2R9NA

Cathepsin s complexed with compound 26
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin S
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9nA00
1BY8A 2JQFR 2R6NA 4BS5A 1M6DA 3PNRA 4N79A 9PAPA 3OF8A 4ZUXU 1ZCMA 5PADA 1S4VA 2YJ9A 5K16A 3LFYA 1PE6A 1Y4HA 4YYWA 2PBHA 3V6CA 4Q8GA 2E02A 4PP2E 3CBJA 3IV2A 2R9MA 3LXSA 8PCHA 1F2CA 2NQGA 4MSXA 1CPJA 3M99A 3H6SA 2XU5A 5F02A 2G8EA 1MDWA 1F2BA 3F5VA 4FIPA 1KHQA 1YK8A 1THEA 2PREA 4YV8A 4QRXA 1PXVA 1SP4B 2XU1A 3WXGA 3MHSA 1PPNA 3WXFA 5J94A 3OVZA 2H7JA 2DC8A 5A24A 4I07A 4P6EA 4BS6A 3P5XA 2R9CA 3CBKA 4OEMA 1VJVA 2DC7A 1MEMA 5JA7A 2IPPB 2P0RA 3P5UA 2P86A 1MS6A 2FRAA 2FQ9A 1ATKA 3MORA 4PI3A 1U9XA 1SNKA 2JQGR 2DCAA 5JH3A 3OVXA 2AYNA 1GECE 4HWYA 4YYUA 2XU3A 3H7DA 3C9EA 1PADA 1TLOA 2VHSA 2DZYA 2AIMA 2FT2A 3O1GA 1GCBA 1AECA 5FPWA 3KWBX 4W4UA 4X6IA 3KFQA 1QXPA 1POPA 4FK5A 1O0EA 2G8JA 2B1NA 1NB5A 4MZSA 1ITOA 2AU1A 4X6JA 3K8UA 2ARYA 2C0YA 3IOQA 1KXRA 3ZUAA 2DJGB 1U9VA 3OISA 2HXZA 1CS8A 1K3BB 3USVA 1EWPA 2HHNA 3TNXA 2DCBA 2OZ2A 4QRVA 1AU4A 3S3QA 1GLOA 1ME4A 2E00A 1EWOA 3RVVA 1MEGA 2HH5A 4BQVA 3MTNA 1CB5A 1YK7A 1NQCA 3NHEA 1NB3A 1Y08A 2E03A 2R9NA 1JQPA 2BDLA 4XR7A 5CVNB 2DC6A 2Y5BA 3RVXA 3PDFA 3HHIA 2G7YA 2YJBA 2FTDA 3BCNA 2AUZA 3KX1A 2CIOA 2DJFB 1F2AA 3I06A 3HWNA 2PADA 4G54A 1QOLA 3KW9A 3KWZA 2PNSA 5EGWA 4MZOA 4CDEB 2DCDA 2AVWA 3BOWA 7PCKA 1BQIA 4QRGA 2R9FA 3AI8A 1F29A 1CV8A 4I04A 2FO5A 4OELA 2P7UA 2R9OA 1PPDA 1IWDA 1VSNA 4AXLA 1QDQA 3OF9A 2DC9A 2BDZA 1CJLA 2ATOA 4BSQA 3GCBA 1ZIVA 1AU3A 1PPOA 4YVAA 1BGOA 2G6DA 3IEJA 1AIMA 2HD5A 2FYEA 1KFUL 1CQDA 4N4ZA 2FRQA 3KKUA 3P5VA 1EWLA 1QMYA 4P6GA 2OULA 4DMYA 3E1ZB 3D6SA 3RVWA 3N4CA 4DMXA 6PADA 3DF0A 2AUXA 1DEUA 3PW3A 2CB5A 4FJCA 4CZWA 1X9YA 3BPMA 3K9MA 4X6HA 2YJ2A 4W5BA 1NLJA 3CH2X 3ERVA 3WXEA 3MHHA 2YJCA 1YVBA 2NQAA 1HUCB 4YYVA 3K24A 3I3TA 2VHFA 1U5IA 4YYSA 3IUTA 1CSBB 4QH6A 3QT4A 4WA6A 2YJ8A 3HHAA 1MIRA 1U9QX 1XKGA 1A6RA 4AXMA 3H8BA 4XUIA 3S3RA 1EF7A 3BC3A 2WBFX 4RY2A 4QBBA 5EF4A 1STFE 2F7DA 1KHPA 2NQDB 3IHPA 2ACTA 1MHWA 1PPPA 3QSDA 4W5CA 1AYWA 1KFXL 1AU2A 2GHUA 3N3KA 4CDFB 3N3GA 2FUDA 2XU4A 1CVZA 4PADA 1YT7A 2Y6EA 1ICFA 2AYOA 1EWMA 3O0UA 4N8WA 4KLBA 4Q8HA 2AS8A 5CVOB 1PIPA 1CTEA 3CH3X 3KSEA 1GMYA 4BPVA 4CDDB 2O6XA 3B79A 4K7CA 5CVMA 4CDCB 5CHTA 1DF0A 3BWKA 2IBIA 1PBHA 1AYVA 3QJ3A 2DZZA 4PP1A 2GFOA 2DCCA 1AYUA 3U8EA 3F75A 5CHVA 4YYRA 2OP3A 1FH0A 1TL9A 2F1GA 3H8CA 1Q6KA 3P5WA 3HD3A 3H89A 3PBHA 2NQIA 3IMAA 1NL6A 1YALA 3V6EA 4YYQA 1TU6A 4I05A 2B1MA 1AU0A 1U9WA 1ME3A 2E01A 1PCIA 3BPFA 1NPZA 1BP4A
chains in the Genus database with same CATH superfamily
1BY8A 2JQFR 2R6NA 4BS5A 1M6DA 3PNRA 4BOSA 2BU3A 4N79A 2BTWA 9PAPA 3OF8A 4ZUXU 1ZCMA 5PADA 1S4VA 2YJ9A 4OVZB 5K16A 3LFYA 1PE6A 3PSEA 1Y4HA 4YYWA 2PBHA 3V6CA 3W31A 4Q8GA 2E02A 4PP2E 3CBJA 3IV2A 2R9MA 3LXSA 8PCHA 1F2CA 5EZSA 2NQGA 4MSXA 1CPJA 3M99A 3H6SA 2XU5A 5F02A 2G8EA 1MDWA 1F2BA 3F5VA 4FIPA 1KHQA 1YK8A 1THEA 2PREA 4YV8A 4QRXA 1PXVA 1SP4B 2XU1A 3MJ5A 3WXGA 3MHSA 1PPNA 3WXFA 5J94A 3OVZA 2H7JA 2DC8A 5A24A 3C0RA 4I07A 4P6EA 5EZQA 4BS6A 3P5XA 4REZA 2R9CA 3CBKA 4OEMA 1VJVA 2DC7A 1MEMA 5JA7A 2IPPB 2P0RA 3P5UA 2P86A 1MS6A 2FRAA 2JTCA 2FQ9A 1ATKA 3MORA 4PI3A 1U9XA 1SNKA 2JQGR 2DCAA 5JH3A 3OVXA 2AYNA 1GECE 4HWYA 4YYUA 4HXDB 2XU3A 3B21A 3H7DA 3C9EA 1PADA 1TLOA 2VHSA 4P16A 2DZYA 2AIMA 2FT2A 3O1GA 1GCBA 1AECA 5FPWA 3KWBX 4W4UA 4X6IA 3KFQA 1QXPA 2UZJA 1POPA 4RF0A 4FK5A 1O0EA 2G8JA 2B1NA 1NB5A 4BOQA 4MZSA 1ITOA 3PHUA 2AU1A 4X6JA 4M0WA 3K8UA 1UKFA 2ARYA 2J7QC 2C0YA 3IOQA 1KXRA 3ZUAA 2DJGB 1U9VA 3OISA 2HXZA 4BOPA 1CS8A 1K3BB 3USVA 1EWPA 2HHNA 3TNXA 4D8BA 2DCBA 2OZ2A 4QRVA 1AU4A 3S3QA 1GLOA 1ME4A 2E00A 1EWOA 3RVVA 1MEGA 2HH5A 4BQVA 3MTNA 1CB5A 1YK7A 1NQCA 3NHEA 3PHWA 1NB3A 1Y08A 2E03A 3OQCA 2R9NA 1JQPA 2BDLA 4XR7A 5CVNB 5E6JA 2DC6A 3PHXA 2Y5BA 3BB7A 3RVXA 3PDFA 2DOSA 2J7QA 3HHIA 2G7YA 2Z84A 2YJBA 2FTDA 3BCNA 2AUZA 3KX1A 2CIOA 2DJFB 1F2AA 3TRKA 3I06A 3HWNA 2PADA 4G54A 3MTVA 1QOLA 3KW9A 3KWZA 4BOZA 3PT2A 2PNSA 5EGWA 4MZOA 4CDEB 4RF1A 2DCDA 4RKXA 2AVWA 3BOWA 7PCKA 3ZNHA 1BQIA 4QRGA 2R9FA 3AI8A 1F29A 4XZXA 4WURA 1CV8A 4I04A 2FO5A 4OELA 2P7UA 2R9OA 1PPDA 1IWDA 4RNAA 1VSNA 4GUAA 4AXLA 1QDQA 3OF9A 2DC9A 2BDZA 1CJLA 2ATOA 4BSQA 3GCBA 1YZBA 1ZIVA 1AU3A 1PPOA 3O65A 4YVAA 3BBAA 1BGOA 2G6DA 3IEJA 1AIMA 2HD5A 2FE8A 2FYEA 1KFUL 1CQDA 4N4ZA 2FRQA 3KKUA 3P5VA 1EWLA 1QMYA 4P6GA 2OULA 4DMYA 3E1ZB 3D6SA 4PT5A 3N4CA 3RVWA 4DMXA 6PADA 3DF0A 2AUXA 2AGAA 4MM3B 1DEUA 3PW3A 2CB5A 4FJCA 2BTWB 4CZWA 1X9YA 3BPMA 3K9MA 4X6HA 4R3DA 2YJ2A 4W5BA 1NLJA 3CH2X 3ERVA 4BOUA 3WXEA 3MHHA 3RNVA 2YJCA 1YVBA 2NQAA 1HUCB 4YYVA 5JZEA 3K24A 3IFUA 3I3TA 2VHFA 1U5IA 3W30A 4YYSA 3IUTA 1CSBB 4QH6A 4A5UA 3QT4A 4WA6A 2YJ8A 3HHAA 1MIRA 1U9QX 1XKGA 1A6RA 4AXMA 3H8BA 4XUIA 3S3RA 1EF7A 1PVJA 3BC3A 2WBFX 4RY2A 4QBBA 5EF4A 1STFE 2F7DA 1KHPA 2NQDB 3IHPA 2ACTA 1MHWA 4IUMA 4OVZA 1PPPA 3QSDA 4W5CA 1AYWA 1KFXL 1AU2A 2GHUA 3N3KA 4CDFB 3N3GA 2FUDA 2XU4A 3MP2A 1CVZA 4PADA 1YT7A 2Y6EA 1ICFA 2AYOA 1EWMA 3O0UA 4N8WA 4KLBA 4Q8HA 2AS8A 5CVOB 1PIPA 5KO3A 1CTEA 3CH3X 3KSEA 1GMYA 4BPVA 4IP3A 4CDDB 2O6XA 3B79A 1DKIA 4K7CA 5CVMA 4CDCB 5CHTA 1DF0A 3BWKA 2IBIA 1PBHA 1AYVA 3QJ3A 4OW0A 2DZZA 3PRPA 4PP1A 2GFOA 2DCCA 4ZTBA 1AYUA 4MI7A 3U8EA 3F75A 3E9SA 5CHVA 4YYRA 2OP3A 1FH0A 1TL9A 2F1GA 3H8CA 3PRMA 4D8EA 1Q6KA 3P5WA 3HD3A 3BY4A 3H89A 3PBHA 2NQIA 3IMAA 4D8IA 1NL6A 1YALA 3V6EA 4YYQA 1TU6A 4I05A 3TMPA 2JRIA 2B1MA 1AU0A 1U9WA 1ME3A 2E01A 1PCIA 3BPFA 1NPZA 1BP4A 2HWKA
chains in the Genus database with same CATH topology
1BY8A 2JQFR 2R6NA 4BS5A 1M6DA 3PNRA 4N79A 9PAPA 3OF8A 4ZUXU 1ZCMA 5PADA 1S4VA 2YJ9A 5K16A 3LFYA 1PE6A 1Y4HA 4YYWA 2PBHA 3V6CA 4Q8GA 2E02A 4PP2E 3CBJA 3IV2A 2R9MA 3LXSA 8PCHA 1F2CA 2NQGA 4MSXA 1CPJA 3M99A 3H6SA 2XU5A 5F02A 2G8EA 1MDWA 1F2BA 3F5VA 4FIPA 1KHQA 1YK8A 1THEA 2PREA 4YV8A 4QRXA 1PXVA 1SP4B 2XU1A 3WXGA 3MHSA 1PPNA 3WXFA 5J94A 3OVZA 2H7JA 2DC8A 5A24A 2VFBA 4I07A 4P6EA 4BS6A 3P5XA 2R9CA 3CBKA 4OEMA 2BSZA 1VJVA 2DC7A 1MEMA 5JA7A 2IPPB 4C5PA 2P0RA 3P5UA 2P86A 1MS6A 2FRAA 2FQ9A 1ATKA 3MORA 4PI3A 1U9XA 1SNKA 2JQGR 2DCAA 5JH3A 1W4TA 3OVXA 2AYNA 1GECE 4HWYA 4YYUA 2XU3A 3H7DA 3C9EA 1PADA 1TLOA 2VHSA 2DZYA 2AIMA 2FT2A 3O1GA 1GCBA 1AECA 5FPWA 3KWBX 4W4UA 4X6IA 3KFQA 1QXPA 1POPA 4FK5A 1O0EA 2G8JA 2B1NA 1NB5A 4MZSA 1ITOA 2AU1A 4X6JA 3K8UA 2ARYA 4B55A 2C0YA 3IOQA 1KXRA 3ZUAA 2DJGB 1U9VA 3OISA 2HXZA 1CS8A 1K3BB 3USVA 1EWPA 2HHNA 3TNXA 2DCBA 2OZ2A 4QRVA 1AU4A 3S3QA 1GLOA 1ME4A 2E00A 1EWOA 3RVVA 1MEGA 2HH5A 4BQVA 3MTNA 1CB5A 1YK7A 1NQCA 3NHEA 1NB3A 1E2TA 1Y08A 2E03A 2R9NA 1JQPA 2BDLA 4XR7A 5CVNB 2DC6A 2Y5BA 3RVXA 3PDFA 3HHIA 2G7YA 2YJBA 2FTDA 3BCNA 2AUZA 3KX1A 2CIOA 2DJFB 1F2AA 3I06A 3HWNA 2PADA 4G54A 1QOLA 3KW9A 4GUZA 3KWZA 2PNSA 5EGWA 4MZOA 4CDEB 2DCDA 2AVWA 3BOWA 7PCKA 1BQIA 4QRGA 2R9FA 3AI8A 1F29A 1CV8A 4I04A 2FO5A 4OELA 2P7UA 2R9OA 1PPDA 1IWDA 4NV8A 1VSNA 4AXLA 1QDQA 3OF9A 2DC9A 2BDZA 1CJLA 2ATOA 4BSQA 3GCBA 1ZIVA 1AU3A 4NV7A 1PPOA 4YVAA 1BGOA 2G6DA 4BGFA 3IEJA 1AIMA 2HD5A 2FYEA 1KFUL 1CQDA 4N4ZA 2FRQA 3KKUA 3P5VA 1EWLA 1QMYA 4P6GA 2OULA 4DMYA 3E1ZB 3D6SA 3RVWA 3N4CA 4DMXA 6PADA 3DF0A 2AUXA 1DEUA 3PW3A 2CB5A 4FJCA 4CZWA 1X9YA 3BPMA 3K9MA 4X6HA 2YJ2A 4W5BA 1NLJA 3CH2X 3ERVA 3WXEA 3MHHA 2YJCA 1YVBA 2NQAA 1HUCB 4YYVA 3K24A 3I3TA 2VHFA 1U5IA 4YYSA 3IUTA 1CSBB 4QH6A 3QT4A 4WA6A 2YJ8A 3HHAA 1MIRA 1U9QX 1XKGA 1A6RA 4AXMA 3H8BA 4XUIA 3S3RA 1EF7A 3BC3A 2WBFX 4RY2A 4QBBA 5EF4A 1STFE 2F7DA 1KHPA 2NQDB 3IHPA 2ACTA 1MHWA 1PPPA 3QSDA 4W5CA 1AYWA 1KFXL 1AU2A 2GHUA 3LTWA 3N3KA 4CDFB 3N3GA 2FUDA 2XU4A 1CVZA 4PADA 1YT7A 2Y6EA 1ICFA 2AYOA 1EWMA 3O0UA 4N8WA 4KLBA 4Q8HA 2AS8A 5CVOB 1W6FA 1PIPA 1CTEA 3CH3X 3KSEA 1GMYA 4BPVA 2VFCA 4CDDB 2O6XA 3B79A 4K7CA 3D9WA 5CVMA 4CDCB 5CHTA 1DF0A 3BWKA 2IBIA 1PBHA 1AYVA 3QJ3A 2DZZA 4PP1A 2GFOA 2DCCA 1AYUA 3U8EA 3F75A 5CHVA 1GX3A 4YYRA 2OP3A 1FH0A 1TL9A 2F1GA 3H8CA 1Q6KA 3P5WA 3HD3A 3H89A 3PBHA 2NQIA 3IMAA 1NL6A 1YALA 3V6EA 4YYQA 1TU6A 4I05A 1W5RA 2B1MA 1AU0A 1U9WA 1ME3A 2E01A 1PCIA 3BPFA 1NPZA 1BP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BY8 A;  2JQF R;  2R6N A;  4BS5 A;  1M6D A;  3PNR A;  4N79 A;  9PAP A;  3OF8 A;  4ZUX U;  1ZCM A;  5PAD A;  1S4V A;  2YJ9 A;  5K16 A;  3LFY A;  1PE6 A;  1Y4H A;  4YYW A;  2PBH A;  3V6C A;  4Q8G A;  2E02 A;  4PP2 E;  3CBJ A;  3IV2 A;  2R9M A;  3LXS A;  8PCH A;  1F2C A;  2NQG A;  4MSX A;  1CPJ A;  3M99 A;  3H6S A;  2XU5 A;  5F02 A;  2G8E A;  1MDW A;  1F2B A;  3F5V A;  4FIP A;  1KHQ A;  1YK8 A;  1THE A;  2PRE A;  4YV8 A;  4QRX A;  1PXV A;  1SP4 B;  2XU1 A;  3WXG A;  3MHS A;  1PPN A;  3WXF A;  5J94 A;  3OVZ A;  2H7J A;  2DC8 A;  5A24 A;  4I07 A;  4P6E A;  4BS6 A;  3P5X A;  2R9C A;  3CBK A;  4OEM A;  1VJV A;  2DC7 A;  1MEM A;  5JA7 A;  2IPP B;  2P0R A;  3P5U A;  2P86 A;  1MS6 A;  2FRA A;  2FQ9 A;  1ATK A;  3MOR A;  4PI3 A;  1U9X A;  1SNK A;  2JQG R;  2DCA A;  5JH3 A;  3OVX A;  2AYN A;  1GEC E;  4HWY A;  4YYU A;  2XU3 A;  3H7D A;  3C9E A;  1PAD A;  1TLO A;  2VHS A;  2DZY A;  2AIM A;  2FT2 A;  3O1G A;  1GCB A;  1AEC A;  5FPW A;  3KWB X;  4W4U A;  4X6I A;  3KFQ A;  1QXP A;  1POP A;  4FK5 A;  1O0E A;  2G8J A;  2B1N A;  1NB5 A;  4MZS A;  1ITO A;  2AU1 A;  4X6J A;  3K8U A;  2ARY A;  2C0Y A;  3IOQ A;  1KXR A;  3ZUA A;  2DJG B;  1U9V A;  3OIS A;  2HXZ A;  1CS8 A;  1K3B B;  3USV A;  1EWP A;  2HHN A;  3TNX A;  2DCB A;  2OZ2 A;  4QRV A;  1AU4 A;  3S3Q A;  1GLO A;  1ME4 A;  2E00 A;  1EWO A;  3RVV A;  1MEG A;  2HH5 A;  4BQV A;  3MTN A;  1CB5 A;  1YK7 A;  1NQC A;  3NHE A;  1NB3 A;  1Y08 A;  2E03 A;  2R9N A;  1JQP A;  2BDL A;  4XR7 A;  5CVN B;  2DC6 A;  2Y5B A;  3RVX A;  3PDF A;  3HHI A;  2G7Y A;  2YJB A;  2FTD A;  3BCN A;  2AUZ A;  3KX1 A;  2CIO A;  2DJF B;  1F2A A;  3I06 A;  3HWN A;  2PAD A;  4G54 A;  1QOL A;  3KW9 A;  3KWZ A;  2PNS A;  5EGW A;  4MZO A;  4CDE B;  2DCD A;  2AVW A;  3BOW A;  7PCK A;  1BQI A;  4QRG A;  2R9F A;  3AI8 A;  1F29 A;  1CV8 A;  4I04 A;  2FO5 A;  4OEL A;  2P7U A;  2R9O A;  1PPD A;  1IWD A;  1VSN A;  4AXL A;  1QDQ A;  3OF9 A;  2DC9 A;  2BDZ A;  1CJL A;  2ATO A;  4BSQ A;  3GCB A;  1ZIV A;  1AU3 A;  1PPO A;  4YVA A;  1BGO A;  2G6D A;  3IEJ A;  1AIM A;  2HD5 A;  2FYE A;  1KFU L;  1CQD A;  4N4Z A;  2FRQ A;  3KKU A;  3P5V A;  1EWL A;  1QMY A;  4P6G A;  2OUL A;  4DMY A;  3E1Z B;  3D6S A;  3RVW A;  3N4C A;  4DMX A;  6PAD A;  3DF0 A;  2AUX A;  1DEU A;  3PW3 A;  2CB5 A;  4FJC A;  4CZW A;  1X9Y A;  3BPM A;  3K9M A;  4X6H A;  2YJ2 A;  4W5B A;  1NLJ A;  3CH2 X;  3ERV A;  3WXE A;  3MHH A;  2YJC A;  1YVB A;  2NQA A;  1HUC B;  4YYV A;  3K24 A;  3I3T A;  2VHF A;  1U5I A;  4YYS A;  3IUT A;  1CSB B;  4QH6 A;  3QT4 A;  4WA6 A;  2YJ8 A;  3HHA A;  1MIR A;  1U9Q X;  1XKG A;  1A6R A;  4AXM A;  3H8B A;  4XUI A;  3S3R A;  1EF7 A;  3BC3 A;  2WBF X;  4RY2 A;  4QBB A;  5EF4 A;  1STF E;  2F7D A;  1KHP A;  2NQD B;  3IHP A;  2ACT A;  1MHW A;  1PPP A;  3QSD A;  4W5C A;  1AYW A;  1KFX L;  1AU2 A;  2GHU A;  3N3K A;  4CDF B;  3N3G A;  2FUD A;  2XU4 A;  1CVZ A;  4PAD A;  1YT7 A;  2Y6E A;  1ICF A;  2AYO A;  1EWM A;  3O0U A;  4N8W A;  4KLB A;  4Q8H A;  2AS8 A;  5CVO B;  1PIP A;  1CTE A;  3CH3 X;  3KSE A;  1GMY A;  4BPV A;  4CDD B;  2O6X A;  3B79 A;  4K7C A;  5CVM A;  4CDC B;  5CHT A;  1DF0 A;  3BWK A;  2IBI A;  1PBH A;  1AYV A;  3QJ3 A;  2DZZ A;  4PP1 A;  2GFO A;  2DCC A;  1AYU A;  3U8E A;  3F75 A;  5CHV A;  4YYR A;  2OP3 A;  1FH0 A;  1TL9 A;  2F1G A;  3H8C A;  1Q6K A;  3P5W A;  3HD3 A;  3H89 A;  3PBH A;  2NQI A;  3IMA A;  1NL6 A;  1YAL A;  3V6E A;  4YYQ A;  1TU6 A;  4I05 A;  2B1M A;  1AU0 A;  1U9W A;  1ME3 A;  2E01 A;  1PCI A;  3BPF A;  1NPZ A;  1BP4 A; 
#chains in the Genus database with same CATH topology
 1BY8 A;  2JQF R;  2R6N A;  4BS5 A;  1M6D A;  3PNR A;  4BOS A;  2BU3 A;  4N79 A;  2BTW A;  9PAP A;  3OF8 A;  4ZUX U;  1ZCM A;  5PAD A;  1S4V A;  2YJ9 A;  4OVZ B;  5K16 A;  3LFY A;  1PE6 A;  3PSE A;  1Y4H A;  4YYW A;  2PBH A;  3V6C A;  3W31 A;  4Q8G A;  2E02 A;  4PP2 E;  3CBJ A;  3IV2 A;  2R9M A;  3LXS A;  8PCH A;  1F2C A;  5EZS A;  2NQG A;  4MSX A;  1CPJ A;  3M99 A;  3H6S A;  2XU5 A;  5F02 A;  2G8E A;  1MDW A;  1F2B A;  3F5V A;  4FIP A;  1KHQ A;  1YK8 A;  1THE A;  2PRE A;  4YV8 A;  4QRX A;  1PXV A;  1SP4 B;  2XU1 A;  3MJ5 A;  3WXG A;  3MHS A;  1PPN A;  3WXF A;  5J94 A;  3OVZ A;  2H7J A;  2DC8 A;  5A24 A;  3C0R A;  4I07 A;  4P6E A;  5EZQ A;  4BS6 A;  3P5X A;  4REZ A;  2R9C A;  3CBK A;  4OEM A;  1VJV A;  2DC7 A;  1MEM A;  5JA7 A;  2IPP B;  2P0R A;  3P5U A;  2P86 A;  1MS6 A;  2FRA A;  2JTC A;  2FQ9 A;  1ATK A;  3MOR A;  4PI3 A;  1U9X A;  1SNK A;  2JQG R;  2DCA A;  5JH3 A;  3OVX A;  2AYN A;  1GEC E;  4HWY A;  4YYU A;  4HXD B;  2XU3 A;  3B21 A;  3H7D A;  3C9E A;  1PAD A;  1TLO A;  2VHS A;  4P16 A;  2DZY A;  2AIM A;  2FT2 A;  3O1G A;  1GCB A;  1AEC A;  5FPW A;  3KWB X;  4W4U A;  4X6I A;  3KFQ A;  1QXP A;  2UZJ A;  1POP A;  4RF0 A;  4FK5 A;  1O0E A;  2G8J A;  2B1N A;  1NB5 A;  4BOQ A;  4MZS A;  1ITO A;  3PHU A;  2AU1 A;  4X6J A;  4M0W A;  3K8U A;  1UKF A;  2ARY A;  2J7Q C;  2C0Y A;  3IOQ A;  1KXR A;  3ZUA A;  2DJG B;  1U9V A;  3OIS A;  2HXZ A;  4BOP A;  1CS8 A;  1K3B B;  3USV A;  1EWP A;  2HHN A;  3TNX A;  4D8B A;  2DCB A;  2OZ2 A;  4QRV A;  1AU4 A;  3S3Q A;  1GLO A;  1ME4 A;  2E00 A;  1EWO A;  3RVV A;  1MEG A;  2HH5 A;  4BQV A;  3MTN A;  1CB5 A;  1YK7 A;  1NQC A;  3NHE A;  3PHW A;  1NB3 A;  1Y08 A;  2E03 A;  3OQC A;  2R9N A;  1JQP A;  2BDL A;  4XR7 A;  5CVN B;  5E6J A;  2DC6 A;  3PHX A;  2Y5B A;  3BB7 A;  3RVX A;  3PDF A;  2DOS A;  2J7Q A;  3HHI A;  2G7Y A;  2Z84 A;  2YJB A;  2FTD A;  3BCN A;  2AUZ A;  3KX1 A;  2CIO A;  2DJF B;  1F2A A;  3TRK A;  3I06 A;  3HWN A;  2PAD A;  4G54 A;  3MTV A;  1QOL A;  3KW9 A;  3KWZ A;  4BOZ A;  3PT2 A;  2PNS A;  5EGW A;  4MZO A;  4CDE B;  4RF1 A;  2DCD A;  4RKX A;  2AVW A;  3BOW A;  7PCK A;  3ZNH A;  1BQI A;  4QRG A;  2R9F A;  3AI8 A;  1F29 A;  4XZX A;  4WUR A;  1CV8 A;  4I04 A;  2FO5 A;  4OEL A;  2P7U A;  2R9O A;  1PPD A;  1IWD A;  4RNA A;  1VSN A;  4GUA A;  4AXL A;  1QDQ A;  3OF9 A;  2DC9 A;  2BDZ A;  1CJL A;  2ATO A;  4BSQ A;  3GCB A;  1YZB A;  1ZIV A;  1AU3 A;  1PPO A;  3O65 A;  4YVA A;  3BBA A;  1BGO A;  2G6D A;  3IEJ A;  1AIM A;  2HD5 A;  2FE8 A;  2FYE A;  1KFU L;  1CQD A;  4N4Z A;  2FRQ A;  3KKU A;  3P5V A;  1EWL A;  1QMY A;  4P6G A;  2OUL A;  4DMY A;  3E1Z B;  3D6S A;  4PT5 A;  3N4C A;  3RVW A;  4DMX A;  6PAD A;  3DF0 A;  2AUX A;  2AGA A;  4MM3 B;  1DEU A;  3PW3 A;  2CB5 A;  4FJC A;  2BTW B;  4CZW A;  1X9Y A;  3BPM A;  3K9M A;  4X6H A;  4R3D A;  2YJ2 A;  4W5B A;  1NLJ A;  3CH2 X;  3ERV A;  4BOU A;  3WXE A;  3MHH A;  3RNV A;  2YJC A;  1YVB A;  2NQA A;  1HUC B;  4YYV A;  5JZE A;  3K24 A;  3IFU A;  3I3T A;  2VHF A;  1U5I A;  3W30 A;  4YYS A;  3IUT A;  1CSB B;  4QH6 A;  4A5U A;  3QT4 A;  4WA6 A;  2YJ8 A;  3HHA A;  1MIR A;  1U9Q X;  1XKG A;  1A6R A;  4AXM A;  3H8B A;  4XUI A;  3S3R A;  1EF7 A;  1PVJ A;  3BC3 A;  2WBF X;  4RY2 A;  4QBB A;  5EF4 A;  1STF E;  2F7D A;  1KHP A;  2NQD B;  3IHP A;  2ACT A;  1MHW A;  4IUM A;  4OVZ A;  1PPP A;  3QSD A;  4W5C A;  1AYW A;  1KFX L;  1AU2 A;  2GHU A;  3N3K A;  4CDF B;  3N3G A;  2FUD A;  2XU4 A;  3MP2 A;  1CVZ A;  4PAD A;  1YT7 A;  2Y6E A;  1ICF A;  2AYO A;  1EWM A;  3O0U A;  4N8W A;  4KLB A;  4Q8H A;  2AS8 A;  5CVO B;  1PIP A;  5KO3 A;  1CTE A;  3CH3 X;  3KSE A;  1GMY A;  4BPV A;  4IP3 A;  4CDD B;  2O6X A;  3B79 A;  1DKI A;  4K7C A;  5CVM A;  4CDC B;  5CHT A;  1DF0 A;  3BWK A;  2IBI A;  1PBH A;  1AYV A;  3QJ3 A;  4OW0 A;  2DZZ A;  3PRP A;  4PP1 A;  2GFO A;  2DCC A;  4ZTB A;  1AYU A;  4MI7 A;  3U8E A;  3F75 A;  3E9S A;  5CHV A;  4YYR A;  2OP3 A;  1FH0 A;  1TL9 A;  2F1G A;  3H8C A;  3PRM A;  4D8E A;  1Q6K A;  3P5W A;  3HD3 A;  3BY4 A;  3H89 A;  3PBH A;  2NQI A;  3IMA A;  4D8I A;  1NL6 A;  1YAL A;  3V6E A;  4YYQ A;  1TU6 A;  4I05 A;  3TMP A;  2JRI A;  2B1M A;  1AU0 A;  1U9W A;  1ME3 A;  2E01 A;  1PCI A;  3BPF A;  1NPZ A;  1BP4 A;  2HWK A; 
#chains in the Genus database with same CATH homology
 1BY8 A;  2JQF R;  2R6N A;  4BS5 A;  1M6D A;  3PNR A;  4N79 A;  9PAP A;  3OF8 A;  4ZUX U;  1ZCM A;  5PAD A;  1S4V A;  2YJ9 A;  5K16 A;  3LFY A;  1PE6 A;  1Y4H A;  4YYW A;  2PBH A;  3V6C A;  4Q8G A;  2E02 A;  4PP2 E;  3CBJ A;  3IV2 A;  2R9M A;  3LXS A;  8PCH A;  1F2C A;  2NQG A;  4MSX A;  1CPJ A;  3M99 A;  3H6S A;  2XU5 A;  5F02 A;  2G8E A;  1MDW A;  1F2B A;  3F5V A;  4FIP A;  1KHQ A;  1YK8 A;  1THE A;  2PRE A;  4YV8 A;  4QRX A;  1PXV A;  1SP4 B;  2XU1 A;  3WXG A;  3MHS A;  1PPN A;  3WXF A;  5J94 A;  3OVZ A;  2H7J A;  2DC8 A;  5A24 A;  2VFB A;  4I07 A;  4P6E A;  4BS6 A;  3P5X A;  2R9C A;  3CBK A;  4OEM A;  2BSZ A;  1VJV A;  2DC7 A;  1MEM A;  5JA7 A;  2IPP B;  4C5P A;  2P0R A;  3P5U A;  2P86 A;  1MS6 A;  2FRA A;  2FQ9 A;  1ATK A;  3MOR A;  4PI3 A;  1U9X A;  1SNK A;  2JQG R;  2DCA A;  5JH3 A;  1W4T A;  3OVX A;  2AYN A;  1GEC E;  4HWY A;  4YYU A;  2XU3 A;  3H7D A;  3C9E A;  1PAD A;  1TLO A;  2VHS A;  2DZY A;  2AIM A;  2FT2 A;  3O1G A;  1GCB A;  1AEC A;  5FPW A;  3KWB X;  4W4U A;  4X6I A;  3KFQ A;  1QXP A;  1POP A;  4FK5 A;  1O0E A;  2G8J A;  2B1N A;  1NB5 A;  4MZS A;  1ITO A;  2AU1 A;  4X6J A;  3K8U A;  2ARY A;  4B55 A;  2C0Y A;  3IOQ A;  1KXR A;  3ZUA A;  2DJG B;  1U9V A;  3OIS A;  2HXZ A;  1CS8 A;  1K3B B;  3USV A;  1EWP A;  2HHN A;  3TNX A;  2DCB A;  2OZ2 A;  4QRV A;  1AU4 A;  3S3Q A;  1GLO A;  1ME4 A;  2E00 A;  1EWO A;  3RVV A;  1MEG A;  2HH5 A;  4BQV A;  3MTN A;  1CB5 A;  1YK7 A;  1NQC A;  3NHE A;  1NB3 A;  1E2T A;  1Y08 A;  2E03 A;  2R9N A;  1JQP A;  2BDL A;  4XR7 A;  5CVN B;  2DC6 A;  2Y5B A;  3RVX A;  3PDF A;  3HHI A;  2G7Y A;  2YJB A;  2FTD A;  3BCN A;  2AUZ A;  3KX1 A;  2CIO A;  2DJF B;  1F2A A;  3I06 A;  3HWN A;  2PAD A;  4G54 A;  1QOL A;  3KW9 A;  4GUZ A;  3KWZ A;  2PNS A;  5EGW A;  4MZO A;  4CDE B;  2DCD A;  2AVW A;  3BOW A;  7PCK A;  1BQI A;  4QRG A;  2R9F A;  3AI8 A;  1F29 A;  1CV8 A;  4I04 A;  2FO5 A;  4OEL A;  2P7U A;  2R9O A;  1PPD A;  1IWD A;  4NV8 A;  1VSN A;  4AXL A;  1QDQ A;  3OF9 A;  2DC9 A;  2BDZ A;  1CJL A;  2ATO A;  4BSQ A;  3GCB A;  1ZIV A;  1AU3 A;  4NV7 A;  1PPO A;  4YVA A;  1BGO A;  2G6D A;  4BGF A;  3IEJ A;  1AIM A;  2HD5 A;  2FYE A;  1KFU L;  1CQD A;  4N4Z A;  2FRQ A;  3KKU A;  3P5V A;  1EWL A;  1QMY A;  4P6G A;  2OUL A;  4DMY A;  3E1Z B;  3D6S A;  3RVW A;  3N4C A;  4DMX A;  6PAD A;  3DF0 A;  2AUX A;  1DEU A;  3PW3 A;  2CB5 A;  4FJC A;  4CZW A;  1X9Y A;  3BPM A;  3K9M A;  4X6H A;  2YJ2 A;  4W5B A;  1NLJ A;  3CH2 X;  3ERV A;  3WXE A;  3MHH A;  2YJC A;  1YVB A;  2NQA A;  1HUC B;  4YYV A;  3K24 A;  3I3T A;  2VHF A;  1U5I A;  4YYS A;  3IUT A;  1CSB B;  4QH6 A;  3QT4 A;  4WA6 A;  2YJ8 A;  3HHA A;  1MIR A;  1U9Q X;  1XKG A;  1A6R A;  4AXM A;  3H8B A;  4XUI A;  3S3R A;  1EF7 A;  3BC3 A;  2WBF X;  4RY2 A;  4QBB A;  5EF4 A;  1STF E;  2F7D A;  1KHP A;  2NQD B;  3IHP A;  2ACT A;  1MHW A;  1PPP A;  3QSD A;  4W5C A;  1AYW A;  1KFX L;  1AU2 A;  2GHU A;  3LTW A;  3N3K A;  4CDF B;  3N3G A;  2FUD A;  2XU4 A;  1CVZ A;  4PAD A;  1YT7 A;  2Y6E A;  1ICF A;  2AYO A;  1EWM A;  3O0U A;  4N8W A;  4KLB A;  4Q8H A;  2AS8 A;  5CVO B;  1W6F A;  1PIP A;  1CTE A;  3CH3 X;  3KSE A;  1GMY A;  4BPV A;  2VFC A;  4CDD B;  2O6X A;  3B79 A;  4K7C A;  3D9W A;  5CVM A;  4CDC B;  5CHT A;  1DF0 A;  3BWK A;  2IBI A;  1PBH A;  1AYV A;  3QJ3 A;  2DZZ A;  4PP1 A;  2GFO A;  2DCC A;  1AYU A;  3U8E A;  3F75 A;  5CHV A;  1GX3 A;  4YYR A;  2OP3 A;  1FH0 A;  1TL9 A;  2F1G A;  3H8C A;  1Q6K A;  3P5W A;  3HD3 A;  3H89 A;  3PBH A;  2NQI A;  3IMA A;  1NL6 A;  1YAL A;  3V6E A;  4YYQ A;  1TU6 A;  4I05 A;  1W5R A;  2B1M A;  1AU0 A;  1U9W A;  1ME3 A;  2E01 A;  1PCI A;  3BPF A;  1NPZ A;  1BP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...