2R9NA

Cathepsin s complexed with compound 26
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9nA00
1AYVA 2YJBA 5CVNB 1NQCA 2AS8A 1F2BA 8PCHA 1NB5A 2DCBA 4XUIA 5EF4A 3QT4A 2VHFA 1S4VA 3RVWA 3MTNA 1CSBB 2JQGR 2FUDA 3PNRA 4X6IA 4YYUA 3RVXA 4CDEB 1F29A 1Q6KA 4QRGA 2PNSA 1BY8A 1NL6A 4XR7A 4I05A 1PE6A 4PP2E 2ARYA 2JQFR 1VJVA 3KX1A 1AIMA 2AUXA 4OELA 2OZ2A 1PPNA 2B1MA 4CDDB 1CJLA 4QRXA 2H7JA 3MHHA 2BDZA 1JQPA 4QBBA 2E02A 1YVBA 4W4UA 4BS6A 1KFUL 1ME4A 3F75A 3S3QA 2CIOA 3B79A 3IV2A 1YT7A 4W5CA 4ZUXU 2G7YA 1STFE 2HHNA 3DF0A 5CVMA 2IBIA 1PXVA 4WA6A 3O0UA 1AYWA 2VHSA 3BPMA 4X6HA 4FIPA 4G54A 3MHSA 1QMYA 2PADA 3K24A 2Y5BA 4DMXA 2FRAA 1MDWA 2FTDA 1TU6A 2AYOA 3ERVA 4P6EA 3V6CA 3IUTA 3OVXA 2OULA 2DZZA 4P6GA 2G8EA 4FK5A 3QJ3A 1A6RA 2BDLA 2E01A 3BPFA 1SNKA 2XU3A 3H7DA 1QXPA 1O0EA 2CB5A 2G8JA 3I06A 3H8CA 3TNXA 3CH2X 2DC8A 1U9VA 1GMYA 1QOLA 3WXFA 3OF8A 1ZCMA 5CHVA 2O6XA 1AU2A 1MIRA 3KFQA 1CB5A 3P5XA 1ICFA 5JA7A 1U5IA 3H8BA 2DC6A 2YJCA 4BPVA 3BC3A 3IHPA 5CHTA 3HD3A 1KHQA 1TL9A 3KKUA 2Y6EA 4PADA 3N4CA 4I07A 1ITOA 1CVZA 3CBKA 3H89A 5EGWA 1PBHA 1EWLA 1DF0A 5K16A 1CS8A 2G6DA 2XU4A 2AVWA 2XU1A 2YJ9A 2DCCA 1PPOA 3F5VA 1CV8A 3OF9A 3HHAA 4BQVA 3CH3X 3NHEA 1NPZA 3IOQA 1ATKA 3MORA 1U9XA 3USVA 1DEUA 1AU0A 3N3GA 1Y08A 5CVOB 4YYVA 1CQDA 2NQGA 4YVAA 1ZIVA 4YV8A 4Q8HA 2E00A 1CTEA 2IPPB 1U9WA 2P0RA 2DC7A 2C0YA 3KWZA 3KWBX 2DJFB 3AI8A 2F1GA 1PPDA 1K3BB 2R9OA 2F7DA 1GECE 4OEMA 4CDFB 1POPA 1QDQA 4AXLA 1EWOA 3OISA 3P5VA 1FH0A 4KLBA 3IMAA 1X9YA 4CDCB 4YYSA 4BS5A 4YYWA 2R9FA 5FPWA 1AECA 1AU3A 4PP1A 5A24A 4YYQA 3K8UA 1Y4HA 1MEGA 5F02A 1EWPA 4I04A 3P5UA 3GCBA 2YJ8A 3BOWA 1YALA 4BSQA 1NLJA 3E1ZB 1PIPA 2B1NA 4Q8GA 2GFOA 3BCNA 1YK8A 3KSEA 1U9QX 2FYEA 2R9NA 2P86A 4HWYA 1KFXL 4YYRA 2ATOA 1SP4B 4W5BA 2XU5A 1TLOA 2DCAA 4X6JA 7PCKA 4AXMA 3K9MA 1BQIA 3U8EA 2DC9A 3WXEA 1XKGA 1BGOA 1MS6A 1YK7A 1PPPA 4MSXA 2R9MA 3V6EA 3I3TA 1MHWA 3LXSA 2FRQA 1PADA 2OP3A 5PADA 4N4ZA 3PW3A 1M6DA 3IEJA 3KW9A 2R9CA 4DMYA 3PBHA 2AIMA 3RVVA 1KHPA 3OVZA 3S3RA 1HUCB 2GHUA 1NB3A 2NQDB 1THEA 4MZOA 2ACTA 2AYNA 3P5WA 4N79A 3HWNA 2FT2A 1KXRA 3C9EA 3H6SA 3LFYA 1EWMA 1EF7A 1F2AA 3HHIA 4FJCA 9PAPA 1AYUA 1CPJA 2DCDA 3M99A 1IWDA 2AU1A 4K7CA 2P7UA 5JH3A 4CZWA 2E03A 3BWKA 4QH6A 2HD5A 1VSNA 2AUZA 1AU4A 1GLOA 6PADA 2NQIA 4MZSA 2PREA 2DJGB 1PCIA 2FO5A 2HXZA 2HH5A 3CBJA 4QRVA 3QSDA 4RY2A 1BP4A 3N3KA 3O1GA 4N8WA 2NQAA 2PBHA 2R6NA 2DZYA 1GCBA 1MEMA 3ZUAA 5J94A 2WBFX 1ME3A 4PI3A 2YJ2A 3PDFA 3WXGA 2FQ9A 3D6SA 1F2CA
chains in the Genus database with same CATH superfamily
3MTVA 1AYVA 2YJBA 5EZSA 5CVNB 4REZA 1NQCA 2AS8A 1F2BA 3W31A 8PCHA 1NB5A 3BY4A 2DCBA 4XUIA 3PSEA 5EF4A 3QT4A 2VHFA 1S4VA 3RVWA 3MTNA 4OVZB 1CSBB 2JQGR 2FUDA 3PNRA 4X6IA 4YYUA 3RVXA 4CDEB 3IFUA 1F29A 1Q6KA 3BB7A 2BTWA 3B21A 4QRGA 2PNSA 2J7QC 1BY8A 1NL6A 4XR7A 4I05A 1PE6A 4PP2E 2ARYA 2JQFR 1VJVA 3KX1A 1AIMA 2AUXA 4OELA 2OZ2A 1PPNA 2B1MA 4CDDB 4A5UA 1CJLA 4QRXA 2H7JA 3MHHA 2BDZA 1JQPA 4QBBA 1YZBA 2E02A 1YVBA 4W4UA 4BS6A 1KFUL 1ME4A 3F75A 3TRKA 3S3QA 2CIOA 3B79A 3IV2A 1YT7A 4W5CA 4ZUXU 2G7YA 1STFE 2HHNA 3DF0A 5CVMA 2JRIA 3PHUA 4IUMA 2IBIA 1PXVA 3TMPA 4WA6A 3O0UA 1AYWA 2VHSA 3BPMA 4X6HA 2FE8A 1PVJA 4FIPA 4G54A 3MHSA 3MP2A 1QMYA 2PADA 4RF0A 4RKXA 3K24A 2Y5BA 4DMXA 2FRAA 1MDWA 2FTDA 1TU6A 3PHWA 2AYOA 3ERVA 4P6EA 3V6CA 3IUTA 3OVXA 2OULA 3PRPA 2DZZA 4P6GA 2G8EA 4FK5A 3QJ3A 1A6RA 2UZJA 2BDLA 2E01A 3BPFA 1SNKA 2XU3A 2BTWB 3H7DA 1QXPA 1O0EA 2HWKA 2CB5A 2G8JA 3I06A 3H8CA 3TNXA 3CH2X 2DC8A 1U9VA 1GMYA 1QOLA 3WXFA 3OF8A 1ZCMA 5CHVA 2O6XA 1AU2A 1MIRA 3KFQA 1CB5A 3P5XA 1ICFA 5JA7A 1U5IA 3H8BA 2DC6A 2YJCA 4BPVA 3BC3A 3IHPA 5CHTA 3HD3A 1KHQA 1TL9A 3KKUA 2Y6EA 4PADA 3N4CA 4I07A 1ITOA 1CVZA 3CBKA 3H89A 5EGWA 1PBHA 1EWLA 1DF0A 4M0WA 5K16A 1CS8A 4WURA 3E9SA 2G6DA 2XU4A 2AVWA 2XU1A 2YJ9A 2DCCA 1PPOA 4BOQA 3F5VA 1CV8A 3OF9A 3HHAA 4BQVA 3CH3X 3NHEA 1NPZA 3IOQA 4BOPA 1ATKA 3MORA 2J7QA 2BU3A 1U9XA 3USVA 4D8EA 1DEUA 1AU0A 3N3GA 3W30A 1Y08A 5CVOB 4YYVA 1CQDA 2NQGA 3O65A 4YVAA 3RNVA 1ZIVA 4YV8A 4Q8HA 2E00A 1CTEA 4BOUA 2IPPB 4IP3A 1U9WA 2P0RA 2DC7A 2C0YA 3KWZA 3KWBX 2DJFB 3AI8A 2DOSA 2F1GA 1PPDA 1K3BB 2R9OA 2F7DA 1GECE 4OEMA 4CDFB 1POPA 1QDQA 4R3DA 4AXLA 5KO3A 1EWOA 3OISA 3P5VA 1FH0A 4KLBA 5JZEA 3IMAA 1X9YA 3PRMA 4CDCB 4YYSA 4BS5A 4YYWA 2R9FA 4MI7A 5FPWA 1AECA 1AU3A 4PP1A 5A24A 4YYQA 3K8UA 1Y4HA 1MEGA 5F02A 1EWPA 4I04A 4P16A 3P5UA 3BBAA 3GCBA 2YJ8A 4XZXA 3BOWA 3OQCA 1YALA 4BSQA 1NLJA 3E1ZB 1PIPA 2B1NA 4Q8GA 2GFOA 3BCNA 1YK8A 3KSEA 1U9QX 2FYEA 2R9NA 5E6JA 2P86A 4OW0A 4HWYA 4HXDB 1KFXL 4YYRA 2ATOA 1SP4B 4W5BA 1DKIA 2XU5A 1TLOA 2DCAA 4X6JA 7PCKA 3PHXA 4AXMA 3K9MA 1BQIA 3U8EA 4BOZA 2DC9A 3WXEA 1XKGA 1BGOA 1MS6A 1YK7A 2JTCA 1PPPA 4ZTBA 3ZNHA 4MSXA 2R9MA 3V6EA 3I3TA 1MHWA 3LXSA 1UKFA 2FRQA 1PADA 2OP3A 5PADA 4OVZA 4N4ZA 3PW3A 1M6DA 3IEJA 3KW9A 2R9CA 4DMYA 3PBHA 2AIMA 3RVVA 1KHPA 3OVZA 3S3RA 1HUCB 2GHUA 4RNAA 1NB3A 2NQDB 1THEA 4MZOA 2ACTA 2AYNA 3P5WA 4N79A 3HWNA 2FT2A 4BOSA 1KXRA 3PT2A 3C9EA 3H6SA 3LFYA 1EWMA 1EF7A 4RF1A 1F2AA 3HHIA 4FJCA 9PAPA 1AYUA 1CPJA 2DCDA 3M99A 1IWDA 2AU1A 5EZQA 4K7CA 2P7UA 5JH3A 4CZWA 2E03A 3BWKA 4QH6A 4GUAA 2HD5A 1VSNA 2AUZA 1AU4A 1GLOA 6PADA 2NQIA 4MZSA 2Z84A 2PREA 2DJGB 1PCIA 4MM3B 2FO5A 4D8BA 2HXZA 2HH5A 2AGAA 3CBJA 4QRVA 4PT5A 3QSDA 4RY2A 1BP4A 3N3KA 3O1GA 4N8WA 2NQAA 2PBHA 2R6NA 3MJ5A 2DZYA 1GCBA 4D8IA 1MEMA 3ZUAA 5J94A 2WBFX 1ME3A 4PI3A 2YJ2A 3PDFA 3C0RA 3WXGA 2FQ9A 3D6SA 1F2CA
chains in the Genus database with same CATH topology
1AYVA 2YJBA 5CVNB 1NQCA 2AS8A 1F2BA 8PCHA 1NB5A 4NV7A 2DCBA 4XUIA 4BGFA 5EF4A 3QT4A 1W4TA 2VHFA 4C5PA 1S4VA 3RVWA 3MTNA 1CSBB 2JQGR 2FUDA 3PNRA 4X6IA 4YYUA 1W6FA 3RVXA 4CDEB 1F29A 1Q6KA 4QRGA 2PNSA 1BY8A 1NL6A 4XR7A 4I05A 1PE6A 4PP2E 2ARYA 2JQFR 1VJVA 3KX1A 1AIMA 2AUXA 3LTWA 4OELA 2OZ2A 1PPNA 2B1MA 4CDDB 1CJLA 4QRXA 2H7JA 3MHHA 2BDZA 1JQPA 4QBBA 2E02A 1YVBA 4W4UA 4BS6A 1KFUL 1ME4A 3F75A 3S3QA 2CIOA 3B79A 3IV2A 1YT7A 4W5CA 4ZUXU 2G7YA 1STFE 2HHNA 3DF0A 5CVMA 2IBIA 1PXVA 4WA6A 3O0UA 1AYWA 2VHSA 3BPMA 4X6HA 4FIPA 4G54A 3MHSA 1QMYA 2PADA 4GUZA 3K24A 2Y5BA 4DMXA 2FRAA 1MDWA 2FTDA 1TU6A 2VFBA 2AYOA 3ERVA 4P6EA 3V6CA 1W5RA 3IUTA 3OVXA 2OULA 2DZZA 4P6GA 2G8EA 4FK5A 3QJ3A 1A6RA 2BDLA 2E01A 3BPFA 1SNKA 2XU3A 3H7DA 1QXPA 1O0EA 2CB5A 2G8JA 3I06A 3H8CA 3TNXA 3CH2X 2DC8A 1U9VA 1GMYA 1GX3A 1QOLA 3WXFA 4B55A 3OF8A 1ZCMA 5CHVA 2O6XA 1AU2A 1MIRA 3KFQA 1CB5A 3P5XA 1ICFA 5JA7A 1U5IA 3H8BA 2DC6A 2YJCA 4BPVA 3BC3A 3IHPA 5CHTA 3HD3A 1KHQA 1TL9A 3KKUA 2Y6EA 4PADA 3N4CA 4I07A 1ITOA 1CVZA 3CBKA 3H89A 5EGWA 1PBHA 1EWLA 3D9WA 1DF0A 5K16A 1CS8A 2G6DA 2XU4A 2AVWA 2XU1A 2YJ9A 2DCCA 1PPOA 3F5VA 1CV8A 3OF9A 3HHAA 4BQVA 3CH3X 3NHEA 1NPZA 3IOQA 1ATKA 3MORA 1U9XA 3USVA 1DEUA 1AU0A 3N3GA 1Y08A 5CVOB 4YYVA 1CQDA 2NQGA 4YVAA 1ZIVA 4YV8A 4Q8HA 2E00A 1CTEA 2IPPB 1U9WA 2P0RA 2DC7A 2C0YA 3KWZA 3KWBX 2DJFB 3AI8A 2F1GA 1PPDA 1K3BB 2R9OA 2F7DA 1GECE 4OEMA 4CDFB 1POPA 1QDQA 4AXLA 1EWOA 3OISA 3P5VA 1FH0A 4KLBA 3IMAA 1X9YA 4CDCB 4YYSA 4BS5A 4YYWA 2R9FA 5FPWA 1AECA 1AU3A 4PP1A 5A24A 4YYQA 3K8UA 1Y4HA 2BSZA 1MEGA 5F02A 1EWPA 4I04A 3P5UA 3GCBA 2YJ8A 3BOWA 1YALA 4BSQA 1NLJA 3E1ZB 1PIPA 2B1NA 4Q8GA 2GFOA 3BCNA 1YK8A 3KSEA 1U9QX 2FYEA 2R9NA 2P86A 4HWYA 1KFXL 4YYRA 2ATOA 1SP4B 4W5BA 2XU5A 1TLOA 2DCAA 4X6JA 7PCKA 4AXMA 2VFCA 3K9MA 1BQIA 3U8EA 2DC9A 3WXEA 1XKGA 1BGOA 1MS6A 1YK7A 1PPPA 4MSXA 2R9MA 3V6EA 3I3TA 1MHWA 3LXSA 2FRQA 1PADA 2OP3A 5PADA 4N4ZA 3PW3A 1M6DA 3IEJA 3KW9A 2R9CA 4DMYA 3PBHA 2AIMA 3RVVA 1KHPA 3OVZA 3S3RA 1HUCB 2GHUA 1NB3A 2NQDB 1THEA 4MZOA 2ACTA 2AYNA 3P5WA 4N79A 3HWNA 4NV8A 2FT2A 1KXRA 3C9EA 3H6SA 3LFYA 1EWMA 1EF7A 1F2AA 3HHIA 4FJCA 9PAPA 1AYUA 1CPJA 2DCDA 3M99A 1IWDA 2AU1A 4K7CA 2P7UA 5JH3A 4CZWA 2E03A 3BWKA 4QH6A 2HD5A 1VSNA 2AUZA 1AU4A 1E2TA 1GLOA 6PADA 2NQIA 4MZSA 2PREA 2DJGB 1PCIA 2FO5A 2HXZA 2HH5A 3CBJA 4QRVA 3QSDA 4RY2A 1BP4A 3N3KA 3O1GA 4N8WA 2NQAA 2PBHA 2R6NA 2DZYA 1GCBA 1MEMA 3ZUAA 5J94A 2WBFX 1ME3A 4PI3A 2YJ2A 3PDFA 3WXGA 2FQ9A 3D6SA 1F2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYV A;  2YJB A;  5CVN B;  1NQC A;  2AS8 A;  1F2B A;  8PCH A;  1NB5 A;  2DCB A;  4XUI A;  5EF4 A;  3QT4 A;  2VHF A;  1S4V A;  3RVW A;  3MTN A;  1CSB B;  2JQG R;  2FUD A;  3PNR A;  4X6I A;  4YYU A;  3RVX A;  4CDE B;  1F29 A;  1Q6K A;  4QRG A;  2PNS A;  1BY8 A;  1NL6 A;  4XR7 A;  4I05 A;  1PE6 A;  4PP2 E;  2ARY A;  2JQF R;  1VJV A;  3KX1 A;  1AIM A;  2AUX A;  4OEL A;  2OZ2 A;  1PPN A;  2B1M A;  4CDD B;  1CJL A;  4QRX A;  2H7J A;  3MHH A;  2BDZ A;  1JQP A;  4QBB A;  2E02 A;  1YVB A;  4W4U A;  4BS6 A;  1KFU L;  1ME4 A;  3F75 A;  3S3Q A;  2CIO A;  3B79 A;  3IV2 A;  1YT7 A;  4W5C A;  4ZUX U;  2G7Y A;  1STF E;  2HHN A;  3DF0 A;  5CVM A;  2IBI A;  1PXV A;  4WA6 A;  3O0U A;  1AYW A;  2VHS A;  3BPM A;  4X6H A;  4FIP A;  4G54 A;  3MHS A;  1QMY A;  2PAD A;  3K24 A;  2Y5B A;  4DMX A;  2FRA A;  1MDW A;  2FTD A;  1TU6 A;  2AYO A;  3ERV A;  4P6E A;  3V6C A;  3IUT A;  3OVX A;  2OUL A;  2DZZ A;  4P6G A;  2G8E A;  4FK5 A;  3QJ3 A;  1A6R A;  2BDL A;  2E01 A;  3BPF A;  1SNK A;  2XU3 A;  3H7D A;  1QXP A;  1O0E A;  2CB5 A;  2G8J A;  3I06 A;  3H8C A;  3TNX A;  3CH2 X;  2DC8 A;  1U9V A;  1GMY A;  1QOL A;  3WXF A;  3OF8 A;  1ZCM A;  5CHV A;  2O6X A;  1AU2 A;  1MIR A;  3KFQ A;  1CB5 A;  3P5X A;  1ICF A;  5JA7 A;  1U5I A;  3H8B A;  2DC6 A;  2YJC A;  4BPV A;  3BC3 A;  3IHP A;  5CHT A;  3HD3 A;  1KHQ A;  1TL9 A;  3KKU A;  2Y6E A;  4PAD A;  3N4C A;  4I07 A;  1ITO A;  1CVZ A;  3CBK A;  3H89 A;  5EGW A;  1PBH A;  1EWL A;  1DF0 A;  5K16 A;  1CS8 A;  2G6D A;  2XU4 A;  2AVW A;  2XU1 A;  2YJ9 A;  2DCC A;  1PPO A;  3F5V A;  1CV8 A;  3OF9 A;  3HHA A;  4BQV A;  3CH3 X;  3NHE A;  1NPZ A;  3IOQ A;  1ATK A;  3MOR A;  1U9X A;  3USV A;  1DEU A;  1AU0 A;  3N3G A;  1Y08 A;  5CVO B;  4YYV A;  1CQD A;  2NQG A;  4YVA A;  1ZIV A;  4YV8 A;  4Q8H A;  2E00 A;  1CTE A;  2IPP B;  1U9W A;  2P0R A;  2DC7 A;  2C0Y A;  3KWZ A;  3KWB X;  2DJF B;  3AI8 A;  2F1G A;  1PPD A;  1K3B B;  2R9O A;  2F7D A;  1GEC E;  4OEM A;  4CDF B;  1POP A;  1QDQ A;  4AXL A;  1EWO A;  3OIS A;  3P5V A;  1FH0 A;  4KLB A;  3IMA A;  1X9Y A;  4CDC B;  4YYS A;  4BS5 A;  4YYW A;  2R9F A;  5FPW A;  1AEC A;  1AU3 A;  4PP1 A;  5A24 A;  4YYQ A;  3K8U A;  1Y4H A;  1MEG A;  5F02 A;  1EWP A;  4I04 A;  3P5U A;  3GCB A;  2YJ8 A;  3BOW A;  1YAL A;  4BSQ A;  1NLJ A;  3E1Z B;  1PIP A;  2B1N A;  4Q8G A;  2GFO A;  3BCN A;  1YK8 A;  3KSE A;  1U9Q X;  2FYE A;  2R9N A;  2P86 A;  4HWY A;  1KFX L;  4YYR A;  2ATO A;  1SP4 B;  4W5B A;  2XU5 A;  1TLO A;  2DCA A;  4X6J A;  7PCK A;  4AXM A;  3K9M A;  1BQI A;  3U8E A;  2DC9 A;  3WXE A;  1XKG A;  1BGO A;  1MS6 A;  1YK7 A;  1PPP A;  4MSX A;  2R9M A;  3V6E A;  3I3T A;  1MHW A;  3LXS A;  2FRQ A;  1PAD A;  2OP3 A;  5PAD A;  4N4Z A;  3PW3 A;  1M6D A;  3IEJ A;  3KW9 A;  2R9C A;  4DMY A;  3PBH A;  2AIM A;  3RVV A;  1KHP A;  3OVZ A;  3S3R A;  1HUC B;  2GHU A;  1NB3 A;  2NQD B;  1THE A;  4MZO A;  2ACT A;  2AYN A;  3P5W A;  4N79 A;  3HWN A;  2FT2 A;  1KXR A;  3C9E A;  3H6S A;  3LFY A;  1EWM A;  1EF7 A;  1F2A A;  3HHI A;  4FJC A;  9PAP A;  1AYU A;  1CPJ A;  2DCD A;  3M99 A;  1IWD A;  2AU1 A;  4K7C A;  2P7U A;  5JH3 A;  4CZW A;  2E03 A;  3BWK A;  4QH6 A;  2HD5 A;  1VSN A;  2AUZ A;  1AU4 A;  1GLO A;  6PAD A;  2NQI A;  4MZS A;  2PRE A;  2DJG B;  1PCI A;  2FO5 A;  2HXZ A;  2HH5 A;  3CBJ A;  4QRV A;  3QSD A;  4RY2 A;  1BP4 A;  3N3K A;  3O1G A;  4N8W A;  2NQA A;  2PBH A;  2R6N A;  2DZY A;  1GCB A;  1MEM A;  3ZUA A;  5J94 A;  2WBF X;  1ME3 A;  4PI3 A;  2YJ2 A;  3PDF A;  3WXG A;  2FQ9 A;  3D6S A;  1F2C A; 
#chains in the Genus database with same CATH topology
 3MTV A;  1AYV A;  2YJB A;  5EZS A;  5CVN B;  4REZ A;  1NQC A;  2AS8 A;  1F2B A;  3W31 A;  8PCH A;  1NB5 A;  3BY4 A;  2DCB A;  4XUI A;  3PSE A;  5EF4 A;  3QT4 A;  2VHF A;  1S4V A;  3RVW A;  3MTN A;  4OVZ B;  1CSB B;  2JQG R;  2FUD A;  3PNR A;  4X6I A;  4YYU A;  3RVX A;  4CDE B;  3IFU A;  1F29 A;  1Q6K A;  3BB7 A;  2BTW A;  3B21 A;  4QRG A;  2PNS A;  2J7Q C;  1BY8 A;  1NL6 A;  4XR7 A;  4I05 A;  1PE6 A;  4PP2 E;  2ARY A;  2JQF R;  1VJV A;  3KX1 A;  1AIM A;  2AUX A;  4OEL A;  2OZ2 A;  1PPN A;  2B1M A;  4CDD B;  4A5U A;  1CJL A;  4QRX A;  2H7J A;  3MHH A;  2BDZ A;  1JQP A;  4QBB A;  1YZB A;  2E02 A;  1YVB A;  4W4U A;  4BS6 A;  1KFU L;  1ME4 A;  3F75 A;  3TRK A;  3S3Q A;  2CIO A;  3B79 A;  3IV2 A;  1YT7 A;  4W5C A;  4ZUX U;  2G7Y A;  1STF E;  2HHN A;  3DF0 A;  5CVM A;  2JRI A;  3PHU A;  4IUM A;  2IBI A;  1PXV A;  3TMP A;  4WA6 A;  3O0U A;  1AYW A;  2VHS A;  3BPM A;  4X6H A;  2FE8 A;  1PVJ A;  4FIP A;  4G54 A;  3MHS A;  3MP2 A;  1QMY A;  2PAD A;  4RF0 A;  4RKX A;  3K24 A;  2Y5B A;  4DMX A;  2FRA A;  1MDW A;  2FTD A;  1TU6 A;  3PHW A;  2AYO A;  3ERV A;  4P6E A;  3V6C A;  3IUT A;  3OVX A;  2OUL A;  3PRP A;  2DZZ A;  4P6G A;  2G8E A;  4FK5 A;  3QJ3 A;  1A6R A;  2UZJ A;  2BDL A;  2E01 A;  3BPF A;  1SNK A;  2XU3 A;  2BTW B;  3H7D A;  1QXP A;  1O0E A;  2HWK A;  2CB5 A;  2G8J A;  3I06 A;  3H8C A;  3TNX A;  3CH2 X;  2DC8 A;  1U9V A;  1GMY A;  1QOL A;  3WXF A;  3OF8 A;  1ZCM A;  5CHV A;  2O6X A;  1AU2 A;  1MIR A;  3KFQ A;  1CB5 A;  3P5X A;  1ICF A;  5JA7 A;  1U5I A;  3H8B A;  2DC6 A;  2YJC A;  4BPV A;  3BC3 A;  3IHP A;  5CHT A;  3HD3 A;  1KHQ A;  1TL9 A;  3KKU A;  2Y6E A;  4PAD A;  3N4C A;  4I07 A;  1ITO A;  1CVZ A;  3CBK A;  3H89 A;  5EGW A;  1PBH A;  1EWL A;  1DF0 A;  4M0W A;  5K16 A;  1CS8 A;  4WUR A;  3E9S A;  2G6D A;  2XU4 A;  2AVW A;  2XU1 A;  2YJ9 A;  2DCC A;  1PPO A;  4BOQ A;  3F5V A;  1CV8 A;  3OF9 A;  3HHA A;  4BQV A;  3CH3 X;  3NHE A;  1NPZ A;  3IOQ A;  4BOP A;  1ATK A;  3MOR A;  2J7Q A;  2BU3 A;  1U9X A;  3USV A;  4D8E A;  1DEU A;  1AU0 A;  3N3G A;  3W30 A;  1Y08 A;  5CVO B;  4YYV A;  1CQD A;  2NQG A;  3O65 A;  4YVA A;  3RNV A;  1ZIV A;  4YV8 A;  4Q8H A;  2E00 A;  1CTE A;  4BOU A;  2IPP B;  4IP3 A;  1U9W A;  2P0R A;  2DC7 A;  2C0Y A;  3KWZ A;  3KWB X;  2DJF B;  3AI8 A;  2DOS A;  2F1G A;  1PPD A;  1K3B B;  2R9O A;  2F7D A;  1GEC E;  4OEM A;  4CDF B;  1POP A;  1QDQ A;  4R3D A;  4AXL A;  5KO3 A;  1EWO A;  3OIS A;  3P5V A;  1FH0 A;  4KLB A;  5JZE A;  3IMA A;  1X9Y A;  3PRM A;  4CDC B;  4YYS A;  4BS5 A;  4YYW A;  2R9F A;  4MI7 A;  5FPW A;  1AEC A;  1AU3 A;  4PP1 A;  5A24 A;  4YYQ A;  3K8U A;  1Y4H A;  1MEG A;  5F02 A;  1EWP A;  4I04 A;  4P16 A;  3P5U A;  3BBA A;  3GCB A;  2YJ8 A;  4XZX A;  3BOW A;  3OQC A;  1YAL A;  4BSQ A;  1NLJ A;  3E1Z B;  1PIP A;  2B1N A;  4Q8G A;  2GFO A;  3BCN A;  1YK8 A;  3KSE A;  1U9Q X;  2FYE A;  2R9N A;  5E6J A;  2P86 A;  4OW0 A;  4HWY A;  4HXD B;  1KFX L;  4YYR A;  2ATO A;  1SP4 B;  4W5B A;  1DKI A;  2XU5 A;  1TLO A;  2DCA A;  4X6J A;  7PCK A;  3PHX A;  4AXM A;  3K9M A;  1BQI A;  3U8E A;  4BOZ A;  2DC9 A;  3WXE A;  1XKG A;  1BGO A;  1MS6 A;  1YK7 A;  2JTC A;  1PPP A;  4ZTB A;  3ZNH A;  4MSX A;  2R9M A;  3V6E A;  3I3T A;  1MHW A;  3LXS A;  1UKF A;  2FRQ A;  1PAD A;  2OP3 A;  5PAD A;  4OVZ A;  4N4Z A;  3PW3 A;  1M6D A;  3IEJ A;  3KW9 A;  2R9C A;  4DMY A;  3PBH A;  2AIM A;  3RVV A;  1KHP A;  3OVZ A;  3S3R A;  1HUC B;  2GHU A;  4RNA A;  1NB3 A;  2NQD B;  1THE A;  4MZO A;  2ACT A;  2AYN A;  3P5W A;  4N79 A;  3HWN A;  2FT2 A;  4BOS A;  1KXR A;  3PT2 A;  3C9E A;  3H6S A;  3LFY A;  1EWM A;  1EF7 A;  4RF1 A;  1F2A A;  3HHI A;  4FJC A;  9PAP A;  1AYU A;  1CPJ A;  2DCD A;  3M99 A;  1IWD A;  2AU1 A;  5EZQ A;  4K7C A;  2P7U A;  5JH3 A;  4CZW A;  2E03 A;  3BWK A;  4QH6 A;  4GUA A;  2HD5 A;  1VSN A;  2AUZ A;  1AU4 A;  1GLO A;  6PAD A;  2NQI A;  4MZS A;  2Z84 A;  2PRE A;  2DJG B;  1PCI A;  4MM3 B;  2FO5 A;  4D8B A;  2HXZ A;  2HH5 A;  2AGA A;  3CBJ A;  4QRV A;  4PT5 A;  3QSD A;  4RY2 A;  1BP4 A;  3N3K A;  3O1G A;  4N8W A;  2NQA A;  2PBH A;  2R6N A;  3MJ5 A;  2DZY A;  1GCB A;  4D8I A;  1MEM A;  3ZUA A;  5J94 A;  2WBF X;  1ME3 A;  4PI3 A;  2YJ2 A;  3PDF A;  3C0R A;  3WXG A;  2FQ9 A;  3D6S A;  1F2C A; 
#chains in the Genus database with same CATH homology
 1AYV A;  2YJB A;  5CVN B;  1NQC A;  2AS8 A;  1F2B A;  8PCH A;  1NB5 A;  4NV7 A;  2DCB A;  4XUI A;  4BGF A;  5EF4 A;  3QT4 A;  1W4T A;  2VHF A;  4C5P A;  1S4V A;  3RVW A;  3MTN A;  1CSB B;  2JQG R;  2FUD A;  3PNR A;  4X6I A;  4YYU A;  1W6F A;  3RVX A;  4CDE B;  1F29 A;  1Q6K A;  4QRG A;  2PNS A;  1BY8 A;  1NL6 A;  4XR7 A;  4I05 A;  1PE6 A;  4PP2 E;  2ARY A;  2JQF R;  1VJV A;  3KX1 A;  1AIM A;  2AUX A;  3LTW A;  4OEL A;  2OZ2 A;  1PPN A;  2B1M A;  4CDD B;  1CJL A;  4QRX A;  2H7J A;  3MHH A;  2BDZ A;  1JQP A;  4QBB A;  2E02 A;  1YVB A;  4W4U A;  4BS6 A;  1KFU L;  1ME4 A;  3F75 A;  3S3Q A;  2CIO A;  3B79 A;  3IV2 A;  1YT7 A;  4W5C A;  4ZUX U;  2G7Y A;  1STF E;  2HHN A;  3DF0 A;  5CVM A;  2IBI A;  1PXV A;  4WA6 A;  3O0U A;  1AYW A;  2VHS A;  3BPM A;  4X6H A;  4FIP A;  4G54 A;  3MHS A;  1QMY A;  2PAD A;  4GUZ A;  3K24 A;  2Y5B A;  4DMX A;  2FRA A;  1MDW A;  2FTD A;  1TU6 A;  2VFB A;  2AYO A;  3ERV A;  4P6E A;  3V6C A;  1W5R A;  3IUT A;  3OVX A;  2OUL A;  2DZZ A;  4P6G A;  2G8E A;  4FK5 A;  3QJ3 A;  1A6R A;  2BDL A;  2E01 A;  3BPF A;  1SNK A;  2XU3 A;  3H7D A;  1QXP A;  1O0E A;  2CB5 A;  2G8J A;  3I06 A;  3H8C A;  3TNX A;  3CH2 X;  2DC8 A;  1U9V A;  1GMY A;  1GX3 A;  1QOL A;  3WXF A;  4B55 A;  3OF8 A;  1ZCM A;  5CHV A;  2O6X A;  1AU2 A;  1MIR A;  3KFQ A;  1CB5 A;  3P5X A;  1ICF A;  5JA7 A;  1U5I A;  3H8B A;  2DC6 A;  2YJC A;  4BPV A;  3BC3 A;  3IHP A;  5CHT A;  3HD3 A;  1KHQ A;  1TL9 A;  3KKU A;  2Y6E A;  4PAD A;  3N4C A;  4I07 A;  1ITO A;  1CVZ A;  3CBK A;  3H89 A;  5EGW A;  1PBH A;  1EWL A;  3D9W A;  1DF0 A;  5K16 A;  1CS8 A;  2G6D A;  2XU4 A;  2AVW A;  2XU1 A;  2YJ9 A;  2DCC A;  1PPO A;  3F5V A;  1CV8 A;  3OF9 A;  3HHA A;  4BQV A;  3CH3 X;  3NHE A;  1NPZ A;  3IOQ A;  1ATK A;  3MOR A;  1U9X A;  3USV A;  1DEU A;  1AU0 A;  3N3G A;  1Y08 A;  5CVO B;  4YYV A;  1CQD A;  2NQG A;  4YVA A;  1ZIV A;  4YV8 A;  4Q8H A;  2E00 A;  1CTE A;  2IPP B;  1U9W A;  2P0R A;  2DC7 A;  2C0Y A;  3KWZ A;  3KWB X;  2DJF B;  3AI8 A;  2F1G A;  1PPD A;  1K3B B;  2R9O A;  2F7D A;  1GEC E;  4OEM A;  4CDF B;  1POP A;  1QDQ A;  4AXL A;  1EWO A;  3OIS A;  3P5V A;  1FH0 A;  4KLB A;  3IMA A;  1X9Y A;  4CDC B;  4YYS A;  4BS5 A;  4YYW A;  2R9F A;  5FPW A;  1AEC A;  1AU3 A;  4PP1 A;  5A24 A;  4YYQ A;  3K8U A;  1Y4H A;  2BSZ A;  1MEG A;  5F02 A;  1EWP A;  4I04 A;  3P5U A;  3GCB A;  2YJ8 A;  3BOW A;  1YAL A;  4BSQ A;  1NLJ A;  3E1Z B;  1PIP A;  2B1N A;  4Q8G A;  2GFO A;  3BCN A;  1YK8 A;  3KSE A;  1U9Q X;  2FYE A;  2R9N A;  2P86 A;  4HWY A;  1KFX L;  4YYR A;  2ATO A;  1SP4 B;  4W5B A;  2XU5 A;  1TLO A;  2DCA A;  4X6J A;  7PCK A;  4AXM A;  2VFC A;  3K9M A;  1BQI A;  3U8E A;  2DC9 A;  3WXE A;  1XKG A;  1BGO A;  1MS6 A;  1YK7 A;  1PPP A;  4MSX A;  2R9M A;  3V6E A;  3I3T A;  1MHW A;  3LXS A;  2FRQ A;  1PAD A;  2OP3 A;  5PAD A;  4N4Z A;  3PW3 A;  1M6D A;  3IEJ A;  3KW9 A;  2R9C A;  4DMY A;  3PBH A;  2AIM A;  3RVV A;  1KHP A;  3OVZ A;  3S3R A;  1HUC B;  2GHU A;  1NB3 A;  2NQD B;  1THE A;  4MZO A;  2ACT A;  2AYN A;  3P5W A;  4N79 A;  3HWN A;  4NV8 A;  2FT2 A;  1KXR A;  3C9E A;  3H6S A;  3LFY A;  1EWM A;  1EF7 A;  1F2A A;  3HHI A;  4FJC A;  9PAP A;  1AYU A;  1CPJ A;  2DCD A;  3M99 A;  1IWD A;  2AU1 A;  4K7C A;  2P7U A;  5JH3 A;  4CZW A;  2E03 A;  3BWK A;  4QH6 A;  2HD5 A;  1VSN A;  2AUZ A;  1AU4 A;  1E2T A;  1GLO A;  6PAD A;  2NQI A;  4MZS A;  2PRE A;  2DJG B;  1PCI A;  2FO5 A;  2HXZ A;  2HH5 A;  3CBJ A;  4QRV A;  3QSD A;  4RY2 A;  1BP4 A;  3N3K A;  3O1G A;  4N8W A;  2NQA A;  2PBH A;  2R6N A;  2DZY A;  1GCB A;  1MEM A;  3ZUA A;  5J94 A;  2WBF X;  1ME3 A;  4PI3 A;  2YJ2 A;  3PDF A;  3WXG A;  2FQ9 A;  3D6S A;  1F2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...