2R9NA

Cathepsin s complexed with compound 26
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9nA00
4W5CA 3F75A 3CH3X 1ME3A 1HUCB 3S3RA 3WXFA 2R9MA 4QRVA 3OISA 2IBIA 1PBHA 3O1GA 3H8BA 2OZ2A 2B1NA 4YYUA 1MEGA 1AU0A 1GCBA 4YVAA 1MEMA 3OF9A 4RY2A 5EF4A 1Q6KA 1YK8A 3S3QA 4WA6A 2JQFR 1KFXL 2E03A 3M99A 5CHTA 1KHQA 3RVXA 4CDDB 1POPA 5JA7A 1STFE 1KHPA 1BP4A 1TL9A 1X9YA 3K8UA 3HD3A 3BCNA 4P6GA 4BS5A 1NB5A 1NPZA 3IMAA 1YVBA 3CBJA 1QXPA 5A24A 4DMYA 2E01A 1VSNA 4W5BA 1Y4HA 1CJLA 5FPWA 4BQVA 2FRAA 2CIOA 3KWBX 1ATKA 1CS8A 2FRQA 2NQAA 4KLBA 2XU4A 3CH2X 1QMYA 3PNRA 3KW9A 1EWPA 1ITOA 1NB3A 2IPPB 2G8EA 4I05A 2YJ9A 1ME4A 3MORA 1MHWA 4CZWA 1TU6A 4QRXA 3K9MA 5JH3A 4X6IA 2DC7A 4BS6A 1AIMA 1NLJA 2VHSA 4YYVA 2HD5A 2BDZA 1NL6A 2E00A 1KFUL 1F2BA 3PBHA 1F29A 2B1MA 2H7JA 1XKGA 1YT7A 3H7DA 3MHHA 1CPJA 2R6NA 6PADA 2PBHA 2HH5A 5EGWA 4K7CA 3IUTA 4ZUXU 2G7YA 2R9NA 1O0EA 1MDWA 3HHAA 3RVVA 3LXSA 4DMXA 3P5WA 3P5XA 1EF7A 1SP4B 1CV8A 4P6EA 2ARYA 1AYVA 2WBFX 2XU3A 3KSEA 1CQDA 2OULA 1PPOA 1EWOA 2DC9A 2DC6A 3DF0A 3BPMA 4Q8GA 1BQIA 3V6CA 1AECA 3WXEA 4FIPA 1PPNA 9PAPA 1F2CA 2JQGR 2DCBA 1BGOA 4XR7A 4BSQA 1QOLA 2FUDA 1S4VA 2YJCA 3I3TA 4FJCA 2XU1A 2DJFB 2GHUA 3OVZA 2R9FA 2BDLA 2ATOA 3ZUAA 1THEA 5CVNB 2Y5BA 3KWZA 4YYWA 2P0RA 1YALA 4QRGA 3BC3A 1PXVA 4N79A 4YYSA 1BY8A 3N4CA 4MSXA 3B79A 2AIMA 2R9OA 2YJ2A 3USVA 4N8WA 4QH6A 2Y6EA 1AU3A 2PREA 4FK5A 5CVOB 3I06A 1DEUA 2FQ9A 1A6RA 1ICFA 3P5VA 1PCIA 2DC8A 2C0YA 1F2AA 4PP2E 1AYWA 1GMYA 3H8CA 4MZOA 4CDCB 2PNSA 3MTNA 3IV2A 3ERVA 1AU2A 4PADA 4OELA 5J94A 1TLOA 2FT2A 4Q8HA 3IEJA 5CHVA 3CBKA 1YK7A 2HXZA 1CVZA 2G8JA 1PE6A 4X6JA 1VJVA 4W4UA 4I07A 4OEMA 2P7UA 3OVXA 3D6SA 3P5UA 8PCHA 3TNXA 3O0UA 2F1GA 1NQCA 5F02A 4PI3A 3RVWA 4XUIA 3N3GA 2VHFA 3QJ3A 3OF8A 2HHNA 3QT4A 1AU4A 2YJBA 2ACTA 1FH0A 1K3BB 3BWKA 3QSDA 1KXRA 3IHPA 4I04A 3NHEA 3E1ZB 2AYNA 2R9CA 1U9XA 2AVWA 1GECE 3N3KA 2FYEA 5CVMA 4PP1A 2P86A 4AXMA 1GLOA 1CB5A 2AUXA 3PW3A 2DJGB 4YYQA 1SNKA 2NQDB 3F5VA 4G54A 2DCAA 4YV8A 7PCKA 1PIPA 3KFQA 1MS6A 1DF0A 1ZCMA 2NQIA 4X6HA 5K16A 3V6EA 4QBBA 3AI8A 3HWNA 3K24A 2E02A 2AU1A 1EWMA 1EWLA 2PADA 3H6SA 4YYRA 1IWDA 2XU5A 1CTEA 1CSBB 4CDEB 3MHSA 3GCBA 1U9WA 4BPVA 2DCCA 3WXGA 3U8EA 2FTDA 4AXLA 3H89A 1QDQA 3IOQA 1PADA 1JQPA 1M6DA 2AS8A 3KKUA 1ZIVA 3BPFA 4MZSA 5PADA 2DZZA 1U5IA 2F7DA 2GFOA 1U9VA 1PPPA 2YJ8A 2CB5A 3HHIA 2DCDA 3C9EA 2NQGA 2AUZA 2AYOA 3BOWA 2OP3A 3PDFA 3LFYA 1AYUA 4N4ZA 4CDFB 2O6XA 1Y08A 3KX1A 1PPDA 2G6DA 1U9QX 4HWYA 2FO5A 2DZYA 1MIRA
chains in the Genus database with same CATH superfamily
4W5CA 3F75A 4OVZA 3CH3X 1ME3A 1HUCB 3S3RA 3WXFA 2R9MA 4QRVA 3OISA 4BOSA 2IBIA 1PBHA 3O1GA 3H8BA 4R3DA 2OZ2A 2B1NA 4YYUA 4D8EA 5KO3A 1MEGA 1AU0A 1GCBA 4YVAA 1MEMA 3OF9A 4RY2A 5EF4A 1Q6KA 3RNVA 1YK8A 3S3QA 4WA6A 2JQFR 1KFXL 2E03A 3M99A 5CHTA 1KHQA 3RVXA 4CDDB 1POPA 5JA7A 1STFE 3PHUA 1KHPA 5JZEA 2J7QA 1BP4A 1TL9A 1X9YA 3K8UA 3HD3A 3BCNA 4D8BA 4P6GA 4BS5A 1NB5A 1NPZA 3IMAA 1YVBA 3CBJA 1QXPA 5A24A 4DMYA 2E01A 1VSNA 2HWKA 1Y4HA 4W5BA 1CJLA 5FPWA 4BQVA 2FRAA 2CIOA 3KWBX 1ATKA 1CS8A 3BBAA 4MM3B 2FRQA 2NQAA 3BY4A 4KLBA 4RF0A 2XU4A 3CH2X 1QMYA 3PNRA 3KW9A 1EWPA 1ITOA 1NB3A 2IPPB 2G8EA 4I05A 2YJ9A 3PHXA 1ME4A 2BTWA 3MORA 3BB7A 1MHWA 4CZWA 1TU6A 4QRXA 3K9MA 5JH3A 4X6IA 2DC7A 4BS6A 1AIMA 3TMPA 1NLJA 2VHSA 4YYVA 2HD5A 3PHWA 2BDZA 1NL6A 2E00A 1KFUL 3MP2A 1F2BA 3PBHA 1F29A 2B1MA 2H7JA 3ZNHA 1XKGA 1YT7A 3H7DA 4A5UA 3MHHA 1CPJA 5EZQA 2R6NA 6PADA 2PBHA 2HH5A 4WURA 5EGWA 4K7CA 3IUTA 4ZUXU 2G7YA 2R9NA 1O0EA 1MDWA 3HHAA 3RVVA 3LXSA 4DMXA 3P5WA 3P5XA 1EF7A 1SP4B 1CV8A 4P6EA 2ARYA 1AYVA 2WBFX 2XU3A 3KSEA 1CQDA 3PRMA 2OULA 1PPOA 2Z84A 1EWOA 2DC9A 2DC6A 3DF0A 3BPMA 4P16A 4Q8GA 1BQIA 3V6CA 1AECA 3WXEA 4FIPA 1PPNA 3PT2A 1YZBA 9PAPA 1F2CA 2JQGR 2DCBA 1BGOA 4XR7A 4BSQA 1QOLA 2FUDA 1S4VA 2YJCA 3I3TA 4FJCA 2XU1A 2DJFB 3TRKA 2GHUA 3OVZA 2R9FA 3C0RA 4HXDB 3MTVA 2BDLA 3B21A 2JTCA 2ATOA 3ZUAA 1THEA 5CVNB 2Y5BA 3KWZA 4YYWA 3E9SA 2P0RA 1YALA 4QRGA 3BC3A 1PXVA 4N79A 4YYSA 1BY8A 2FE8A 3N4CA 4BOUA 3B79A 4MSXA 2AIMA 3IFUA 2J7QC 2R9OA 2YJ2A 4REZA 3W31A 3USVA 4N8WA 4IP3A 4OVZB 4QH6A 2Y6EA 3OQCA 1AU3A 2PREA 4FK5A 5CVOB 3I06A 1PVJA 1DEUA 2FQ9A 1A6RA 1ICFA 3PSEA 3P5VA 1PCIA 2DC8A 2C0YA 1F2AA 4PP2E 1AYWA 4GUAA 1GMYA 3H8CA 4MZOA 4CDCB 2PNSA 3MTNA 3IV2A 3ERVA 1AU2A 4PADA 4OELA 5J94A 1TLOA 2FT2A 4IUMA 4BOQA 4Q8HA 3IEJA 3PRPA 5CHVA 2AGAA 3CBKA 1YK7A 2HXZA 1CVZA 2G8JA 1PE6A 4X6JA 1VJVA 4D8IA 4W4UA 4I07A 5E6JA 4OEMA 2P7UA 4BOPA 3OVXA 3D6SA 3P5UA 8PCHA 3TNXA 3O0UA 2F1GA 1NQCA 5F02A 4PI3A 3RVWA 4XUIA 3N3GA 2VHFA 3QJ3A 3OF8A 4ZTBA 2HHNA 2JRIA 3QT4A 1AU4A 2YJBA 2ACTA 2BU3A 1FH0A 1K3BB 3BWKA 3QSDA 2BTWB 1KXRA 3IHPA 4I04A 3NHEA 3E1ZB 2AYNA 2R9CA 1U9XA 2AVWA 1GECE 3MJ5A 3N3KA 2FYEA 4RNAA 5CVMA 4PP1A 2P86A 4AXMA 1GLOA 4PT5A 1CB5A 2AUXA 3PW3A 2DJGB 4RF1A 4YYQA 1SNKA 2NQDB 3F5VA 4G54A 2DCAA 4YV8A 7PCKA 1PIPA 3KFQA 4XZXA 1MS6A 4OW0A 1DF0A 1ZCMA 2NQIA 4X6HA 5K16A 3V6EA 4QBBA 3AI8A 3HWNA 3K24A 2E02A 2AU1A 1EWMA 1EWLA 2PADA 3H6SA 4YYRA 1IWDA 2XU5A 1CTEA 1CSBB 4CDEB 3MHSA 3GCBA 1U9WA 4BPVA 2DCCA 3WXGA 3U8EA 2FTDA 4AXLA 3H89A 1QDQA 4M0WA 2UZJA 3IOQA 1PADA 1JQPA 1M6DA 2AS8A 3KKUA 1ZIVA 3BPFA 4MZSA 5PADA 2DZZA 1UKFA 1U5IA 2F7DA 2GFOA 1U9VA 1PPPA 2YJ8A 2CB5A 3HHIA 4RKXA 1DKIA 5EZSA 2DCDA 3C9EA 2NQGA 2AUZA 2AYOA 3BOWA 2OP3A 3PDFA 3LFYA 1AYUA 4N4ZA 4CDFB 2O6XA 3W30A 1Y08A 3KX1A 1PPDA 4BOZA 2G6DA 1U9QX 4HWYA 2DOSA 2FO5A 3O65A 2DZYA 4MI7A 1MIRA
chains in the Genus database with same CATH topology
4W5CA 3F75A 3CH3X 2VFCA 1ME3A 1HUCB 4GUZA 3S3RA 3WXFA 2R9MA 4QRVA 2BSZA 3OISA 2IBIA 1PBHA 3O1GA 3H8BA 2OZ2A 2B1NA 4YYUA 4BGFA 1MEGA 1AU0A 1W5RA 1GCBA 4YVAA 1MEMA 3OF9A 4RY2A 5EF4A 1Q6KA 4B55A 1YK8A 2VFBA 4WA6A 3S3QA 2JQFR 1KFXL 2E03A 3M99A 5CHTA 1KHQA 3RVXA 4CDDB 1POPA 5JA7A 1STFE 1KHPA 1BP4A 1TL9A 1X9YA 3K8UA 3HD3A 3BCNA 4P6GA 4BS5A 1NB5A 1NPZA 3IMAA 1YVBA 3CBJA 1QXPA 5A24A 4DMYA 2E01A 1VSNA 4W5BA 1Y4HA 1CJLA 5FPWA 4BQVA 2FRAA 2CIOA 1GX3A 3D9WA 3KWBX 1ATKA 1W4TA 1CS8A 2FRQA 2NQAA 4KLBA 2XU4A 3CH2X 1QMYA 3PNRA 3KW9A 1EWPA 1ITOA 1NB3A 2IPPB 2G8EA 4I05A 2YJ9A 1ME4A 3MORA 1MHWA 4CZWA 1TU6A 4QRXA 3K9MA 5JH3A 4X6IA 2DC7A 4BS6A 1AIMA 1NLJA 2VHSA 4YYVA 2HD5A 2BDZA 1NL6A 2E00A 1KFUL 1F2BA 3PBHA 1F29A 2B1MA 2H7JA 1XKGA 1YT7A 3H7DA 3MHHA 1CPJA 2R6NA 6PADA 2PBHA 2HH5A 5EGWA 4K7CA 3IUTA 4ZUXU 2G7YA 2R9NA 1O0EA 1MDWA 3HHAA 3RVVA 3LXSA 4DMXA 3P5WA 3P5XA 1EF7A 1SP4B 1CV8A 4P6EA 2ARYA 1AYVA 2WBFX 2XU3A 3KSEA 1CQDA 2OULA 1PPOA 1EWOA 2DC9A 2DC6A 3DF0A 3BPMA 4Q8GA 1BQIA 3V6CA 1AECA 1W6FA 3WXEA 4FIPA 1PPNA 9PAPA 1F2CA 2JQGR 2DCBA 1BGOA 4XR7A 4BSQA 1QOLA 2FUDA 1S4VA 2YJCA 3I3TA 4FJCA 2XU1A 2DJFB 2GHUA 3OVZA 2R9FA 2BDLA 2ATOA 3ZUAA 1THEA 5CVNB 2Y5BA 3KWZA 4YYWA 2P0RA 1YALA 4QRGA 3BC3A 1PXVA 4N79A 4YYSA 1BY8A 3N4CA 4MSXA 3B79A 2AIMA 2R9OA 2YJ2A 3USVA 4N8WA 4QH6A 2Y6EA 1AU3A 2PREA 4FK5A 5CVOB 3I06A 1DEUA 2FQ9A 1A6RA 1ICFA 3P5VA 1PCIA 2DC8A 2C0YA 1F2AA 4PP2E 1AYWA 1GMYA 3H8CA 4MZOA 4CDCB 2PNSA 3MTNA 3IV2A 3ERVA 1AU2A 4PADA 4OELA 5J94A 1TLOA 2FT2A 4Q8HA 3IEJA 5CHVA 3CBKA 1E2TA 1YK7A 2HXZA 1CVZA 2G8JA 1PE6A 4X6JA 1VJVA 4W4UA 4I07A 4OEMA 2P7UA 3OVXA 3D6SA 3P5UA 8PCHA 3TNXA 3O0UA 2F1GA 1NQCA 5F02A 4PI3A 3RVWA 4XUIA 3N3GA 2VHFA 3QJ3A 3OF8A 2HHNA 3QT4A 1AU4A 2YJBA 2ACTA 1FH0A 1K3BB 4NV8A 3BWKA 3QSDA 1KXRA 3IHPA 4I04A 3NHEA 3E1ZB 2AYNA 2R9CA 1U9XA 2AVWA 1GECE 3N3KA 2FYEA 5CVMA 4PP1A 3LTWA 2P86A 4AXMA 1GLOA 1CB5A 2AUXA 3PW3A 2DJGB 4YYQA 1SNKA 2NQDB 3F5VA 4G54A 2DCAA 4YV8A 7PCKA 1PIPA 3KFQA 1MS6A 1DF0A 1ZCMA 2NQIA 4X6HA 5K16A 3V6EA 4QBBA 3AI8A 3HWNA 3K24A 2E02A 2AU1A 1EWMA 1EWLA 2PADA 3H6SA 4YYRA 1IWDA 2XU5A 1CTEA 1CSBB 4CDEB 3MHSA 3GCBA 1U9WA 4BPVA 2DCCA 3WXGA 3U8EA 2FTDA 4AXLA 3H89A 1QDQA 3IOQA 1PADA 1JQPA 1M6DA 4C5PA 2AS8A 3KKUA 1ZIVA 3BPFA 4MZSA 5PADA 2DZZA 1U5IA 2F7DA 2GFOA 1U9VA 1PPPA 2YJ8A 2CB5A 3HHIA 4NV7A 2DCDA 3C9EA 2NQGA 2AUZA 2AYOA 3BOWA 2OP3A 3PDFA 3LFYA 1AYUA 4N4ZA 4CDFB 2O6XA 1Y08A 3KX1A 1PPDA 2G6DA 1U9QX 4HWYA 2FO5A 2DZYA 1MIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5C A;  3F75 A;  3CH3 X;  1ME3 A;  1HUC B;  3S3R A;  3WXF A;  2R9M A;  4QRV A;  3OIS A;  2IBI A;  1PBH A;  3O1G A;  3H8B A;  2OZ2 A;  2B1N A;  4YYU A;  1MEG A;  1AU0 A;  1GCB A;  4YVA A;  1MEM A;  3OF9 A;  4RY2 A;  5EF4 A;  1Q6K A;  1YK8 A;  3S3Q A;  4WA6 A;  2JQF R;  1KFX L;  2E03 A;  3M99 A;  5CHT A;  1KHQ A;  3RVX A;  4CDD B;  1POP A;  5JA7 A;  1STF E;  1KHP A;  1BP4 A;  1TL9 A;  1X9Y A;  3K8U A;  3HD3 A;  3BCN A;  4P6G A;  4BS5 A;  1NB5 A;  1NPZ A;  3IMA A;  1YVB A;  3CBJ A;  1QXP A;  5A24 A;  4DMY A;  2E01 A;  1VSN A;  4W5B A;  1Y4H A;  1CJL A;  5FPW A;  4BQV A;  2FRA A;  2CIO A;  3KWB X;  1ATK A;  1CS8 A;  2FRQ A;  2NQA A;  4KLB A;  2XU4 A;  3CH2 X;  1QMY A;  3PNR A;  3KW9 A;  1EWP A;  1ITO A;  1NB3 A;  2IPP B;  2G8E A;  4I05 A;  2YJ9 A;  1ME4 A;  3MOR A;  1MHW A;  4CZW A;  1TU6 A;  4QRX A;  3K9M A;  5JH3 A;  4X6I A;  2DC7 A;  4BS6 A;  1AIM A;  1NLJ A;  2VHS A;  4YYV A;  2HD5 A;  2BDZ A;  1NL6 A;  2E00 A;  1KFU L;  1F2B A;  3PBH A;  1F29 A;  2B1M A;  2H7J A;  1XKG A;  1YT7 A;  3H7D A;  3MHH A;  1CPJ A;  2R6N A;  6PAD A;  2PBH A;  2HH5 A;  5EGW A;  4K7C A;  3IUT A;  4ZUX U;  2G7Y A;  2R9N A;  1O0E A;  1MDW A;  3HHA A;  3RVV A;  3LXS A;  4DMX A;  3P5W A;  3P5X A;  1EF7 A;  1SP4 B;  1CV8 A;  4P6E A;  2ARY A;  1AYV A;  2WBF X;  2XU3 A;  3KSE A;  1CQD A;  2OUL A;  1PPO A;  1EWO A;  2DC9 A;  2DC6 A;  3DF0 A;  3BPM A;  4Q8G A;  1BQI A;  3V6C A;  1AEC A;  3WXE A;  4FIP A;  1PPN A;  9PAP A;  1F2C A;  2JQG R;  2DCB A;  1BGO A;  4XR7 A;  4BSQ A;  1QOL A;  2FUD A;  1S4V A;  2YJC A;  3I3T A;  4FJC A;  2XU1 A;  2DJF B;  2GHU A;  3OVZ A;  2R9F A;  2BDL A;  2ATO A;  3ZUA A;  1THE A;  5CVN B;  2Y5B A;  3KWZ A;  4YYW A;  2P0R A;  1YAL A;  4QRG A;  3BC3 A;  1PXV A;  4N79 A;  4YYS A;  1BY8 A;  3N4C A;  4MSX A;  3B79 A;  2AIM A;  2R9O A;  2YJ2 A;  3USV A;  4N8W A;  4QH6 A;  2Y6E A;  1AU3 A;  2PRE A;  4FK5 A;  5CVO B;  3I06 A;  1DEU A;  2FQ9 A;  1A6R A;  1ICF A;  3P5V A;  1PCI A;  2DC8 A;  2C0Y A;  1F2A A;  4PP2 E;  1AYW A;  1GMY A;  3H8C A;  4MZO A;  4CDC B;  2PNS A;  3MTN A;  3IV2 A;  3ERV A;  1AU2 A;  4PAD A;  4OEL A;  5J94 A;  1TLO A;  2FT2 A;  4Q8H A;  3IEJ A;  5CHV A;  3CBK A;  1YK7 A;  2HXZ A;  1CVZ A;  2G8J A;  1PE6 A;  4X6J A;  1VJV A;  4W4U A;  4I07 A;  4OEM A;  2P7U A;  3OVX A;  3D6S A;  3P5U A;  8PCH A;  3TNX A;  3O0U A;  2F1G A;  1NQC A;  5F02 A;  4PI3 A;  3RVW A;  4XUI A;  3N3G A;  2VHF A;  3QJ3 A;  3OF8 A;  2HHN A;  3QT4 A;  1AU4 A;  2YJB A;  2ACT A;  1FH0 A;  1K3B B;  3BWK A;  3QSD A;  1KXR A;  3IHP A;  4I04 A;  3NHE A;  3E1Z B;  2AYN A;  2R9C A;  1U9X A;  2AVW A;  1GEC E;  3N3K A;  2FYE A;  5CVM A;  4PP1 A;  2P86 A;  4AXM A;  1GLO A;  1CB5 A;  2AUX A;  3PW3 A;  2DJG B;  4YYQ A;  1SNK A;  2NQD B;  3F5V A;  4G54 A;  2DCA A;  4YV8 A;  7PCK A;  1PIP A;  3KFQ A;  1MS6 A;  1DF0 A;  1ZCM A;  2NQI A;  4X6H A;  5K16 A;  3V6E A;  4QBB A;  3AI8 A;  3HWN A;  3K24 A;  2E02 A;  2AU1 A;  1EWM A;  1EWL A;  2PAD A;  3H6S A;  4YYR A;  1IWD A;  2XU5 A;  1CTE A;  1CSB B;  4CDE B;  3MHS A;  3GCB A;  1U9W A;  4BPV A;  2DCC A;  3WXG A;  3U8E A;  2FTD A;  4AXL A;  3H89 A;  1QDQ A;  3IOQ A;  1PAD A;  1JQP A;  1M6D A;  2AS8 A;  3KKU A;  1ZIV A;  3BPF A;  4MZS A;  5PAD A;  2DZZ A;  1U5I A;  2F7D A;  2GFO A;  1U9V A;  1PPP A;  2YJ8 A;  2CB5 A;  3HHI A;  2DCD A;  3C9E A;  2NQG A;  2AUZ A;  2AYO A;  3BOW A;  2OP3 A;  3PDF A;  3LFY A;  1AYU A;  4N4Z A;  4CDF B;  2O6X A;  1Y08 A;  3KX1 A;  1PPD A;  2G6D A;  1U9Q X;  4HWY A;  2FO5 A;  2DZY A;  1MIR A; 
#chains in the Genus database with same CATH topology
 4W5C A;  3F75 A;  4OVZ A;  3CH3 X;  1ME3 A;  1HUC B;  3S3R A;  3WXF A;  2R9M A;  4QRV A;  3OIS A;  4BOS A;  2IBI A;  1PBH A;  3O1G A;  3H8B A;  4R3D A;  2OZ2 A;  2B1N A;  4YYU A;  4D8E A;  5KO3 A;  1MEG A;  1AU0 A;  1GCB A;  4YVA A;  1MEM A;  3OF9 A;  4RY2 A;  5EF4 A;  1Q6K A;  3RNV A;  1YK8 A;  3S3Q A;  4WA6 A;  2JQF R;  1KFX L;  2E03 A;  3M99 A;  5CHT A;  1KHQ A;  3RVX A;  4CDD B;  1POP A;  5JA7 A;  1STF E;  3PHU A;  1KHP A;  5JZE A;  2J7Q A;  1BP4 A;  1TL9 A;  1X9Y A;  3K8U A;  3HD3 A;  3BCN A;  4D8B A;  4P6G A;  4BS5 A;  1NB5 A;  1NPZ A;  3IMA A;  1YVB A;  3CBJ A;  1QXP A;  5A24 A;  4DMY A;  2E01 A;  1VSN A;  2HWK A;  1Y4H A;  4W5B A;  1CJL A;  5FPW A;  4BQV A;  2FRA A;  2CIO A;  3KWB X;  1ATK A;  1CS8 A;  3BBA A;  4MM3 B;  2FRQ A;  2NQA A;  3BY4 A;  4KLB A;  4RF0 A;  2XU4 A;  3CH2 X;  1QMY A;  3PNR A;  3KW9 A;  1EWP A;  1ITO A;  1NB3 A;  2IPP B;  2G8E A;  4I05 A;  2YJ9 A;  3PHX A;  1ME4 A;  2BTW A;  3MOR A;  3BB7 A;  1MHW A;  4CZW A;  1TU6 A;  4QRX A;  3K9M A;  5JH3 A;  4X6I A;  2DC7 A;  4BS6 A;  1AIM A;  3TMP A;  1NLJ A;  2VHS A;  4YYV A;  2HD5 A;  3PHW A;  2BDZ A;  1NL6 A;  2E00 A;  1KFU L;  3MP2 A;  1F2B A;  3PBH A;  1F29 A;  2B1M A;  2H7J A;  3ZNH A;  1XKG A;  1YT7 A;  3H7D A;  4A5U A;  3MHH A;  1CPJ A;  5EZQ A;  2R6N A;  6PAD A;  2PBH A;  2HH5 A;  4WUR A;  5EGW A;  4K7C A;  3IUT A;  4ZUX U;  2G7Y A;  2R9N A;  1O0E A;  1MDW A;  3HHA A;  3RVV A;  3LXS A;  4DMX A;  3P5W A;  3P5X A;  1EF7 A;  1SP4 B;  1CV8 A;  4P6E A;  2ARY A;  1AYV A;  2WBF X;  2XU3 A;  3KSE A;  1CQD A;  3PRM A;  2OUL A;  1PPO A;  2Z84 A;  1EWO A;  2DC9 A;  2DC6 A;  3DF0 A;  3BPM A;  4P16 A;  4Q8G A;  1BQI A;  3V6C A;  1AEC A;  3WXE A;  4FIP A;  1PPN A;  3PT2 A;  1YZB A;  9PAP A;  1F2C A;  2JQG R;  2DCB A;  1BGO A;  4XR7 A;  4BSQ A;  1QOL A;  2FUD A;  1S4V A;  2YJC A;  3I3T A;  4FJC A;  2XU1 A;  2DJF B;  3TRK A;  2GHU A;  3OVZ A;  2R9F A;  3C0R A;  4HXD B;  3MTV A;  2BDL A;  3B21 A;  2JTC A;  2ATO A;  3ZUA A;  1THE A;  5CVN B;  2Y5B A;  3KWZ A;  4YYW A;  3E9S A;  2P0R A;  1YAL A;  4QRG A;  3BC3 A;  1PXV A;  4N79 A;  4YYS A;  1BY8 A;  2FE8 A;  3N4C A;  4BOU A;  3B79 A;  4MSX A;  2AIM A;  3IFU A;  2J7Q C;  2R9O A;  2YJ2 A;  4REZ A;  3W31 A;  3USV A;  4N8W A;  4IP3 A;  4OVZ B;  4QH6 A;  2Y6E A;  3OQC A;  1AU3 A;  2PRE A;  4FK5 A;  5CVO B;  3I06 A;  1PVJ A;  1DEU A;  2FQ9 A;  1A6R A;  1ICF A;  3PSE A;  3P5V A;  1PCI A;  2DC8 A;  2C0Y A;  1F2A A;  4PP2 E;  1AYW A;  4GUA A;  1GMY A;  3H8C A;  4MZO A;  4CDC B;  2PNS A;  3MTN A;  3IV2 A;  3ERV A;  1AU2 A;  4PAD A;  4OEL A;  5J94 A;  1TLO A;  2FT2 A;  4IUM A;  4BOQ A;  4Q8H A;  3IEJ A;  3PRP A;  5CHV A;  2AGA A;  3CBK A;  1YK7 A;  2HXZ A;  1CVZ A;  2G8J A;  1PE6 A;  4X6J A;  1VJV A;  4D8I A;  4W4U A;  4I07 A;  5E6J A;  4OEM A;  2P7U A;  4BOP A;  3OVX A;  3D6S A;  3P5U A;  8PCH A;  3TNX A;  3O0U A;  2F1G A;  1NQC A;  5F02 A;  4PI3 A;  3RVW A;  4XUI A;  3N3G A;  2VHF A;  3QJ3 A;  3OF8 A;  4ZTB A;  2HHN A;  2JRI A;  3QT4 A;  1AU4 A;  2YJB A;  2ACT A;  2BU3 A;  1FH0 A;  1K3B B;  3BWK A;  3QSD A;  2BTW B;  1KXR A;  3IHP A;  4I04 A;  3NHE A;  3E1Z B;  2AYN A;  2R9C A;  1U9X A;  2AVW A;  1GEC E;  3MJ5 A;  3N3K A;  2FYE A;  4RNA A;  5CVM A;  4PP1 A;  2P86 A;  4AXM A;  1GLO A;  4PT5 A;  1CB5 A;  2AUX A;  3PW3 A;  2DJG B;  4RF1 A;  4YYQ A;  1SNK A;  2NQD B;  3F5V A;  4G54 A;  2DCA A;  4YV8 A;  7PCK A;  1PIP A;  3KFQ A;  4XZX A;  1MS6 A;  4OW0 A;  1DF0 A;  1ZCM A;  2NQI A;  4X6H A;  5K16 A;  3V6E A;  4QBB A;  3AI8 A;  3HWN A;  3K24 A;  2E02 A;  2AU1 A;  1EWM A;  1EWL A;  2PAD A;  3H6S A;  4YYR A;  1IWD A;  2XU5 A;  1CTE A;  1CSB B;  4CDE B;  3MHS A;  3GCB A;  1U9W A;  4BPV A;  2DCC A;  3WXG A;  3U8E A;  2FTD A;  4AXL A;  3H89 A;  1QDQ A;  4M0W A;  2UZJ A;  3IOQ A;  1PAD A;  1JQP A;  1M6D A;  2AS8 A;  3KKU A;  1ZIV A;  3BPF A;  4MZS A;  5PAD A;  2DZZ A;  1UKF A;  1U5I A;  2F7D A;  2GFO A;  1U9V A;  1PPP A;  2YJ8 A;  2CB5 A;  3HHI A;  4RKX A;  1DKI A;  5EZS A;  2DCD A;  3C9E A;  2NQG A;  2AUZ A;  2AYO A;  3BOW A;  2OP3 A;  3PDF A;  3LFY A;  1AYU A;  4N4Z A;  4CDF B;  2O6X A;  3W30 A;  1Y08 A;  3KX1 A;  1PPD A;  4BOZ A;  2G6D A;  1U9Q X;  4HWY A;  2DOS A;  2FO5 A;  3O65 A;  2DZY A;  4MI7 A;  1MIR A; 
#chains in the Genus database with same CATH homology
 4W5C A;  3F75 A;  3CH3 X;  2VFC A;  1ME3 A;  1HUC B;  4GUZ A;  3S3R A;  3WXF A;  2R9M A;  4QRV A;  2BSZ A;  3OIS A;  2IBI A;  1PBH A;  3O1G A;  3H8B A;  2OZ2 A;  2B1N A;  4YYU A;  4BGF A;  1MEG A;  1AU0 A;  1W5R A;  1GCB A;  4YVA A;  1MEM A;  3OF9 A;  4RY2 A;  5EF4 A;  1Q6K A;  4B55 A;  1YK8 A;  2VFB A;  4WA6 A;  3S3Q A;  2JQF R;  1KFX L;  2E03 A;  3M99 A;  5CHT A;  1KHQ A;  3RVX A;  4CDD B;  1POP A;  5JA7 A;  1STF E;  1KHP A;  1BP4 A;  1TL9 A;  1X9Y A;  3K8U A;  3HD3 A;  3BCN A;  4P6G A;  4BS5 A;  1NB5 A;  1NPZ A;  3IMA A;  1YVB A;  3CBJ A;  1QXP A;  5A24 A;  4DMY A;  2E01 A;  1VSN A;  4W5B A;  1Y4H A;  1CJL A;  5FPW A;  4BQV A;  2FRA A;  2CIO A;  1GX3 A;  3D9W A;  3KWB X;  1ATK A;  1W4T A;  1CS8 A;  2FRQ A;  2NQA A;  4KLB A;  2XU4 A;  3CH2 X;  1QMY A;  3PNR A;  3KW9 A;  1EWP A;  1ITO A;  1NB3 A;  2IPP B;  2G8E A;  4I05 A;  2YJ9 A;  1ME4 A;  3MOR A;  1MHW A;  4CZW A;  1TU6 A;  4QRX A;  3K9M A;  5JH3 A;  4X6I A;  2DC7 A;  4BS6 A;  1AIM A;  1NLJ A;  2VHS A;  4YYV A;  2HD5 A;  2BDZ A;  1NL6 A;  2E00 A;  1KFU L;  1F2B A;  3PBH A;  1F29 A;  2B1M A;  2H7J A;  1XKG A;  1YT7 A;  3H7D A;  3MHH A;  1CPJ A;  2R6N A;  6PAD A;  2PBH A;  2HH5 A;  5EGW A;  4K7C A;  3IUT A;  4ZUX U;  2G7Y A;  2R9N A;  1O0E A;  1MDW A;  3HHA A;  3RVV A;  3LXS A;  4DMX A;  3P5W A;  3P5X A;  1EF7 A;  1SP4 B;  1CV8 A;  4P6E A;  2ARY A;  1AYV A;  2WBF X;  2XU3 A;  3KSE A;  1CQD A;  2OUL A;  1PPO A;  1EWO A;  2DC9 A;  2DC6 A;  3DF0 A;  3BPM A;  4Q8G A;  1BQI A;  3V6C A;  1AEC A;  1W6F A;  3WXE A;  4FIP A;  1PPN A;  9PAP A;  1F2C A;  2JQG R;  2DCB A;  1BGO A;  4XR7 A;  4BSQ A;  1QOL A;  2FUD A;  1S4V A;  2YJC A;  3I3T A;  4FJC A;  2XU1 A;  2DJF B;  2GHU A;  3OVZ A;  2R9F A;  2BDL A;  2ATO A;  3ZUA A;  1THE A;  5CVN B;  2Y5B A;  3KWZ A;  4YYW A;  2P0R A;  1YAL A;  4QRG A;  3BC3 A;  1PXV A;  4N79 A;  4YYS A;  1BY8 A;  3N4C A;  4MSX A;  3B79 A;  2AIM A;  2R9O A;  2YJ2 A;  3USV A;  4N8W A;  4QH6 A;  2Y6E A;  1AU3 A;  2PRE A;  4FK5 A;  5CVO B;  3I06 A;  1DEU A;  2FQ9 A;  1A6R A;  1ICF A;  3P5V A;  1PCI A;  2DC8 A;  2C0Y A;  1F2A A;  4PP2 E;  1AYW A;  1GMY A;  3H8C A;  4MZO A;  4CDC B;  2PNS A;  3MTN A;  3IV2 A;  3ERV A;  1AU2 A;  4PAD A;  4OEL A;  5J94 A;  1TLO A;  2FT2 A;  4Q8H A;  3IEJ A;  5CHV A;  3CBK A;  1E2T A;  1YK7 A;  2HXZ A;  1CVZ A;  2G8J A;  1PE6 A;  4X6J A;  1VJV A;  4W4U A;  4I07 A;  4OEM A;  2P7U A;  3OVX A;  3D6S A;  3P5U A;  8PCH A;  3TNX A;  3O0U A;  2F1G A;  1NQC A;  5F02 A;  4PI3 A;  3RVW A;  4XUI A;  3N3G A;  2VHF A;  3QJ3 A;  3OF8 A;  2HHN A;  3QT4 A;  1AU4 A;  2YJB A;  2ACT A;  1FH0 A;  1K3B B;  4NV8 A;  3BWK A;  3QSD A;  1KXR A;  3IHP A;  4I04 A;  3NHE A;  3E1Z B;  2AYN A;  2R9C A;  1U9X A;  2AVW A;  1GEC E;  3N3K A;  2FYE A;  5CVM A;  4PP1 A;  3LTW A;  2P86 A;  4AXM A;  1GLO A;  1CB5 A;  2AUX A;  3PW3 A;  2DJG B;  4YYQ A;  1SNK A;  2NQD B;  3F5V A;  4G54 A;  2DCA A;  4YV8 A;  7PCK A;  1PIP A;  3KFQ A;  1MS6 A;  1DF0 A;  1ZCM A;  2NQI A;  4X6H A;  5K16 A;  3V6E A;  4QBB A;  3AI8 A;  3HWN A;  3K24 A;  2E02 A;  2AU1 A;  1EWM A;  1EWL A;  2PAD A;  3H6S A;  4YYR A;  1IWD A;  2XU5 A;  1CTE A;  1CSB B;  4CDE B;  3MHS A;  3GCB A;  1U9W A;  4BPV A;  2DCC A;  3WXG A;  3U8E A;  2FTD A;  4AXL A;  3H89 A;  1QDQ A;  3IOQ A;  1PAD A;  1JQP A;  1M6D A;  4C5P A;  2AS8 A;  3KKU A;  1ZIV A;  3BPF A;  4MZS A;  5PAD A;  2DZZ A;  1U5I A;  2F7D A;  2GFO A;  1U9V A;  1PPP A;  2YJ8 A;  2CB5 A;  3HHI A;  4NV7 A;  2DCD A;  3C9E A;  2NQG A;  2AUZ A;  2AYO A;  3BOW A;  2OP3 A;  3PDF A;  3LFY A;  1AYU A;  4N4Z A;  4CDF B;  2O6X A;  1Y08 A;  3KX1 A;  1PPD A;  2G6D A;  1U9Q X;  4HWY A;  2FO5 A;  2DZY A;  1MIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...