 1NVMA 3U61B 2ICIA 1DGJA 5I4DA 1I4RA 3PRPA 4QHSA 1XHBA 1AN8A 1Z6TA 2BYTA 1EWCA 3BK1A 3E56A 1UWXA 3AEEB 2AQ1B 3BYYB 2WXGA 5KPZA 4BLCA 3AE8B 2JXTA 4QOZC 4JV5M 2WU5B 1SXJC 3GLHA 3DWGC 2XFTA 2LMCA 3QAUA 2CJNA 1GB1A 4NZLB 4TUWA 4WAFA 3FUVA 2BTWB 3JAMS 3VKHA 1L1TA 2KAJA 3L25A 2C98A 3HU2A 2W3RA 3U60A 2UXDM 5T8IA 2H89B 1GPXA 1FXIA 1V97A 4DR4M 4D80A 3PNYA 3BOSA 3AH7A 3GPYA 4AKGA 3VRBB 2WXKA 3B9PA 3A45A 3PSEA 3K92A 2G9HD 3KW6A 4PCZA 1JWAD 2D7EA 4YTPB 1QOFA 2WLBA 4LY6A 3PHXA 3BK2A 2N9KA 3NUHB 1HT2E 1GKIA 1QT9A 3M0EA 4GC9A 3UMMA 3U7ZA 1PM5A 4YHHM 1TS5A 4IBEA 3GQ5A 3AE3B 2C96A 5FR3A 1E6EB 2OEDA 1YUBA 2KMMA 5A2QS 4USAA 1JROA 3V05A 5JI3E 5ITRA 3Q8EA 4MB7A 1OFFA 3OTOM 1FNNA 1SXJB 3M7GA 1FCCC 5E26A 1K3XA 3O65A 1DOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RF0 A;  3MJ5 A;  3E9S A;  4RF1 A;  4REZ A;  4PT5 A;  4OVZ B;  4OVZ A;  4P16 A;  5E6J A;  4M0W A;  5KO3 A;  3MP2 A;  4MM3 B;  4R3D A;  4RNA A;  4OW0 A;  4WUR A;  2FE8 A; 
#chains in the Genus database with same CATH topology
 2Y0Q A;  4XDC A;  3RNE C;  4HK2 A;  1V92 A;  1BY8 A;  2UWQ A;  3K8Z A;  3DPD A;  1G71 A;  1GLN A;  1JR3 A;  1YN5 A;  4KKI A;  4B0E A;  2VII A;  3QX1 A;  3PHW B;  4KOD A;  2F5S A;  2IO1 B;  4M0W A;  2FQ9 A;  1VZ7 A;  3KX1 A;  1NB5 A;  2C9W B;  3H4J A;  3MTN B;  5E6N A;  3JSV A;  5CHT A;  2MBH A;  2IGG A;  1J0G A;  1HQC A;  1VQ1 A;  2Z8Y M;  1D3Z A;  2R9O A;  3KS8 A;  4WWM A;  3O13 A;  3ZC7 B;  1X1M A;  2FUD A;  1EWP A;  1UKF A;  2DNF A;  3FTD A;  1E8X A;  1C9F A;  2KWU B;  3D6S A;  2V6Z M;  1FXA A;  1KF6 B;  1UNS A;  2IZV B;  3HM6 X;  3KP1 E;  3ZIM A;  4ANR A;  4L23 A;  5EXS A;  2NTT A;  2ZCC A;  1QZE A;  4P6G A;  1ICF A;  3V3X A;  1ZXI A;  2J7N A;  1OTR A;  4IJE A;  4M9X A;  1P7E A;  5H8Y E;  4FWG A;  1PGB A;  2JYE A;  1GAQ B;  1SIJ A;  5DPW A;  3TRK A;  1EO6 A;  4NXN M;  1ZMV A;  2KZU A;  5HG2 A;  2NS5 A;  2PKO A;  1WJU A;  2IJ0 A;  1PCI A;  2KRU A;  1OAI A;  3ZVV A;  6PAD A;  2Z3X A;  1I4P A;  2GBJ A;  2ZEQ A;  4B3T M;  3KS4 A;  4DV4 M;  1JWM D;  5EE3 A;  3ZNG C;  2G4D B;  1DGH B;  3IAM 1;  2KFK A;  2M0X A;  4HXD A;  4LNF A;  5DCN A;  3AEA B;  1S1Q B;  2HL7 A;  1RU3 A;  4BBN C;  4HKZ E;  1CUK A;  2JNH A;  1FXT B;  4I6L B;  2DZN B;  3SMS A;  4DQO C;  2KDL A;  2L4F A;  2LJ5 A;  1WFY A;  2VH2 A;  2GFO A;  4KDL B;  1QVR A;  2ZW0 A;  4FHJ A;  1Y4H A;  3W67 A;  3TQS A;  4YTM B;  3I57 A;  4K7S A;  4QRG A;  1TTN A;  2M4N A;  4YL8 A;  2CE7 A;  1KFY B;  3PS6 A;  1AAR A;  1LO5 D;  2BF8 B;  2TSS A;  5IWA M;  4B08 A;  2JY8 A;  5EE9 A;  2INC C;  2UYZ B;  4JWU C;  4WH4 A;  1ZIV A;  2XU5 A;  4LRS A;  1N63 A;  1WX7 A;  4I6P A;  4DUY M;  4HRO A;  4BS5 A;  1WF9 A;  1J8C A;  2VQF M;  1MPE A;  4K3C A;  2N1V A;  2BTE A;  2A5Y B;  2R65 A;  2L05 A;  4W9J A;  2AWT A;  2D3A A;  2KJ6 A;  2CHQ A;  3IXS A;  5FLX S;  4DHZ B;  3RUI B;  2D3G A;  4C80 A;  1IFY A;  2BS4 B;  3R9X B;  3PZD A;  3PRP B;  4NOO B;  5EP4 A;  4ZTB A;  1D0K A;  3PPA A;  1U4A A;  4F2L A;  4NRV A;  4NJC A;  3QWL A;  2Y0T A;  3PT2 A;  2L8J A;  1YMH E;  2WXF A;  3KUZ A;  3CMM B;  2NQD B;  5ITY A;  4LG2 A;  1OQQ A;  3SFZ A;  3VQI A;  2ZTD A;  3ETR A;  3B7N A;  1I4G A;  4LZJ A;  4M0W B;  2X8A A;  4QNR A;  4RKU F;  1M6D A;  3SFD B;  2LD9 A;  1WR1 B;  2AU1 A;  4FWH A;  1P3Q U;  1FMA D;  4CJ6 A;  4M8M A;  2QBY B;  2JZ1 A;  2BYF A;  4PS8 A;  2JY5 A;  4LGM A;  1YT7 A;  5LNK 1;  1U9Q X;  3RNF C;  2ZW1 A;  3QIJ A;  2BJW A;  1XEE A;  3BBZ A;  2JUO A;  1IUE A;  1SXJ E;  4BQV A;  2BNK A;  2ZAO A;  1N78 A;  2KWV B;  4NJ6 A;  4AP4 C;  1WJ7 A;  5FSW A;  2LJI A;  1UFZ A;  1GOZ A;  4B7H A;  3FIL B;  3RUL A;  3GCB A;  5D7G A;  3MTV A;  1UH6 A;  4KIK A;  1GEC E;  3DVG Y;  2HWK A;  2SAK A;  4ARI A;  1N5X A;  2ACZ B;  4OZA A;  1Q5W B;  1TF0 B;  1VZ8 A;  3HGI A;  3APF A;  4TSS A;  4HPP A;  2Y6E A;  4W5C A;  3GRY A;  1G8P A;  4KO8 A;  3SEB A;  2ATO A;  2Z4R A;  4DK5 A;  1K3B B;  4NSR A;  1HNX M;  4AUQ C;  3Q3M C;  4N6E B;  4BOP A;  1IN8 A;  2LVN C;  1W5T A;  3L08 A;  3B74 A;  3SC3 A;  4FCV A;  3E46 A;  1SEB D;  1V9J A;  3GS2 A;  5J17 A;  4CIZ A;  3DBS A;  1Q10 A;  3PZ7 A;  4KHP M;  1QAM A;  1MVK A;  2BQQ A;  3V60 A;  4RF0 A;  3E21 A;  5BMH A;  3KH0 A;  1QQR A;  1ZDX A;  1ZXH A;  3T9L A;  1UBQ A;  2J0K A;  1L6U A;  4M8N A;  3PBH A;  3NG0 A;  2MRP A;  4G0N B;  5F3W A;  5GXG B;  1WIV A;  2APL A;  1I4X A;  4YT0 B;  4TQ1 A;  4DDI D;  4DV0 M;  2DKL A;  2K22 A;  4GXB A;  4RGT A;  2KAC A;  3RNB C;  4DXA B;  1Z2M A;  4WQM A;  2KNA A;  3Q3N C;  1WE7 A;  4YVA A;  2D3C A;  2BTW A;  2HDE A;  1TS2 A;  3Q2A C;  1ATK A;  4B3S M;  2GBM A;  3QJZ A;  3KYD D;  1XMO M;  2WXH A;  3OG5 A;  1C3T A;  2ACT A;  3AEB B;  3PLV A;  3TEX A;  1AYW A;  2J5Y A;  3HJS A;  3OAW A;  2WGS A;  1WGH A;  3QQ8 B;  4JYA M;  1L6V A;  1DEU A;  3QJ3 A;  2INN E;  1WMH B;  4ICV A;  3MJ5 A;  1J5E M;  2L0F A;  2L7R A;  2J7Q B;  3AE1 B;  1F2C A;  4DV7 M;  4ITK A;  1VD2 A;  4BOZ B;  2G8E A;  1YE9 A;  3RI7 C;  4LJP B;  1WYG A;  2IGD A;  4CHT B;  1GJZ A;  2DC6 A;  3Q3F A;  3GLI E;  3JSV B;  4G4N A;  2RPV A;  5KQ8 A;  2HTH A;  1RYJ A;  2H88 B;  2MLB A;  2UUC M;  1WGD A;  5CHW A;  3RNC C;  2MCN B;  1CJL A;  1GL7 A;  3X0W A;  1Q6K A;  2AVW A;  1FRD A;  1OQR A;  4II7 A;  4LRT A;  4FWD A;  2P0R A;  4X6I A;  3M6A A;  1DYQ A;  4L8R C;  1QZM A;  2PNS A;  4GU2 A;  3O65 B;  2L2D A;  5KPR A;  3O0U A;  4LJ4 A;  3TWK A;  3GLG E;  1N61 A;  2K0P A;  4DMX A;  1GG3 A;  1V5T A;  3D8B A;  3R66 C;  2KJR A;  5GKN A;  3GRR A;  1NHW C;  4EIW A;  2J52 A;  3NY5 A;  4DXG A;  4LFB M;  4I5S A;  1WZ3 A;  3TEZ A;  2F7D A;  2G8J A;  3BPM A;  1HZ6 A;  1ZP0 B;  1THE A;  3QT4 A;  2ZM6 M;  1E10 A;  3K9M A;  1EU4 A;  3LXF A;  2FCS A;  4F1I A;  4IP3 A;  4ANW A;  2YFQ A;  2DWN A;  4BKS D;  2KO3 A;  1I42 A;  1F2R C;  5HFY A;  3QCA A;  1F2R I;  2IPK D;  2CHX A;  4M01 A;  5CHV C;  1WYW B;  3W1S C;  1MG4 A;  4DHJ D;  2F4V M;  2A5U A;  4B6W A;  3ZLZ A;  5EQT A;  5JZE A;  2LZ6 A;  3UIN B;  5KO3 A;  3TMP A;  4L2Y A;  1EE8 A;  4ZOH C;  1SG9 A;  4II3 B;  3VAW A;  3TEY A;  2WP9 B;  2WXO A;  1A6R A;  5FTN A;  1SGH A;  4AI6 A;  3AB5 A;  3AFH A;  3PFI A;  2OP3 A;  4P6E A;  3F92 A;  3B2F A;  1ZMU A;  1Z5B A;  1YD8 U;  2LGS A;  1SNK A;  3NJT A;  4YXD B;  1V8C A;  5BYS A;  1XXG A;  4IG7 B;  3CH3 X;  5EXP A;  3T1Y M;  2R18 A;  1R4N I;  3RGP A;  3K8U A;  1WY8 A;  1SF0 A;  2HD5 B;  1E8Y A;  1DGF A;  1GC7 A;  3BBA A;  2Y20 A;  1C1Y B;  3I06 A;  4YSZ B;  4Z8X A;  4AW4 A;  3CTW B;  3K1J A;  2XZU A;  4XE0 A;  1R7S A;  1XLQ A;  4K1R B;  2X4A A;  1T6B X;  4PYZ A;  5C2T B;  3AEG B;  2D2Q A;  3I04 M;  4IUM A;  2K5P A;  4KVG B;  4PT5 A;  2DZZ A;  3FAH A;  1F77 A;  2BKR B;  4B7F A;  3Q14 C;  1OFH A;  1QAN A;  1LM8 B;  4LF9 M;  5BMG A;  4AWJ A;  1C4A A;  3KSE A;  4EEW A;  2FO5 A;  1ACC A;  4D8E A;  2A4Z A;  4R3D A;  3IG8 A;  4LNK A;  4G6Z A;  3FTF A;  3PNV A;  2C5L C;  1K50 A;  1MU5 A;  4P16 A;  1NQC A;  5FK9 C;  3GPX A;  3X23 A;  3TBL D;  2AYO A;  1D0L A;  3U30 A;  3RCZ A;  4XWW A;  3W0L B;  4RCO A;  5TSS A;  1NL6 A;  1F2A A;  4X57 B;  2WHI A;  1V1P A;  3E9S A;  4RF1 A;  3AL0 C;  1T0Q C;  2ZPN A;  3OJ4 B;  1D0M A;  1XF5 L;  1Q02 A;  2VF8 A;  1HZ5 A;  2LHG A;  2JQF R;  3GLH B;  2WDV B;  2KDE B;  3WA0 A;  3L17 A;  2B3A A;  4XDD A;  4OVZ B;  5IP4 D;  3V76 A;  4LJ9 A;  3GP7 A;  2KZS A;  1EUV B;  3NRZ A;  4IM0 A;  2MWS B;  5C3J B;  1N77 A;  1AU0 A;  2D07 B;  4NRW A;  2FCM A;  2QBY A;  4ZYN A;  5IZ7 D;  3ZTD A;  3S3Q A;  3U6D A;  3HHI A;  3KWB X;  1FFU A;  2HWJ A;  4WWN A;  2KTR A;  1M4V A;  1VDD A;  3U52 E;  1YNT E;  2GI9 A;  2R61 A;  1J09 A;  4IBF A;  1XLN A;  2KFJ A;  4RGO S;  1Z59 A;  2MJD A;  2ONQ A;  2PLP A;  3KQ4 A;  2L6O A;  4RM9 A;  1HQR D;  3IEJ A;  3SU8 X;  2G1E A;  2EJS A;  1KXR A;  2ZTC A;  2DYM A;  1I4H A;  2GB1 A;  4JXJ A;  2BT6 A;  4X62 M;  2L09 A;  1QUS A;  2K25 A;  4IIW A;  4XGI A;  2FOI C;  2MEK A;  1A5R A;  3SDL C;  2UXB M;  4M9Z A;  2OQ4 A;  3GLF B;  2IGH A;  2CS4 A;  1SIF A;  4BKT A;  2DX5 B;  3AE4 B;  4US9 A;  1EF7 A;  3I51 A;  4QH6 A;  1T0S C;  1QOA A;  4JI0 M;  3ZYY X;  2DLB A;  3M95 A;  3DOW A;  4YYV A;  3IG5 A;  3TWM A;  3KOX E;  1EF5 A;  1J7B A;  3BY4 B;  2JZ0 A;  3L10 B;  3APD A;  4FCT A;  4JI5 M;  1YOV B;  4ANX A;  1N5W A;  1JR3 D;  4WA6 A;  3BOW A;  2ZBK B;  1NYR A;  2KC2 A;  5ITQ A;  4JI2 M;  3AE7 B;  3DA1 A;  1KYI A;  3ZXR A;  3P5U A;  4HJK A;  5BR8 M;  4LLG M;  1QF6 A;  4LCB A;  2CU1 A;  2ASQ A;  4PDG A;  1V34 A;  4JL9 A;  4CDD B;  5A24 A;  2N7J A;  2DAI A;  1EWL A;  1QQW A;  4MZO A;  3RNA C;  3CBK A;  1IBK M;  4LNN A;  2EKK A;  1V1P B;  3DBR B;  1OIZ A;  4GOC A;  4P1B C;  4LJ8 A;  2J7O A;  4Q7J A;  1C76 A;  1PJI A;  4DDG D;  3U6M A;  1C1K A;  5C1B A;  4WWP A;  1OKS A;  2Y5P A;  2JY6 A;  4JQW C;  3K9O A;  2RSU A;  2DZJ A;  1MN3 A;  1C79 A;  2QHO A;  1Q1O A;  1VZ6 A;  2BU3 A;  4XBO A;  3HK0 A;  4GMQ A;  2IY0 B;  3M63 B;  2DYO A;  1QDT A;  5D3D A;  1JQP A;  4DV1 M;  2INP E;  3WHL A;  4MGI E;  4N58 A;  4HVB A;  2CHW A;  3FD9 A;  4HL4 A;  2QIE B;  4A3P A;  3R7Q A;  3UGB B;  2MRO B;  3MHS D;  4W5W A;  2ZAM A;  1OQY A;  1C7Y A;  1R7R A;  5CVO B;  1UGM A;  1XD3 B;  1RLF A;  3PHU A;  3VLF B;  3W68 A;  4KX6 B;  1E7P B;  3KOZ E;  3LQQ A;  1JCK B;  1P7F A;  1SBB B;  2NBU A;  2NR2 A;  4W9H A;  2PW9 A;  2JXX A;  3H7P A;  3E4R A;  3BXW A;  3Q3O C;  1ZQ9 A;  3BVZ A;  4DR5 M;  4PD2 A;  1ZPS A;  1YQ3 B;  1TY0 A;  4KDI C;  2DWQ A;  3NZ3 A;  5LXH A;  2JWU A;  2E3T A;  2ON8 A;  3ZO5 B;  3U61 A;  3BVG A;  2IDY A;  5JXV A;  1WXQ A;  2KYW A;  2JYT A;  2BWB A;  3ZJV A;  3V6C A;  2P5T A;  2JZ3 B;  3ML9 A;  2NQ8 C;  3T3O A;  4EKU A;  1SSN A;  1R5L A;  4M02 A;  1SXJ A;  2GBN A;  4KSL C;  2X49 A;  3SMP A;  1FEH A;  1JML A;  4AG5 A;  3B89 A;  1CK1 A;  3N3K B;  2XSZ D;  1KH0 A;  1LQB A;  4I81 A;  3A4S C;  5G5H A;  5IAA C;  4XZX A;  2DOS A;  4G4O A;  2RMM A;  3PRZ A;  3F5V A;  3KFU G;  3T6P A;  3U6L A;  3A42 A;  2MBB B;  4W9K A;  5FTJ A;  2DHZ A;  1PRB A;  1F0Z A;  3UJN A;  3L28 A;  4ZHO A;  3U6C A;  5JA7 A;  3P5X A;  2VRR B;  1OJL A;  1ET9 A;  1L0Y B;  2RGF A;  5C23 A;  2V1U A;  4BOZ A;  3HZJ A;  1T5X D;  1PQS A;  5KHO A;  5ITX A;  4II2 B;  4ANV A;  1RWS A;  4GIT A;  3VDP A;  3AE5 B;  3U2S C;  1AU3 A;  2K6B A;  2FH0 A;  4JN6 A;  2R45 A;  3LXS A;  4RKX A;  3GLF A;  2KVR A;  2DC8 A;  1YSY A;  1FD6 A;  2JSV X;  1WGL A;  1B9R A;  2BB6 A;  1VRA B;  5G5G A;  3HWS A;  4OZC A;  1JRU A;  3BWK A;  2XK5 B;  2R9C A;  3PRM A;  1JWS D;  2V3S A;  3FUT A;  1CTE A;  1E9R A;  3KSX A;  4M0D A;  2BWF A;  4DHZ E;  4CO7 A;  4LFA M;  1TR8 A;  2M0A A;  3GRV A;  4FCW A;  5F02 A;  3A1Q B;  4GLS C;  4C56 C;  1YLA A;  3P4P B;  1U9X A;  2CHV A;  2DJG B;  3PLU A;  4JIO U;  1HTO A;  2KNZ A;  2FT2 A;  4GHA A;  3RGS A;  2Y3A A;  3MFG A;  2HHN A;  4BVU C;  2PE9 A;  3P2B A;  2K9X A;  1AIM A;  3IT4 B;  4XWT A;  1X9Y A;  2BVC A;  4X6H A;  3SHG B;  4WQO B;  3K2L A;  1JRP A;  5EP2 A;  2AYO B;  2HH5 A;  3IFW B;  1NSF A;  4GC5 A;  4L4U A;  2PMV A;  4L78 A;  4PP2 E;  2WXP A;  2KAN A;  4PK1 A;  1Q0W B;  1E32 A;  1DOX A;  4NC6 A;  1Q3B A;  1ZUD 2;  1DV0 A;  1OTR B;  1GJT A;  3VR8 B;  3F75 A;  2F1G A;  1VCB A;  2LNH C;  1GVN A;  2VF7 A;  1R6B X;  3TWL A;  1XMQ M;  1CQD A;  3EIE A;  2R9M A;  1D2N A;  1WX8 A;  2DYB A;  2NMQ A;  3SAR A;  4ANU A;  1WWT A;  4UN2 B;  1Y8G A;  1J7A A;  2K39 A;  1MJD A;  2JU6 X;  3GPU A;  1YN4 A;  3H1U A;  4JI3 M;  1ZOY B;  5HI1 A;  2WXM A;  4GIV A;  3HJ8 A;  3A98 B;  4ZHP A;  3KSJ A;  3U8E A;  2JPH A;  2QZ4 A;  4ITQ A;  3L29 A;  2J0M A;  4HJG E;  4L15 A;  3DOA A;  2UUA M;  2QEJ C;  3ZKJ C;  3R8B A;  3LVV A;  3NVW A;  3A33 B;  4A9A A;  4GHL A;  4K0K M;  3H6N A;  1WGN A;  4P1C C;  2RD0 A;  4RM8 A;  2CV0 A;  2F5Q A;  4WW0 A;  3I4Y A;  1C4P A;  3U4E G;  4FLH A;  3MP2 A;  4LF6 M;  3AUL A;  1ZMW A;  4MM3 B;  1OEY A;  2ERC A;  4AJY B;  4ZDV A;  1V49 A;  4FJY A;  4QRX A;  1FNV A;  2V0G A;  1KSF X;  5CVM A;  3IG3 A;  1Y56 A;  2V1C A;  5EXX A;  1QYR A;  2KLC A;  3J2P B;  4FK5 A;  4AXL A;  4BOQ A;  1T3T A;  3UGJ A;  3M62 B;  3VHT C;  3GOE A;  2CRU A;  2O01 F;  1G3I A;  2FRQ A;  1XXH E;  3P4S B;  3FUW A;  2JTC A;  2C60 A;  3DVN U;  1UF0 A;  2W9N A;  2CEA A;  2ZCB A;  1IY1 A;  1CMX B;  1EF1 A;  2MW5 A;  3T15 A;  1IBL M;  4YYS A;  2XLJ A;  1ITO A;  1NNU C;  4MEM A;  3KWL A;  5KQD A;  3P4Q B;  3PT2 B;  5HHD G;  4HEO A;  1WR1 A;  4FJV B;  2WDT B;  1P3Q Q;  4L6V 6;  2ZJD A;  3ALB A;  2FRA A;  1QOG A;  2WDQ B;  1EWY C;  4KZ0 A;  3LVW A;  2DZM A;  2R46 A;  3TMP B;  3DBL B;  3K9P B;  2LUE A;  3WXE A;  2VDB B;  4IC7 B;  1FO4 A;  5H37 D;  2DAK A;  2JY7 A;  4C7Y A;  1E8Z A;  3HHX A;  3L4P A;  3PRE A;  2JF5 A;  1O0E A;  1V5O A;  2Z0D B;  5LLI A;  3FKE A;  4FIP A;  1DGB A;  4BOU A;  4WJN A;  3RT3 B;  1XO3 A;  2BDZ A;  3L16 A;  4N59 A;  1FM0 D;  3PO0 A;  3OWE B;  1AWD A;  1NHG C;  4LNO A;  2CIO A;  2CV2 A;  1RAX A;  3W31 A;  2JWZ A;  5L8R F;  4MGY E;  4NAW A;  1T43 A;  2PRE A;  4AXM A;  1MDW A;  2JXN A;  4ZRP A;  1TKG A;  2WZJ A;  5DFL A;  2W3S A;  2UXC M;  4B7G A;  3DFZ A;  3EUB 2;  1QOL A;  2RDB C;  2L76 A;  4LNI A;  1WMH A;  3WAL A;  2W54 A;  1XLP A;  3WAM A;  3RPF C;  2KXJ A;  1WGK A;  4FA6 A;  1GLO A;  1SXT A;  2FTD A;  3CF2 A;  4B3R M;  1WGY A;  4JWS C;  2DJF B;  2E00 A;  2N0S B;  4LZZ A;  3H7D A;  4RFB A;  4NY0 A;  3NS1 A;  2Z7J A;  1POP A;  4NSO B;  2LH0 A;  4BZA A;  4KLN A;  3VTU A;  3R2T A;  2V4I B;  3ZNH B;  2DI0 A;  1UZX B;  5K16 A;  3DBL I;  4B3M M;  1L2B A;  1TH4 A;  2NBV B;  3FKY A;  3NZS A;  3AV8 A;  1IN5 A;  2PAD A;  2K9D A;  1PXV A;  3MTN A;  3PV1 A;  4HDO A;  1WRI A;  3TUO A;  3IAS 1;  3C19 A;  4R7G A;  2CV1 A;  4LF5 M;  1D5M C;  3AOE A;  3HHZ A;  4Q2J A;  1GC6 A;  3B2G A;  2L0T A;  3PHW A;  2LEK A;  2MA9 B;  2OUL A;  3VUX A;  2NQA A;  4IKG A;  4S17 A;  4DV3 M;  1AW7 A;  1L0V B;  3J7A S;  1OFI A;  2KA6 B;  2XSZ A;  2H1R A;  2BYE A;  3GLI A;  1C4C A;  5JH5 C;  2EA0 A;  1MFW A;  4K81 A;  3KOY E;  1P1A A;  4LGY A;  1E7U A;  4TV3 A;  1YQ4 B;  1YK7 A;  1MIR A;  4KGR A;  2GLS A;  4JE3 B;  2JWS A;  4LJA A;  5KHQ A;  1ORY B;  2JVC A;  1AYF A;  2LVQ A;  3BPF A;  3CIR B;  1PDX A;  2JX5 A;  2REX A;  2MJE A;  2YJ8 A;  2BW2 A;  3LYY A;  1SJH D;  3DCG A;  1TBE A;  2F5O A;  1WGR A;  3C3D A;  1L1Z A;  1IPG A;  2DEN B;  3FIL A;  4P17 A;  3VTV A;  3FUX A;  3AM9 A;  4LF7 M;  3VH4 B;  1VSN A;  4HCN B;  1ZAE A;  4BKS A;  1S4V A;  2IBI B;  2HJ1 A;  3HM3 A;  4S0R A;  2G5G X;  4MGZ E;  1FIQ A;  3K24 A;  1E7V A;  1XWI A;  2AL3 A;  2CWB A;  1TH3 A;  1LGR A;  2H5X A;  4DUZ M;  2QP9 X;  2EMS A;  4BFR A;  3B79 A;  1VDV A;  2I38 A;  1WJ4 A;  4N4Z A;  3JVZ X;  5FTL A;  2XH9 A;  1IQP A;  4GDL B;  4TMA B;  3SHF A;  2V3P A;  4A3O A;  2XN9 C;  3HX3 A;  5BYR A;  3WCQ A;  4N9F 4;  3UF8 A;  4ZRJ A;  1S3S A;  3OIS A;  1NEK B;  2WQY B;  1L7Y A;  4B95 A;  5J94 A;  3K9P A;  3PVL A;  3NZU A;  2P86 A;  2XZF A;  4RY2 A;  3CSF A;  2GNO A;  2NVU I;  1TT5 B;  5EJC A;  4A8X C;  1BP4 A;  2XEW A;  2ZNV C;  2V3N A;  3DDC B;  2IBI A;  1IXS A;  3VVW B;  3TEW A;  5E6O A;  4KT0 F;  1IGC A;  3EA6 A;  2HCB A;  3D32 A;  4GKK M;  1FJG M;  2F5N A;  1D6E C;  4ICU A;  4QHT A;  2C0Y A;  4MAC A;  2PEA A;  2YVC A;  4REZ A;  1UM8 A;  3GLG A;  1PJJ A;  1N60 A;  2MBO A;  3PZ8 A;  2KDM A;  2D7G A;  3V62 A;  4C4V B;  3W5V B;  4A55 A;  4LTU A;  3I01 M;  3JR4 A;  3ZDT A;  3OQC A;  2MHJ A;  3MC9 A;  2LVQ D;  1AUA A;  4MI7 A;  2FIF A;  3HJQ A;  2L52 A;  3B7Q A;  3GLI B;  2PE6 B;  4FHK A;  4ZPX A;  5FR6 A;  3AV0 A;  3A9J B;  4EZL A;  5MPO A;  5ITU A;  2R4E A;  1MG8 A;  4D2K A;  4M9S A;  2BWE S;  1CQV A;  4JI1 M;  2YJ9 A;  2EKI A;  3AI8 A;  4W5B A;  2XFS A;  1V1O A;  2WX1 A;  3TCA A;  5J2R A;  3SYK A;  2BPS A;  1BXT A;  4W9C A;  4XK8 F;  1QLB B;  2R9F A;  3ZGZ A;  1VEK A;  2R44 A;  2LGY A;  2HXZ A;  4IBG A;  1PVJ A;  2GOW A;  2D7H A;  2KVZ A;  3L2A A;  4FBJ B;  2L00 B;  1F4I A;  3ML8 A;  5IOI A;  2H7J A;  2R6F A;  3HKP A;  2RGH A;  3PVS A;  1N75 A;  4URK A;  1HT1 E;  1TTE A;  2J7Q C;  2DEN A;  2BDL A;  3HU3 A;  1TU6 A;  3I5J C;  3KUC B;  1A5T A;  1WXV A;  1TL9 A;  3P5W A;  3CF6 E;  2R2O A;  1NJF A;  1V86 A;  2I1J A;  3W2D A;  2Y5B B;  1GJS A;  3A9J A;  1NI3 A;  2L7I A;  4YYW A;  2O2V B;  1F29 A;  1V33 A;  3V6E A;  3RFW A;  2WXL A;  4I4L A;  2JY6 B;  3AE2 B;  2UUB M;  2NPT B;  3P63 A;  2RR9 A;  3R7R A;  2LVO A;  3HHW A;  3A1Q A;  3BCN A;  2MSE D;  2X8X X;  3GO8 A;  3LDZ E;  4J6I A;  1UBI A;  5BO4 B;  1ZCM A;  3OVX A;  2QSF X;  2PVO D;  3TIX A;  3MHZ A;  4H2A A;  3TL5 A;  1TGU A;  2JZZ A;  3A4R A;  1CPJ A;  4JI4 M;  3MJW A;  2D5G A;  1MS6 A;  4AKH A;  1UEL A;  2NBW B;  4MJS B;  2MX2 A;  1AIP C;  1FRR A;  4OU7 A;  4G4R A;  2FCQ A;  4TQ0 A;  2HHH M;  4XGA B;  1MHH E;  4X6J A;  3AMZ A;  4FAD A;  2BS3 B;  4LJ6 A;  1WI0 A;  1QOB A;  4YYU A;  2R62 A;  4BOS A;  1DF0 A;  2WXN A;  1LFD A;  1WH3 A;  3GLG B;  4MH0 E;  3I3T B;  4F8C B;  3NHE A;  2KTF A;  2DZL A;  1IY2 A;  2VQE M;  2WNM A;  3SR6 A;  1XCT L;  3WIM A;  4HCP B;  3KVW A;  1KM7 A;  2FID A;  1VJK A;  2JQR B;  5EZQ A;  4YTN B;  1XLO A;  4DR7 M;  3HVD A;  1CV8 A;  3U5Z B;  1KLV A;  2QEN A;  5LMN M;  4PAD A;  4OZB A;  2KWD A;  1TZO A;  5DYI A;  2AHM A;  1RFK A;  2AUX A;  2UZJ A;  3W30 A;  1GB4 A;  1DO2 A;  2KTR B;  3L54 A;  1XQQ A;  3NVV A;  2L7H A;  5CVN B;  1QAQ A;  3EIH A;  4F1S A;  1E8W A;  5JI2 E;  2E6X A;  5BYQ A;  2KDB A;  4JI8 M;  1K8R B;  1IBM M;  2KT7 A;  4KV2 A;  1I7H A;  2GQF A;  1ROE A;  2KX0 A;  1PUT A;  1YJI A;  2WS3 B;  3H89 A;  2KEB A;  4G3O A;  5JH3 A;  1K51 A;  3R8F A;  2ZVN A;  1GAB A;  2XEP A;  1NBF C;  3V6C B;  4YSX B;  3ZH9 B;  2B1N A;  3FRH A;  1KTK A;  3IVF A;  3BII D;  3GZN B;  2CKH B;  4P6V F;  5D6J B;  1R2Z A;  3ZDM C;  4A6Q A;  3RNV A;  4MH8 A;  1YJ1 A;  3OJ3 A;  3IHP C;  2Y5B A;  5DNY A;  1HNW M;  2XNA C;  2R0I A;  3FUU A;  1HNZ M;  4DV6 M;  1NY6 A;  4Y28 F;  2EKE C;  2DNA A;  4DR3 M;  1N33 M;  1AU2 A;  1I94 M;  3H7S A;  5G2N A;  1K53 A;  3DZD A;  2AUZ A;  1TIF A;  2K8H A;  4GB9 A;  2I7N A;  3OLM D;  3ONS A;  1MEM A;  1XKG A;  2L1A A;  2PPH A;  1XXH A;  3VRA B;  1QUT A;  1F9J A;  5E6J A;  3WAO A;  3PXG A;  4W9I A;  3H4M A;  2BKF A;  1V2Y A;  1FPY A;  1SE4 A;  2MQJ A;  4IDI A;  3AN1 A;  4CQN A;  1KFX L;  4E3C A;  1TDZ A;  4RNA A;  1HA5 A;  3D8L A;  3ECI A;  3W9C B;  3C8Y A;  2DVW B;  1KFV A;  5IKC M;  1J7K A;  1QXP A;  2BBC A;  2OOB A;  2JZP A;  3EC8 A;  3AEF B;  2Q2E B;  3DWM A;  1ME4 A;  4RMA A;  2K8B A;  2JRI A;  1JAL A;  4X66 M;  1W5S A;  2G7Y A;  4D8B A;  2CUZ A;  2FNA A;  3C0R B;  3JW0 X;  4G50 A;  3VKG A;  2KD0 A;  3M99 A;  3MOR A;  1A70 A;  3AE6 B;  2C7N B;  3VK7 A;  2KNV A;  5LMU M;  1G41 A;  1K3W A;  1BGO A;  4DR2 M;  1Y8R C;  4IJF A;  5IN7 A;  2XK5 A;  2J42 A;  5DPR A;  3P1M A;  1AYV A;  3IV2 A;  5FPW A;  2LVA A;  4MGK E;  1RM6 C;  1BQI A;  1NDD A;  1YAL A;  4BB9 A;  4GEW A;  5PAD A;  2KN5 A;  2MH8 A;  4FW9 A;  4C4V A;  3CF0 A;  2N4F A;  4MZS A;  4BOS C;  2E5L M;  2N9X A;  3VDU A;  1MHX A;  2KW0 A;  3PDF A;  1NYQ A;  5EP1 A;  4LF4 M;  4PP1 A;  5EXT A;  3JR5 A;  2UU9 M;  1L2N A;  3U6Q A;  2M56 B;  1UGJ A;  1D4B A;  2OZ2 A;  2DAJ A;  2UU7 A;  3N30 A;  1PE6 A;  2XGN A;  1QAO A;  1T6O A;  5AUK A;  2WDR B;  2KQ7 A;  2YJB A;  7CAT A;  2WSE F;  3LJ3 A;  1MX0 A;  1TS3 A;  3GP1 A;  2HTM E;  1UUP A;  3BIN A;  2E02 A;  3AE9 B;  2LHD A;  1DOY A;  3A9K B;  2MR9 A;  3N3K A;  3Q8C A;  3OVZ A;  3KFQ A;  4GDL A;  4IBB A;  2DCD A;  2WBF X;  2BJV A;  1PPD A;  4XC2 A;  2NQI A;  5TR5 A;  4Z6Y A;  4GDK B;  2JQG R;  3KOW E;  1R4M B;  3B0A A;  2IY1 B;  1UWM A;  2N7E A;  3TPZ A;  1OIP A;  2LGD A;  2LUM A;  2AS8 A;  2Z59 B;  3BYT B;  2FUG 1;  1PGY A;  3ZJU A;  4YYQ A;  3AKZ A;  2DC7 A;  2LHE A;  4W9L A;  9PAP A;  4HDQ A;  1YN3 A;  3IBE A;  2LXC A;  3O1G A;  4M00 A;  2N9E B;  1T0Y A;  2ARY A;  3B9J A;  2PBH A;  2BWE A;  1R4N B;  3P42 A;  1IP9 A;  4N8W A;  4QBB A;  3DHI C;  2K6Q A;  1IN6 A;  4ZRK A;  2C5R A;  3DVG X;  2XU3 A;  1R4G A;  3GE3 C;  4G11 A;  1TLO A;  3U60 B;  4B9K A;  3E1Z B;  3GLF E;  3N3G A;  1IN7 A;  2NPT A;  2LGX A;  3KXE C;  2IO2 B;  2KOX A;  3NVZ A;  4FN2 A;  4NQL B;  4AZF A;  5L83 A;  4PDI A;  1E9M A;  4LK0 M;  2DZY A;  4US8 A;  3A46 A;  2CB5 A;  1TYG B;  4I04 A;  1TDH A;  3B1L X;  1ZW7 A;  1I4Q A;  1TH2 A;  1IBX A;  4GIP A;  2KRK A;  4IWQ A;  4IW0 A;  1WR6 E;  2Z4S A;  4NAM A;  3M3J A;  3ZXV A;  3SBJ A;  1N36 M;  3H8C A;  1XT9 B;  4DBG B;  4MGH A;  1SJE D;  1E9S A;  2KLG A;  4KGS A;  2KC1 A;  3WAN A;  2ZAN A;  3N9Y C;  3IUT A;  3QSD A;  3W1S A;  3SD5 A;  2K0B X;  1Y08 A;  1KLU D;  3FC4 A;  3USV A;  2LXE A;  4NAW B;  5LXI B;  3BY4 A;  3UZU A;  1NY5 A;  2M60 A;  3J81 S;  3IMA A;  2JA2 A;  3GB1 A;  2HE7 A;  4NNJ B;  3VR9 B;  3ZTC A;  2MGW A;  2CP8 A;  4OX9 M;  2QJL A;  4YWG G;  2JRH A;  4LJ5 A;  2O6V B;  4HLQ A;  1GL6 A;  3NBI A;  1UD7 A;  4LJO B;  3IT6 B;  4N79 A;  2ZZP B;  1STE A;  2OOA A;  3CGW A;  1ZDV A;  1GCB A;  5EGW A;  4GN1 A;  5EE0 A;  5JHA A;  1LTM A;  5IO9 A;  2D10 A;  3GQ4 A;  2BS2 B;  3PRM B;  1FNW A;  1FH0 A;  2G8L A;  1BVS A;  3NHE B;  1KHQ A;  5ITX E;  5EDS A;  3ABV B;  2G4S A;  4IBD A;  1XNQ M;  3TE6 A;  1QKZ A;  1NO1 A;  4UDU C;  1WE6 A;  5IT9 S;  2QPA A;  2I7P A;  1VLB A;  3UIP B;  2YLM A;  2LI5 A;  4E74 A;  5FTM A;  2R4J A;  1HXY D;  2M8S A;  2VZK B;  2XU1 A;  4CDE B;  2FUH B;  3EFC A;  1YVB A;  4DR1 M;  5G55 A;  1N62 A;  2YJC A;  4I05 A;  2J0J A;  2Y5C A;  3ENE A;  4JLC A;  3FTC A;  2HAK A;  3U6O A;  4IM2 A;  4PYU A;  1PJT A;  5EP3 A;  2V4L A;  1SE3 A;  1OEY J;  3GE8 C;  5D94 A;  3DF0 A;  2AQ3 B;  2RDG A;  2CHZ A;  3KW9 A;  3MHS A;  4IWO A;  3P5V A;  4OVZ A;  2I1K A;  2K47 A;  2I2Y A;  2D11 A;  4IBI A;  3MC0 B;  1PPP A;  2QQ8 A;  4WJO A;  1E90 A;  4DXF A;  2VHF A;  3AOG A;  2B76 B;  1TS4 A;  3DBH I;  3GRU A;  2Z0E B;  2RGO A;  2DZI A;  3VFK A;  3FRI A;  2J4X A;  3Q3J A;  3RN9 C;  2WSC F;  2WWZ A;  1QIL A;  2NQG A;  1XXH B;  1QDR A;  3KWV A;  3UQB A;  2OOB B;  2N9L A;  3U8Z A;  1KJT A;  2C7H A;  1CS8 A;  3UQA A;  1IXR C;  4EFO A;  3N1Z C;  3AI5 A;  1ZV1 A;  2JP7 A;  1VG5 A;  3LMM A;  1BUI C;  2OPF A;  3QC8 B;  2CJO A;  2Y21 A;  4RGN A;  4HEA 1;  3H7P B;  3AU4 A;  4WJQ A;  2EUC A;  1PPN A;  2KN4 A;  2FNJ B;  3TSS A;  3Q8G A;  3VUW A;  1SXJ D;  1JWB D;  2EO2 A;  1XNR M;  2RRU A;  3C0R A;  1CSB B;  3K9O B;  4CYE A;  4W4U A;  3DHG C;  3B21 A;  4BPV A;  1HEZ E;  2JUJ A;  3H8B A;  4DV2 M;  2KNB A;  1HTQ A;  2YQZ A;  3LCV B;  1ZGU B;  1HJP A;  4MM3 A;  1WHC A;  2HD5 A;  3N1X C;  1IBX B;  1BML C;  1YK8 A;  3U6S A;  1Z5C A;  1WSP A;  3IFU A;  3THG A;  5IRE B;  4A90 A;  3U6E A;  2L83 A;  3ZNI D;  4XR7 A;  1PYW D;  4ZYS A;  3HUI A;  1VDL A;  3R2I A;  2WXJ A;  2GHU A;  5D2M B;  2C7M B;  3I63 C;  1H8C A;  1KOT A;  1BT0 A;  3AED B;  1C78 A;  1KRH A;  1EWO A;  3LQR A;  2IO3 B;  3MP9 A;  2FYE A;  1SB3 C;  5CHF A;  1KHP A;  4A5U A;  2FS1 A;  3DHH C;  3MHH A;  2KHH A;  2N7D A;  2W55 A;  4HPL B;  4AQ7 A;  1XCQ L;  1CB5 A;  3NS8 A;  1QMY A;  4EZJ A;  2G45 B;  2PIA A;  2O6X A;  2Z8L A;  4NJ7 A;  3BVM A;  3QWZ B;  2LHC A;  1YZB A;  1WIA A;  1IYF A;  2QCZ A;  4MSM B;  1PFD A;  3RE8 A;  1Q39 A;  3J7B A;  3VTW A;  4GRI A;  4D81 A;  3A9K A;  1IGD A;  2PTL A;  2HKJ A;  2LBC A;  3DBR I;  2LTU A;  5EF4 A;  4HLE A;  2HJ8 A;  4AQY M;  4IBJ A;  4LF8 M;  3HRD D;  3Q8F A;  1PBH A;  5ITT A;  1TJE A;  4J3O D;  4JX1 C;  1XC8 A;  2OJW A;  4TKN A;  2YEP B;  4KKJ A;  1B1Z A;  2RDH A;  3PGE A;  4ZRQ A;  5DPT A;  5AZG A;  4B0M A;  2KDI A;  1HE8 A;  1E0Z A;  5J18 A;  2XBB C;  3H6S A;  3MHV C;  3N32 A;  1L5P A;  1NPZ A;  3ZJT A;  5C18 A;  1EIJ A;  2FCN A;  3U6P A;  3SAT A;  2SEB D;  4X65 M;  2IO0 B;  5AUI A;  4ZUX U;  2QIL A;  1YJJ A;  2FBW B;  3FYD A;  1CJE A;  3I4V A;  2DAM A;  5L95 C;  2FAZ A;  3RFZ B;  2QMT A;  4YSY B;  4Q8G A;  1EWM A;  4I8O A;  2FFJ A;  2N35 A;  4CZW A;  4DBG A;  1FNU A;  1DO0 A;  1G4A E;  1H6U A;  2LRU A;  4HKQ A;  4QNM A;  1JB0 F;  1DKI A;  2KQS A;  3ZQ4 A;  3H9D A;  5CX3 A;  2KKC A;  4DMY A;  3UK6 A;  2MBE A;  3AXC A;  4NXM M;  4XYC A;  3AJI B;  5DPS A;  1J19 A;  1AU4 A;  3ZUA A;  3SHQ A;  3RYT A;  1P98 A;  4ZRI A;  2KJH B;  4KGT A;  3FYC A;  3CST A;  1WXM A;  4Q8H A;  2XU4 A;  4K3B A;  3CBJ A;  3DVN V;  3GLH E;  3VFD A;  4RGM A;  2DZO B;  1KLG D;  3BWU D;  3PW3 A;  2M5Z A;  3T38 A;  2AX5 A;  2KXE A;  3C58 A;  8CAT A;  1L0X B;  1WX9 A;  4ASW C;  1SP4 B;  4RH6 A;  4R71 A;  2X38 A;  1WGG A;  3KVF B;  3T1H M;  1GUA B;  5HKH A;  2VZK D;  2Q5W D;  4X64 M;  2M1M A;  4CHK A;  3MC8 A;  3H8H A;  1IY0 A;  4K7W A;  8PCH A;  2DCB A;  2DCA A;  1L4D B;  2CU3 A;  3PTF C;  2LWX A;  4HPM B;  4IOI E;  2MP2 B;  1S3S G;  4MSQ B;  3MMP A;  2CR5 A;  2ZVO A;  3J80 S;  2J53 A;  2NTS A;  2WXQ A;  2B3T A;  3FE3 A;  3Q8X A;  1VEG A;  1RFA A;  3Q8B A;  4OEM A;  4BBN F;  1MHW A;  4QOS A;  4MT5 A;  3BB7 A;  2LVO C;  3CWI A;  4DHJ B;  4JPS A;  4FXC A;  1VEJ A;  3UI3 A;  3KDS E;  5CTR C;  1WZ0 A;  3BC3 A;  5C1Z A;  4I07 A;  2L4E A;  3AOE C;  3ZCB B;  3GQ3 A;  1R4M I;  2B1M A;  3C3E A;  4EE2 A;  5D3I B;  4YV8 A;  1PGA A;  1TKE A;  3J9C A;  4A3V B;  1VJV A;  2AYN A;  2R9N A;  2N1W A;  2CHG A;  2PJH A;  3HIZ A;  2RKO A;  3OF8 A;  1Z5A A;  4AG6 A;  4KIK B;  3VK8 A;  4S12 A;  1WJ6 A;  4GDK A;  2G3Q A;  3SAU A;  3GZN I;  3L27 A;  1ISN A;  1IM2 A;  1Q3C A;  3LCU A;  1ET6 A;  4LDT B;  1MJG M;  4WP2 A;  3PNR A;  2WSF F;  2RPQ A;  3Q69 A;  5FKA C;  3HU1 A;  1PJS A;  3LB8 C;  2C9C A;  3I9V 1;  3SAW A;  4FJZ A;  1JQJ C;  2EEL A;  3RVV A;  3KYC D;  2YJ2 A;  3RZW C;  2DBY A;  1C77 A;  4G3X B;  1K82 A;  2QCU A;  2IPP B;  4OVU A;  1PGX A;  4EOY A;  2AGA A;  2W82 A;  4IBK A;  1N34 M;  2GRI A;  1NEN B;  1E94 E;  2YNM D;  1L2C A;  1F52 A;  2LVP A;  3EFU A;  1TZ1 A;  2E01 A;  3NBX X;  1LV7 A;  4K7U A;  1D5X C;  1SE2 A;  2XF3 A;  3NVY A;  2WU2 B;  4GKJ M;  2MJ5 B;  3MK6 A;  3ERV A;  1PJQ A;  4WWO A;  1EM7 A;  2LGI A;  2OHF A;  4DV5 M;  3FTE A;  4GSW A;  4BKG A;  4OW0 A;  2DAE A;  5AZH A;  3WAP A;  1OAO C;  2WYQ A;  2OJR A;  3L26 A;  1WM2 A;  2VH1 A;  3QAQ A;  2QDF A;  3SAS A;  1ENF A;  4FJC A;  5KPT A;  1L4Z B;  2KDF B;  2K3U A;  1MI0 A;  3DQV A;  1FFV A;  2EKF A;  3URY A;  5JHB A;  3TNX A;  4OEL A;  4KZC A;  2DWL A;  2WXR A;  2WXI A;  2DHY A;  2LFI A;  2AL6 A;  1TY2 A;  2J7Q A;  1IN4 A;  3KP0 E;  1VR9 A;  2CFO A;  4IWP A;  3V61 A;  4WAA A;  1J7C A;  5FTK A;  2DAF A;  4G4Q A;  2C9O A;  1EFU B;  2O6V A;  1DGH A;  2O2V A;  1CZP A;  4NL4 H;  4MJS A;  1JW9 D;  4ARC A;  4AJW A;  1NVI D;  2AQ2 B;  4F7Z A;  2KMC A;  3L0W B;  1K52 A;  4QAY A;  2OO9 A;  1QDQ A;  3QYE A;  4QRV A;  4D8I A;  3HY5 A;  2GBR A;  3SYL A;  3V6E B;  1HQY E;  1N6Z A;  1X37 A;  4YY3 M;  3NOB A;  4C00 A;  1JQ4 A;  4P7I A;  4W9D A;  1NNJ A;  1WM3 A;  1E5W A;  3RVW A;  4BBA A;  2NCN A;  4GUA A;  5EZS A;  2K1F A;  2QSD A;  1JWU D;  1GNU A;  3B08 A;  4BS6 A;  1PAD A;  1T0R C;  2KFK B;  4HXD B;  3KW5 B;  4L16 A;  4MEL A;  4GH9 A;  3AEC B;  1GMY A;  4MSX A;  3WXF A;  2KQ4 X;  3P4R B;  3WHK A;  3QYB A;  1NJG A;  2LXA A;  4HRS A;  4I6N B;  3OF9 A;  4JI7 M;  4CGY B;  3KKU A;  3U7D A;  1R2Y A;  4IM3 A;  4XZ4 A;  3ZNZ B;  5IA7 A;  2DWZ B;  2QHO B;  3ZNH A;  2MH7 A;  3KLS X;  4WUR A;  3C9P A;  4LJ7 A;  3W1Y A;  4FD2 A;  1LXD A;  5GMV A;  3SFE B;  1U5I A;  4O1N A;  4LFC M;  2DCC A;  5DYG A;  1YX5 B;  3BZD B;  2C99 A;  2DHR A;  3RZF A;  1U9W A;  3IOQ A;  3ZRF A;  1I4W A;  1IXZ A;  1NV8 A;  3NWL A;  3VDZ A;  2KWC A;  3SAV A;  3W0F A;  4W9G A;  1L2D A;  4KLB A;  2M17 A;  1DGG A;  4D82 A;  2FE8 A;  2YR0 A;  2L32 A;  2V1Y A;  4TUU A;  4C7Z A;  4EZK A;  1ESF A;  3QK0 A;  1IXS B;  1G6J A;  2YEP F;  5BMI A;  4G54 A;  1WRD B;  2IYD B;  3EHV A;  1D5Z C;  1FCL A;  1NV9 A;  2BGF A;  2KMA A;  2M19 A;  5JZE B;  1ZE3 D;  5EE1 A;  3QHT A;  4KSK C;  1TKY A;  4PS7 A;  4FUL A;  2F5P A;  1EU3 A;  1XB2 B;  3N20 C;  3ILK A;  4DR6 M;  3W5U B;  3I3T A;  2K8C A;  4MDK E;  3N4C A;  2O25 A;  2DWM A;  2DXI A;  4OVV A;  3GPP A;  4L1B A;  4AS1 A;  2N9P C;  3QA8 A;  4LDT D;  1G59 A;  3TL4 X;  3Q8A A;  4CIS A;  1WJN A;  3KUD B;  4JI6 M;  1I35 A;  2DC9 A;  3EGR A;  5AZF A;  1U9V A;  4ACF A;  3EEC A;  1ME3 A;  5BPV A;  4CDF B;  2QC8 A;  3PHX B;  1P0R A;  1HUC B;  3HHY A;  3U5Z A;  2Z84 A;  3HHM A;  3KWZ A;  2BB5 A;  1T3Q A;  3WXG A;  3LFY A;  2PVG C;  4CDC B;  3J27 B;  4FVM A;  2O5R A;  4AKI A;  3HVZ A;  3R3M A;  4OHJ A;  1L8Q A;  2MJ3 A;  1V80 A;  3RD2 A;  4WIP A;  5H92 C;  4GMV A;  1N32 M;  3ZQJ A;  4IBC A;  3T3N A;  1MEG A;  1HR0 M;  1NVM A;  3U61 B;  2ICI A;  3VH3 B;  3JYU A;  1DGJ A;  2KX3 A;  5I4D A;  1I4R A;  3PRP A;  4QHS A;  1GO5 A;  1XHB A;  1P9D U;  1AN8 A;  2BYV E;  3DBH B;  1WXA A;  2AIM A;  1Z6T A;  2BYT A;  1EWC A;  1ZKH A;  3BK1 A;  3E56 A;  1UWX A;  1TGZ B;  5E6P A;  2V9H A;  3AEE B;  3C9E A;  2AQ1 B;  3BYY B;  4XX5 A;  2LAS A;  2WXG A;  1NI2 A;  4A20 A;  5KPZ A;  4BLC A;  2JRI B;  3AE8 B;  2JXT A;  4QOZ C;  3N1Y C;  4W9E A;  2O6V D;  4BAX A;  3CH2 X;  4JV5 M;  2WU5 B;  1SXJ C;  2GMI C;  3GLH A;  3DWG C;  2XFT A;  4NQK E;  1OGW A;  2LMC A;  2ZNV B;  3QAU A;  2CJN A;  1GB1 A;  4NZL B;  4TUW A;  4WAF A;  3FUV A;  2BTW B;  2R6N A;  3JAM S;  2JT4 B;  2LRW A;  3VKH A;  1L1T A;  3B7Z A;  4NPN A;  1PPO A;  2R2Q A;  2E03 A;  3PSE B;  4W9F A;  2KAJ A;  3T8M A;  3APC A;  3L25 A;  2C98 A;  2MP2 A;  4YYR A;  3HU2 A;  2DAG A;  3RNG C;  1V6E A;  2W3R A;  2P7U A;  3UIO B;  3HHA A;  1AEC A;  3U60 A;  2LWP A;  4XUI A;  2UXD M;  1H4R A;  4AOF A;  3HWN A;  2ZPY A;  2H89 B;  5T8I A;  1FXI A;  1WXS A;  1GPX A;  1NB3 A;  2L3Z A;  4EUT A;  5CHV A;  4IUM B;  1V97 A;  3TJP A;  4DR4 M;  3L13 A;  4D80 A;  3PNY A;  4HWY A;  3BOS A;  3AH7 A;  4LCD E;  3ZW3 A;  3GPY A;  4AKG A;  3IEC A;  1JR3 E;  3VRB B;  1CVZ A;  2WXK A;  1Z5S B;  3B9P A;  3A45 A;  3PSE A;  3K92 A;  1F2B A;  2G9H D;  3KW6 A;  2KHW B;  4PCZ A;  1JWA D;  3LW5 F;  1YIW A;  2DZK A;  2D7E A;  4YTP B;  2IND C;  7PCK A;  1QOF A;  3AU5 A;  2WLB A;  4LY6 A;  3PHX A;  3ZRC A;  3BK2 A;  2N9K A;  2WX0 A;  3VXW A;  4K7C A;  1PIP A;  2LVP C;  4BSQ A;  3NUH B;  1HT2 E;  3IHP A;  3HD3 A;  2QNJ A;  1GKI A;  1QT9 A;  1V81 A;  3M0E A;  4GC9 A;  3Q6B A;  1IWD A;  1STF E;  3UMM A;  3U7Z A;  4E71 A;  1KFU L;  4PI3 A;  3RVX A;  2VHS A;  2MBQ A;  1PM5 A;  3S2A A;  1YX6 B;  4YHH M;  1TS5 A;  3RMK C;  2KK8 A;  4IBE A;  1M94 A;  2G6D A;  3ZUN A;  3QAR A;  3GQ5 A;  3AE3 B;  4GGQ A;  2AEH A;  2C96 A;  3VUY A;  1NLJ A;  4HWI B;  2K6D B;  1E6E B;  2OED A;  5FR3 A;  1YUB A;  2KMM A;  5A2Q S;  4USA A;  1JRO A;  2EMT A;  4PS3 A;  3V05 A;  5JI3 E;  5ITR A;  3Q8E A;  4MB7 A;  1SE9 A;  1OFF A;  2D3B A;  2G3Q B;  3OTO M;  1FNN A;  1SXJ B;  3M7G A;  4JGH B;  1FCC C;  1AYU A;  4WJP A;  1F1H A;  2GBK A;  4DWF A;  5E26 A;  5AEK B;  1K3X A;  1YQB A;  1RRB A;  3O65 A;  3S3R A;  2KZR A;  1DOI A; 
#chains in the Genus database with same CATH homology
 2Y0Q A;  4XDC A;  3K8Z A;  1GLN A;  1JR3 A;  1YN5 A;  4KKI A;  4B0E A;  2VII A;  4KOD A;  2F5S A;  4M0W A;  1VZ7 A;  2IGG A;  1HQC A;  3KS8 A;  4WWM A;  3O13 A;  3ZC7 B;  1UKF A;  3FTD A;  1C9F A;  2V6Z M;  1FXA A;  1KF6 B;  1UNS A;  3KP1 E;  4L23 A;  5EXS A;  2NTT A;  3V3X A;  1ZXI A;  2J7N A;  4IJE A;  4M9X A;  1P7E A;  5H8Y E;  4FWG A;  1PGB A;  2JYE A;  1GAQ B;  1SIJ A;  3TRK A;  4NXN M;  2KZU A;  5HG2 A;  2PKO A;  2IJ0 A;  2KRU A;  2Z3X A;  1I4P A;  4B3T M;  3KS4 A;  4DV4 M;  1JWM D;  5EE3 A;  1DGH B;  3IAM 1;  3AEA B;  2HL7 A;  4HKZ E;  2DZN B;  3SMS A;  4DQO C;  1QVR A;  2ZW0 A;  3TQS A;  4YTM B;  3I57 A;  2CE7 A;  1KFY B;  1LO5 D;  2TSS A;  5IWA M;  4B08 A;  5EE9 A;  4JWU C;  4WH4 A;  4LRS A;  1N63 A;  4DUY M;  4HRO A;  2VQF M;  1MPE A;  2BTE A;  2A5Y B;  2R65 A;  2CHQ A;  3IXS A;  5FLX S;  4C80 A;  2BS4 B;  3R9X B;  4NOO B;  5EP4 A;  4ZTB A;  4NRV A;  4NJC A;  3QWL A;  2Y0T A;  3PT2 A;  2WXF A;  1YMH E;  5ITY A;  4LG2 A;  1OQQ A;  3SFZ A;  3VQI A;  3ETR A;  1I4G A;  4LZJ A;  2X8A A;  4QNR A;  3SFD B;  4FWH A;  1FMA D;  2QBY B;  4LGM A;  5LNK 1;  2ZW1 A;  2BJW A;  1XEE A;  1IUE A;  1SXJ E;  2BNK A;  2ZAO A;  1N78 A;  5FSW A;  2LJI A;  1GOZ A;  4B7H A;  3FIL B;  5D7G A;  3MTV A;  2HWK A;  2SAK A;  4ARI A;  1N5X A;  2ACZ B;  4OZA A;  1VZ8 A;  3HGI A;  4TSS A;  3GRY A;  1G8P A;  4KO8 A;  3SEB A;  2Z4R A;  4NSR A;  1HNX M;  4N6E B;  4BOP A;  1IN8 A;  1W5T A;  3SC3 A;  4FCV A;  1SEB D;  3GS2 A;  3PZ7 A;  1Q10 A;  4KHP M;  1QAM A;  1MVK A;  4RF0 A;  5BMH A;  1QQR A;  1ZDX A;  1ZXH A;  1L6U A;  5GXG B;  5F3W A;  1I4X A;  4YT0 B;  4TQ1 A;  4DV0 M;  2K22 A;  4RGT A;  2KAC A;  4WQM A;  2BTW A;  2HDE A;  1TS2 A;  4B3S M;  1XMO M;  2WXH A;  3AEB B;  3TEX A;  3HJS A;  4JYA M;  1L6V A;  2INN E;  3MJ5 A;  1J5E M;  3AE1 B;  4DV7 M;  4ITK A;  1YE9 A;  1WYG A;  2IGD A;  4CHT B;  4G4N A;  2RPV A;  5KQ8 A;  1RYJ A;  2H88 B;  2UUC M;  1GL7 A;  1FRD A;  1OQR A;  4II7 A;  4LRT A;  4FWD A;  3M6A A;  1DYQ A;  4L8R C;  1QZM A;  5KPR A;  4LJ4 A;  3TWK A;  1N61 A;  2K0P A;  3D8B A;  5GKN A;  3GRR A;  1NHW C;  4EIW A;  2J52 A;  4DXG A;  4LFB M;  4I5S A;  3TEZ A;  1HZ6 A;  1ZP0 B;  2ZM6 M;  1E10 A;  1EU4 A;  3LXF A;  4IP3 A;  2YFQ A;  2DWN A;  1F2R C;  5HFY A;  1F2R I;  2IPK D;  2F4V M;  5EQT A;  5JZE A;  5KO3 A;  3TMP A;  4L2Y A;  1EE8 A;  4ZOH C;  3TEY A;  2WP9 B;  2WXO A;  5FTN A;  4AI6 A;  3AB5 A;  3AFH A;  3PFI A;  3B2F A;  1Z5B A;  4YXD B;  1V8C A;  5BYS A;  1XXG A;  5EXP A;  3T1Y M;  2R18 A;  3RGP A;  1SF0 A;  1DGF A;  3BBA A;  2Y20 A;  4YSZ B;  4Z8X A;  4AW4 A;  3CTW B;  4XE0 A;  3K1J A;  2XZU A;  1R7S A;  1XLQ A;  2X4A A;  1T6B X;  5C2T B;  3AEG B;  4IUM A;  2K5P A;  4PT5 A;  3FAH A;  1F77 A;  4B7F A;  1OFH A;  1QAN A;  4LF9 M;  5BMG A;  1C4A A;  1ACC A;  4D8E A;  4R3D A;  3IG8 A;  4G6Z A;  3FTF A;  3PNV A;  1K50 A;  1MU5 A;  4P16 A;  5FK9 C;  3GPX A;  4XWW A;  3W0L B;  4RCO A;  5TSS A;  1V1P A;  3E9S A;  4RF1 A;  3AL0 C;  1XF5 L;  1HZ5 A;  3GLH B;  2WDV B;  4XDD A;  4OVZ B;  4LJ9 A;  3GP7 A;  2KZS A;  3NRZ A;  5C3J B;  1N77 A;  4NRW A;  2QBY A;  5IZ7 D;  3U6D A;  1FFU A;  1M4V A;  1VDD A;  3U52 E;  1YNT E;  2GI9 A;  2R61 A;  1J09 A;  4IBF A;  1XLN A;  4RGO S;  1Z59 A;  2ONQ A;  3KQ4 A;  2MJD A;  2PLP A;  2L6O A;  1HQR D;  2G1E A;  2DYM A;  1I4H A;  2GB1 A;  4JXJ A;  2BT6 A;  4X62 M;  2L09 A;  4IIW A;  4XGI A;  2FOI C;  2MEK A;  2UXB M;  4M9Z A;  2OQ4 A;  3GLF B;  2IGH A;  3AE4 B;  4US9 A;  3I51 A;  1QOA A;  4JI0 M;  3ZYY X;  2DLB A;  3IG5 A;  3TWM A;  3KOX E;  1J7B A;  4FCT A;  4JI5 M;  1N5W A;  1JR3 D;  2ZBK B;  1NYR A;  5ITQ A;  4JI2 M;  3AE7 B;  3DA1 A;  1KYI A;  5BR8 M;  4LLG M;  1QF6 A;  4LCB A;  4PDG A;  2N7J A;  1QQW A;  1IBK M;  1V1P B;  4LJ8 A;  2J7O A;  1C76 A;  1PJI A;  3U6M A;  1C1K A;  5C1B A;  2Y5P A;  1C79 A;  1VZ6 A;  2BU3 A;  4XBO A;  4GMQ A;  2DYO A;  5D3D A;  4DV1 M;  2INP E;  3WHL A;  4MGI E;  4N58 A;  3FD9 A;  4HL4 A;  2QIE B;  4W5W A;  2ZAM A;  1R7R A;  3PHU A;  3VLF B;  4KX6 B;  1E7P B;  3KOZ E;  3LQQ A;  1JCK B;  1P7F A;  1SBB B;  2PW9 A;  3E4R A;  1ZQ9 A;  3BVZ A;  4DR5 M;  4PD2 A;  1ZPS A;  1YQ3 B;  1TY0 A;  2DWQ A;  3NZ3 A;  2JWU A;  2E3T A;  2ON8 A;  3U61 A;  3BVG A;  2IDY A;  5JXV A;  1WXQ A;  2JYT A;  3ZJV A;  2P5T A;  2NQ8 C;  3T3O A;  1SSN A;  1SXJ A;  2X49 A;  3SMP A;  1FEH A;  1JML A;  4AG5 A;  1CK1 A;  2XSZ D;  1KH0 A;  4I81 A;  5G5H A;  4XZX A;  2DOS A;  4G4O A;  2RMM A;  3KFU G;  3U6L A;  3A42 A;  5FTJ A;  1F0Z A;  3UJN A;  3L28 A;  4ZHO A;  3U6C A;  1OJL A;  1ET9 A;  1L0Y B;  2V1U A;  4BOZ A;  1T5X D;  5ITX A;  1RWS A;  4GIT A;  3VDP A;  3AE5 B;  3U2S C;  4JN6 A;  2R45 A;  4RKX A;  3GLF A;  1YSY A;  1FD6 A;  2JSV X;  1B9R A;  2BB6 A;  1VRA B;  5G5G A;  3HWS A;  4OZC A;  3PRM A;  1JWS D;  3FUT A;  1E9R A;  3KSX A;  4M0D A;  4LFA M;  2M0A A;  3GRV A;  4FCW A;  4GLS C;  4C56 C;  3P4P B;  2CHV A;  4GHA A;  3RGS A;  2Y3A A;  3MFG A;  2K9X A;  3IT4 B;  4XWT A;  3SHG B;  3K2L A;  1JRP A;  5EP2 A;  1NSF A;  4GC5 A;  4L4U A;  2PMV A;  4L78 A;  2WXP A;  1E32 A;  1DOX A;  1Q3B A;  1ZUD 2;  3VR8 B;  1GVN A;  2LNH C;  3TWL A;  1R6B X;  1XMQ M;  3EIE A;  1D2N A;  2NMQ A;  3SAR A;  1WWT A;  1J7A A;  2JU6 X;  3GPU A;  1YN4 A;  4JI3 M;  1ZOY B;  5HI1 A;  2WXM A;  3HJ8 A;  3A98 B;  4ZHP A;  3KSJ A;  2QZ4 A;  4ITQ A;  3L29 A;  4HJG E;  4L15 A;  3DOA A;  2UUA M;  2QEJ C;  3R8B A;  3LVV A;  3NVW A;  4A9A A;  4GHL A;  4K0K M;  2CV0 A;  2F5Q A;  4WW0 A;  3I4Y A;  1C4P A;  3U4E G;  3MP2 A;  4LF6 M;  4MM3 B;  2ERC A;  1FNV A;  2V0G A;  1KSF X;  1Y56 A;  2V1C A;  5EXX A;  1QYR A;  3J2P B;  4BOQ A;  1T3T A;  3UGJ A;  1G3I A;  3P4S B;  3FUW A;  2JTC A;  2CEA A;  1IY1 A;  3T15 A;  1IBL M;  2XLJ A;  1NNU C;  3KWL A;  5KQD A;  3P4Q B;  5HHD G;  1QOG A;  2WDQ B;  1EWY C;  3LVW A;  2R46 A;  1FO4 A;  5H37 D;  4C7Y A;  3HHX A;  3L4P A;  3FKE A;  1DGB A;  4BOU A;  1XO3 A;  4N59 A;  1FM0 D;  3PO0 A;  3OWE B;  1AWD A;  1NHG C;  2CV2 A;  3W31 A;  4MGY E;  4ZRP A;  1TKG A;  2W3S A;  2UXC M;  4B7G A;  3DFZ A;  3EUB 2;  2W54 A;  1XLP A;  3RPF C;  1WGK A;  1SXT A;  3CF2 A;  4B3R M;  4JWS C;  2N0S B;  4LZZ A;  4RFB A;  3NS1 A;  2Z7J A;  4NSO B;  2LH0 A;  4KLN A;  3R2T A;  2V4I B;  4B3M M;  1L2B A;  1TH4 A;  3AV8 A;  1IN5 A;  1WRI A;  3TUO A;  3IAS 1;  4R7G A;  2CV1 A;  4LF5 M;  1D5M C;  3AOE A;  3HHZ A;  4Q2J A;  3PHW A;  3B2G A;  2LEK A;  4IKG A;  4DV3 M;  1AW7 A;  1L0V B;  3J7A S;  1OFI A;  2KA6 B;  2XSZ A;  2H1R A;  3GLI A;  1C4C A;  2EA0 A;  3KOY E;  4LGY A;  1YQ4 B;  4KGR A;  4JE3 B;  4LJA A;  1ORY B;  1AYF A;  3CIR B;  1PDX A;  2JX5 A;  2MJE A;  3LYY A;  2BW2 A;  1SJH D;  2F5O A;  1L1Z A;  3FIL A;  3FUX A;  3AM9 A;  4LF7 M;  1ZAE A;  2G5G X;  4MGZ E;  1FIQ A;  1XWI A;  1TH3 A;  4DUZ M;  2QP9 X;  1VDV A;  2I38 A;  5FTL A;  2XH9 A;  1IQP A;  4GDL B;  4TMA B;  3SHF A;  2V3P A;  2XN9 C;  5BYR A;  3WCQ A;  1S3S A;  1NEK B;  2WQY B;  2XZF A;  4A8X C;  5EJC A;  2V3N A;  3TEW A;  1IGC A;  3EA6 A;  2HCB A;  4GKK M;  1FJG M;  2F5N A;  1D6E C;  4QHT A;  4MAC A;  4REZ A;  1UM8 A;  3GLG A;  1PJJ A;  1N60 A;  3PZ8 A;  2KDM A;  2D7G A;  3W5V B;  4A55 A;  4LTU A;  3JR4 A;  3OQC A;  4MI7 A;  3HJQ A;  2L52 A;  3GLI B;  4ZPX A;  3AV0 A;  5MPO A;  5ITU A;  2R4E A;  4D2K A;  4M9S A;  1CQV A;  4JI1 M;  2EKI A;  2XFS A;  1V1O A;  3SYK A;  1BXT A;  1QLB B;  3ZGZ A;  4IBG A;  1PVJ A;  2D7H A;  3L2A A;  3HKP A;  2RGH A;  3PVS A;  1N75 A;  2J7Q C;  1HT1 E;  3HU3 A;  3CF6 E;  1NJF A;  3W2D A;  1NI3 A;  2L7I A;  3RFW A;  2WXL A;  4I4L A;  3AE2 B;  2UUB M;  3P63 A;  3HHW A;  3GO8 A;  2PVO D;  3MHZ A;  4H2A A;  1TGU A;  4JI4 M;  2D5G A;  4AKH A;  1FRR A;  4OU7 A;  4G4R A;  4TQ0 A;  2HHH M;  1MHH E;  3AMZ A;  2BS3 B;  4LJ6 A;  1QOB A;  2R62 A;  4BOS A;  2WXN A;  3GLG B;  4MH0 E;  1IY2 A;  2VQE M;  2WNM A;  3SR6 A;  1XCT L;  3KVW A;  1VJK A;  2JQR B;  5EZQ A;  4YTN B;  1XLO A;  4DR7 M;  3HVD A;  3U5Z B;  2QEN A;  5LMN M;  4OZB A;  2KWD A;  1TZO A;  5DYI A;  2AHM A;  1RFK A;  2UZJ A;  3W30 A;  1GB4 A;  1DO2 A;  3NVV A;  2L7H A;  1QAQ A;  3EIH A;  5JI2 E;  2E6X A;  5BYQ A;  4JI8 M;  1IBM M;  1I7H A;  1ROE A;  1PUT A;  1YJI A;  2WS3 B;  2KEB A;  3R8F A;  1K51 A;  4YSX B;  2XEP A;  3ZH9 B;  1KTK A;  3BII D;  4P6V F;  1R2Z A;  4A6Q A;  3RNV A;  4MH8 A;  5DNY A;  1HNW M;  2XNA C;  3FUU A;  1HNZ M;  4DV6 M;  1NY6 A;  4DR3 M;  1N33 M;  1I94 M;  1K53 A;  3DZD A;  2I7N A;  2L1A A;  1XXH A;  3VRA B;  5E6J A;  3PXG A;  3H4M A;  1SE4 A;  4IDI A;  3AN1 A;  4CQN A;  1TDZ A;  4RNA A;  1HA5 A;  3D8L A;  3W9C B;  3C8Y A;  2DVW B;  1KFV A;  1J7K A;  2BBC A;  2JZP A;  3AEF B;  2Q2E B;  3DWM A;  2JRI A;  1JAL A;  4X66 M;  1W5S A;  4D8B A;  2CUZ A;  2FNA A;  3VKG A;  1A70 A;  3AE6 B;  3VK7 A;  5LMU M;  1G41 A;  1K3W A;  4DR2 M;  4IJF A;  2J42 A;  3P1M A;  4MGK E;  1RM6 C;  4BB9 A;  4FW9 A;  3CF0 A;  2E5L M;  3VDU A;  1MHX A;  2KW0 A;  1NYQ A;  5EP1 A;  4LF4 M;  5EXT A;  3JR5 A;  2UU9 M;  3U6Q A;  2M56 B;  1UGJ A;  1D4B A;  2XGN A;  1QAO A;  5AUK A;  2WDR B;  7CAT A;  1MX0 A;  1TS3 A;  3GP1 A;  2HTM E;  1UUP A;  3AE9 B;  2LHD A;  1DOY A;  3Q8C A;  4IBB A;  2BJV A;  4Z6Y A;  4GDK B;  3KOW E;  1UWM A;  3TPZ A;  2LUM A;  3BYT B;  2FUG 1;  3ZJU A;  3AKZ A;  2LHE A;  1YN3 A;  3B9J A;  3P42 A;  1IN6 A;  2C5R A;  3U60 B;  1IN7 A;  3KXE C;  3NVZ A;  4AZF A;  4PDI A;  1E9M A;  4LK0 M;  4US8 A;  3A46 A;  1TYG B;  1TDH A;  1I4Q A;  1TH2 A;  1IBX A;  4GIP A;  2KRK A;  2Z4S A;  4NAM A;  3SBJ A;  1N36 M;  4MGH A;  1SJE D;  1E9S A;  4KGS A;  2ZAN A;  3N9Y C;  3W1S A;  1KLU D;  3FC4 A;  2LXE A;  4NAW B;  3BY4 A;  3UZU A;  1NY5 A;  2M60 A;  3J81 S;  2JA2 A;  3GB1 A;  3VR9 B;  4OX9 M;  2QJL A;  4YWG G;  4LJ5 A;  4HLQ A;  1GL6 A;  3NBI A;  3IT6 B;  1STE A;  1ZDV A;  5EE0 A;  3GQ4 A;  2BS2 B;  1FNW A;  2G8L A;  5ITX E;  3ABV B;  4IBD A;  4UDU C;  3TE6 A;  1XNQ M;  1QKZ A;  5IT9 S;  2QPA A;  2I7P A;  1VLB A;  5FTM A;  2R4J A;  1HXY D;  2VZK B;  4DR1 M;  1N62 A;  2Y5C A;  3FTC A;  3U6O A;  5EP3 A;  1SE3 A;  2AQ3 B;  2RDG A;  4OVZ A;  2I2Y A;  2K47 A;  4IBI A;  3MC0 B;  4DXF A;  3AOG A;  2B76 B;  1TS4 A;  3GRU A;  2RGO A;  2J4X A;  1QIL A;  1XXH B;  3KWV A;  2N9L A;  1IXR C;  3LMM A;  1BUI C;  2OPF A;  2CJO A;  2Y21 A;  4RGN A;  4HEA 1;  2EUC A;  2KN4 A;  3TSS A;  1SXJ D;  1JWB D;  2EO2 A;  1XNR M;  3C0R A;  3B21 A;  1HEZ E;  4DV2 M;  2YQZ A;  1IBX B;  1BML C;  3U6S A;  1Z5C A;  1WSP A;  3IFU A;  3THG A;  5IRE B;  4A90 A;  3U6E A;  2L83 A;  1PYW D;  4ZYS A;  3HUI A;  3R2I A;  2WXJ A;  3AED B;  1C78 A;  1KRH A;  3LQR A;  3MP9 A;  1SB3 C;  4A5U A;  2W55 A;  4AQ7 A;  1XCQ L;  2PIA A;  2Z8L A;  3BVM A;  1YZB A;  1PFD A;  3RE8 A;  1Q39 A;  3J7B A;  4GRI A;  4D81 A;  1IGD A;  2PTL A;  2HKJ A;  4AQY M;  4IBJ A;  4LF8 M;  3HRD D;  3Q8F A;  4JX1 C;  4J3O D;  5ITT A;  1TJE A;  1XC8 A;  2YEP B;  4KKJ A;  1B1Z A;  2RDH A;  4ZRQ A;  4B0M A;  1E0Z A;  3MHV C;  1L5P A;  3ZJT A;  5C18 A;  3U6P A;  3SAT A;  2SEB D;  4X65 M;  5AUI A;  2QIL A;  1YJJ A;  2FBW B;  3FYD A;  1CJE A;  3I4V A;  3RFZ B;  2QMT A;  4YSY B;  4I8O A;  2FFJ A;  1FNU A;  1DO0 A;  1G4A E;  1H6U A;  4HKQ A;  4QNM A;  1DKI A;  3ZQ4 A;  3UK6 A;  4NXM M;  3AJI B;  4KGT A;  3FYC A;  3VFD A;  4RGM A;  2DZO B;  1KLG D;  3BWU D;  2M5Z A;  3T38 A;  2AX5 A;  2KXE A;  3C58 A;  8CAT A;  1L0X B;  4RH6 A;  2X38 A;  3T1H M;  2VZK D;  2Q5W D;  4X64 M;  3H8H A;  1IY0 A;  1L4D B;  2CU3 A;  2LWX A;  4IOI E;  3J80 S;  2J53 A;  2NTS A;  2WXQ A;  3Q8X A;  3Q8B A;  4QOS A;  4MT5 A;  3BB7 A;  3CWI A;  4JPS A;  4FXC A;  3UI3 A;  3KDS E;  3AOE C;  3ZCB B;  3GQ3 A;  4EE2 A;  5D3I B;  1PGA A;  1TKE A;  3J9C A;  4A3V B;  2CHG A;  2RKO A;  1Z5A A;  4AG6 A;  3VK8 A;  4S12 A;  3SAU A;  3L27 A;  1IM2 A;  1Q3C A;  1ET6 A;  3Q69 A;  5FKA C;  3HU1 A;  3LB8 C;  2C9C A;  3I9V 1;  3SAW A;  1JQJ C;  2EEL A;  2DBY A;  1C77 A;  1K82 A;  2QCU A;  1PGX A;  2AGA A;  2W82 A;  4IBK A;  1N34 M;  2GRI A;  1NEN B;  1E94 E;  2YNM D;  1L2C A;  1LV7 A;  1D5X C;  1SE2 A;  2XF3 A;  3NVY A;  2WU2 B;  4GKJ M;  3MK6 A;  1EM7 A;  2LGI A;  2OHF A;  4DV5 M;  3FTE A;  4OW0 A;  3L26 A;  3SAS A;  1ENF A;  5KPT A;  1L4Z B;  2K3U A;  1MI0 A;  1FFV A;  3URY A;  2DWL A;  2WXR A;  2WXI A;  2LFI A;  1TY2 A;  2J7Q A;  1IN4 A;  3KP0 E;  1VR9 A;  2CFO A;  1J7C A;  5FTK A;  4G4Q A;  2C9O A;  1DGH A;  1CZP A;  4NL4 H;  1JW9 D;  4ARC A;  1NVI D;  2AQ2 B;  1K52 A;  4D8I A;  3SYL A;  1HQY E;  1X37 A;  4YY3 M;  1JQ4 A;  1NNJ A;  4BBA A;  4GUA A;  5EZS A;  2QSD A;  1JWU D;  4HXD B;  4L16 A;  4GH9 A;  3AEC B;  2KQ4 X;  3P4R B;  3WHK A;  1NJG A;  4HRS A;  4JI7 M;  4CGY B;  1R2Y A;  2DWZ B;  3ZNH A;  2MH7 A;  3KLS X;  4WUR A;  4LJ7 A;  4FD2 A;  3SFE B;  4O1N A;  4LFC M;  5DYG A;  3BZD B;  2C99 A;  2DHR A;  1I4W A;  1IXZ A;  3NWL A;  3SAV A;  3W0F A;  1L2D A;  1DGG A;  4D82 A;  2FE8 A;  2YR0 A;  2L32 A;  4C7Z A;  1ESF A;  1IXS B;  2YEP F;  5BMI A;  1D5Z C;  1FCL A;  2M19 A;  1ZE3 D;  5EE1 A;  1TKY A;  2F5P A;  1EU3 A;  3W5U B;  3ILK A;  4DR6 M;  2DWM A;  2DXI A;  3GPP A;  4L1B A;  4AS1 A;  1G59 A;  3TL4 X;  3Q8A A;  4CIS A;  4JI6 M;  3EGR A;  5BPV A;  3HHY A;  3U5Z A;  2Z84 A;  2BB5 A;  1T3Q A;  2PVG C;  4FVM A;  3J27 B;  2O5R A;  3HVZ A;  4AKI A;  4OHJ A;  1L8Q A;  2MJ3 A;  4WIP A;  5H92 C;  1N32 M;  4IBC A;  3T3N A;  1HR0 M;  1NVM A;  3U61 B;  2ICI A;  1DGJ A;  5I4D A;  1I4R A;  3PRP A;  4QHS A;  1XHB A;  1AN8 A;  1Z6T A;  2BYT A;  1EWC A;  3BK1 A;  3E56 A;  1UWX A;  3AEE B;  2AQ1 B;  3BYY B;  2WXG A;  5KPZ A;  4BLC A;  3AE8 B;  2JXT A;  4QOZ C;  4JV5 M;  2WU5 B;  1SXJ C;  3GLH A;  3DWG C;  2XFT A;  2LMC A;  3QAU A;  2CJN A;  1GB1 A;  4NZL B;  4TUW A;  4WAF A;  3FUV A;  2BTW B;  3JAM S;  3VKH A;  1L1T A;  2KAJ A;  3L25 A;  2C98 A;  3HU2 A;  2W3R A;  3U60 A;  2UXD M;  5T8I A;  2H89 B;  1GPX A;  1FXI A;  1V97 A;  4DR4 M;  4D80 A;  3PNY A;  3BOS A;  3AH7 A;  3GPY A;  4AKG A;  3VRB B;  2WXK A;  3B9P A;  3A45 A;  3PSE A;  3K92 A;  2G9H D;  3KW6 A;  4PCZ A;  1JWA D;  2D7E A;  4YTP B;  1QOF A;  2WLB A;  4LY6 A;  3PHX A;  3BK2 A;  2N9K A;  3NUH B;  1HT2 E;  1GKI A;  1QT9 A;  3M0E A;  4GC9 A;  3UMM A;  3U7Z A;  1PM5 A;  4YHH M;  1TS5 A;  4IBE A;  3GQ5 A;  3AE3 B;  2C96 A;  5FR3 A;  1E6E B;  2OED A;  1YUB A;  2KMM A;  5A2Q S;  4USA A;  1JRO A;  3V05 A;  5JI3 E;  5ITR A;  3Q8E A;  4MB7 A;  1OFF A;  3OTO M;  1FNN A;  1SXJ B;  3M7G A;  1FCC C;  5E26 A;  1K3X A;  3O65 A;  1DOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...