3P5UA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actinidin
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
molecule tags Hydrolase
total genus 70
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5uA00
1KHPA 3IHPA 3O0UA 3M99A 3CBJA 3NHEA 1GCBA 4X6JA 2AUXA 4CDFB 3MHHA 4KLBA 4CDEB 2YJ8A 3H8BA 1NL6A 3BWKA 3BPFA 3V6EA 1FH0A 1JQPA 3PNRA 2ARYA 1VJVA 3HHIA 2B1MA 1PIPA 2FQ9A 3I3TA 2OULA 1BP4A 2Y6EA 1KFXL 2GFOA 4DMXA 2BDZA 1MDWA 2R9FA 2PADA 3BOWA 2HXZA 2NQAA 4YYVA 4QRGA 1EWMA 2FRQA 4OELA 4K7CA 2FRAA 4YYSA 2R9CA 3CH3X 1THEA 1POPA 1ZCMA 3QJ3A 3D6SA 1PCIA 3E1ZB 3B79A 2E02A 1QDQA 4I05A 2YJCA 4N4ZA 1BQIA 1PE6A 2R9MA 2BDLA 2E01A 4YVAA 2E03A 3IEJA 1GLOA 2XU1A 2PNSA 6PADA 1AECA 2JQGR 3RVWA 4G54A 1S4VA 1TLOA 2YJBA 2PREA 5EGWA 3S3RA 2C0YA 3H89A 2VHFA 2HD5A 2AS8A 3PW3A 1EF7A 2AVWA 1PPOA 2XU4A 4AXLA 4N79A 4WA6A 4BS6A 1KFUL 2IPPB 1MEGA 4DMYA 1MIRA 4QH6A 1DEUA 1CQDA 1AU3A 2FTDA 1CTEA 1PADA 5J94A 8PCHA 1PPNA 2NQGA 1YALA 1SNKA 1BGOA 3P5UA 3RVXA 2F7DA 4FK5A 1AU0A 3KWZA 2AUZA 1CB5A 3U8EA 2P86A 3MTNA 3KX1A 2AYOA 4FJCA 1QMYA 3USVA 1TU6A 3HD3A 1Y08A 3P5WA 3F5VA 2E00A 4X6HA 3RVVA 1U9VA 2P0RA 3N3GA 1XKGA 2NQIA 1ZIVA 3IUTA 4BSQA 3ZUAA 1F2AA 1F2BA 2FO5A 9PAPA 1CJLA 2GHUA 1M6DA 1X9YA 2DC8A 2XU5A 2G8JA 1AU2A 1AIMA 3MORA 4MZOA 4FIPA 3TNXA 1ATKA 2R9NA 4W4UA 2OZ2A 3LXSA 4P6GA 3K8UA 1PBHA 1QXPA 1O0EA 2HH5A 3P5VA 4PP1A 3OF8A 1A6RA 3IMAA 1DF0A 2XU3A 2YJ9A 1ITOA 1YK7A 2WBFX 2DCAA 3CBKA 5CVNB 2FYEA 1YVBA 1ICFA 3O1GA 2DCBA 4Q8GA 2OP3A 3V6CA 1YT7A 1BY8A 1PPDA 1ME3A 1U9QX 1KXRA 5CVMA 2G7YA 1NPZA 2R6NA 3KKUA 3GCBA 2AIMA 3BCNA 2DZYA 3PDFA 1NB5A 4BS5A 3IV2A 1EWLA 2NQDB 4BPVA 4Q8HA 2DJGB 5JH3A 2VHSA 1NB3A 3AI8A 2CIOA 5EF4A 3LFYA 2AYNA 3WXGA 4PI3A 2JQFR 4CDDB 3H6SA 2DCCA 4OEMA 1MEMA 1NLJA 1AYVA 2G8EA 4XUIA 1AU4A 2DCDA 1PPPA 2G6DA 3N4CA 3CH2X 1CPJA 1EWPA 3C9EA 4N8WA 3OISA 2FT2A 4BQVA 2YJ2A 3BPMA 2DC7A 1K3BB 3QSDA 1CSBB 2ATOA 1PXVA 1AYUA 5PADA 1EWOA 1GMYA 5K16A 2CB5A 5A24A 4ZUXU 4W5BA 1KHQA 3K24A 1VSNA 3KWBX 4I04A 1IWDA 1CVZA 5CHVA 3H7DA 4PP2E 1STFE 3F75A 2F1GA 2FUDA 3OVZA 4YV8A 3BC3A 3WXEA 4YYUA 1CS8A 5F02A 3OF9A 2DZZA 1TL9A 4QRXA 4CDCB 2DC6A 2DC9A 1YK8A 1F29A 2HHNA 3H8CA 2ACTA 3KFQA 3K9MA 3IOQA 2AU1A 2O6XA 3P5XA 4PADA 1MHWA 4X6IA 3HHAA 4HWYA 4RY2A 3KW9A 2Y5BA 3KSEA 1U9WA 4I07A 4MZSA 1QOLA 4MSXA 1ME4A 3HWNA 3PBHA 2P7UA 3I06A 2PBHA 1GECE 5CVOB 4P6EA 7PCKA 1F2CA 4YYRA 3OVXA 3ERVA 2R9OA 2H7JA 4CZWA 2B1NA 5CHTA 1U5IA 4QBBA 3WXFA 1AYWA 1U9XA 4YYQA 1SP4B 3N3KA 5JA7A 4XR7A 1NQCA 3S3QA 3MHSA 4W5CA 3QT4A 1HUCB 1MS6A 1CV8A 2DJFB 5FPWA 2IBIA 4YYWA 4AXMA 3DF0A 1Y4HA 1Q6KA 4QRVA
chains in the Genus database with same CATH superfamily
1KHPA 4XZXA 3IHPA 3O0UA 3M99A 3CBJA 3NHEA 1GCBA 4X6JA 2AUXA 4CDFB 3MHHA 4KLBA 4CDEB 2YJ8A 3H8BA 1NL6A 3BWKA 3BPFA 3V6EA 4PT5A 4RF1A 1FH0A 1JQPA 3PNRA 2ARYA 1VJVA 3HHIA 2B1MA 1PIPA 2FQ9A 3I3TA 2OULA 1BP4A 2Y6EA 3TMPA 1KFXL 2GFOA 4DMXA 2BDZA 1MDWA 2R9FA 2PADA 3BOWA 2HXZA 2NQAA 4D8IA 4YYVA 4QRGA 1EWMA 2FRQA 5EZSA 4OELA 4K7CA 2FRAA 4YYSA 1DKIA 2R9CA 3CH3X 1THEA 1POPA 4R3DA 1ZCMA 3QJ3A 3D6SA 1PCIA 3E1ZB 3B79A 2E02A 2UZJA 1QDQA 4I05A 2YJCA 4N4ZA 1BQIA 3PRPA 5EZQA 1PE6A 2R9MA 2BDLA 3MP2A 2E01A 4YVAA 2E03A 3IEJA 1GLOA 2XU1A 2PNSA 6PADA 1PVJA 1AECA 2JQGR 3RVWA 4BOUA 4G54A 4RNAA 1S4VA 1TLOA 2YJBA 2PREA 5EGWA 3S3RA 2C0YA 3W31A 3H89A 2VHFA 2HD5A 2AS8A 4IUMA 3PW3A 1EF7A 4IP3A 2AVWA 1PPOA 2XU4A 4AXLA 2J7QA 4N79A 4WA6A 4BS6A 1KFUL 2IPPB 1MEGA 4DMYA 1MIRA 4QH6A 1DEUA 1CQDA 1AU3A 2FTDA 1CTEA 2HWKA 1PADA 5J94A 8PCHA 4BOPA 1PPNA 2NQGA 1YALA 1SNKA 1BGOA 3P5UA 3RVXA 2F7DA 4FK5A 1AU0A 3KWZA 2AUZA 1CB5A 3U8EA 2P86A 3MTNA 3KX1A 2AYOA 4FJCA 1QMYA 3USVA 4BOQA 1TU6A 3HD3A 1Y08A 3P5WA 3F5VA 2E00A 4X6HA 5E6JA 3RVVA 1U9VA 2P0RA 3N3GA 1XKGA 2NQIA 1ZIVA 3IUTA 2BU3A 4BSQA 3ZUAA 1F2AA 1F2BA 2FO5A 9PAPA 1CJLA 2GHUA 1M6DA 1X9YA 2DC8A 2XU5A 2G8JA 1AU2A 1AIMA 3MORA 4MZOA 4FIPA 3TNXA 1ATKA 2R9NA 4W4UA 2OZ2A 3LXSA 4P6GA 1UKFA 3K8UA 1PBHA 1QXPA 1O0EA 2HH5A 3P5VA 4PP1A 3OF8A 1A6RA 3IMAA 1DF0A 2XU3A 2AGAA 1ITOA 2YJ9A 1YK7A 2WBFX 2DCAA 4P16A 3CBKA 4MI7A 5CVNB 2FYEA 1YVBA 1ICFA 3O1GA 4OVZB 2DCBA 4Q8GA 2OP3A 3V6CA 1YT7A 1BY8A 2FE8A 3MTVA 3C0RA 1PPDA 1ME3A 1U9QX 1KXRA 5CVMA 2G7YA 1NPZA 5KO3A 2R6NA 3KKUA 3RNVA 3GCBA 2AIMA 3BCNA 2DZYA 3PDFA 1NB5A 4BS5A 3IV2A 1EWLA 2NQDB 4BPVA 3OQCA 4Q8HA 2DJGB 2J7QC 5JH3A 4BOZA 2VHSA 4WURA 1NB3A 3AI8A 2CIOA 5EF4A 3LFYA 2AYNA 2JTCA 3WXGA 4PI3A 3PHUA 2JQFR 4CDDB 3H6SA 2DCCA 4OEMA 4A5UA 3PT2A 1MEMA 1NLJA 2DOSA 1AYVA 2G8EA 4XUIA 1AU4A 2DCDA 1PPPA 2G6DA 3N4CA 3CH2X 1CPJA 1EWPA 3C9EA 4N8WA 3OISA 2FT2A 4BQVA 2YJ2A 3BPMA 2DC7A 4GUAA 1K3BB 3QSDA 1CSBB 2ATOA 1PXVA 1YZBA 1AYUA 5PADA 1EWOA 1GMYA 5K16A 2CB5A 5A24A 4ZUXU 4OW0A 4W5BA 1KHQA 3K24A 1VSNA 4HXDB 2BTWB 5JZEA 3KWBX 3MJ5A 4I04A 3B21A 3PRMA 1IWDA 1CVZA 5CHVA 3H7DA 4PP2E 1STFE 3F75A 2JRIA 2F1GA 2FUDA 4M0WA 2BTWA 3OVZA 3BBAA 3PSEA 4YV8A 3PHWA 3BC3A 3WXEA 4YYUA 1CS8A 5F02A 3OF9A 2DZZA 1TL9A 4QRXA 4CDCB 2DC6A 2DC9A 1YK8A 1F29A 2HHNA 3H8CA 2ACTA 4D8BA 3KFQA 3E9SA 3ZNHA 3K9MA 3W30A 3O65A 3IOQA 2AU1A 2O6XA 3BB7A 3P5XA 3PHXA 4OVZA 4PADA 1MHWA 4X6IA 3HHAA 4HWYA 4RY2A 3KW9A 3BY4A 2Y5BA 3KSEA 1U9WA 4MM3B 4I07A 4MZSA 1QOLA 4MSXA 1ME4A 3HWNA 3PBHA 2P7UA 3I06A 2PBHA 1GECE 5CVOB 4P6EA 7PCKA 1F2CA 4YYRA 3OVXA 3ERVA 2R9OA 2H7JA 4CZWA 2B1NA 5CHTA 1U5IA 4QBBA 4RKXA 3WXFA 1AYWA 1U9XA 4REZA 4YYQA 1SP4B 3N3KA 5JA7A 4XR7A 1NQCA 3S3QA 3MHSA 4W5CA 3IFUA 1HUCB 3QT4A 4RF0A 4ZTBA 1MS6A 3TRKA 1CV8A 2DJFB 2Z84A 5FPWA 2IBIA 4D8EA 4YYWA 4AXMA 3DF0A 1Y4HA 1Q6KA 4QRVA 4BOSA
chains in the Genus database with same CATH topology
1KHPA 3IHPA 3O0UA 3M99A 3CBJA 3NHEA 1GCBA 4X6JA 2AUXA 4CDFB 3MHHA 4KLBA 4CDEB 2YJ8A 3H8BA 1NL6A 3BWKA 3BPFA 3V6EA 1FH0A 1JQPA 3PNRA 2ARYA 1VJVA 1E2TA 3HHIA 2B1MA 1PIPA 2FQ9A 3I3TA 2OULA 1BP4A 2Y6EA 1KFXL 2GFOA 4DMXA 2BDZA 2VFBA 1MDWA 2R9FA 2PADA 3BOWA 2HXZA 2NQAA 4YYVA 4QRGA 1EWMA 2FRQA 4OELA 4K7CA 2FRAA 4YYSA 1GX3A 2R9CA 3CH3X 1THEA 1POPA 1ZCMA 3QJ3A 3D6SA 1PCIA 3E1ZB 3B79A 2E02A 1QDQA 4I05A 2YJCA 4N4ZA 1BQIA 1PE6A 2R9MA 2BDLA 2E01A 4YVAA 2E03A 3IEJA 1GLOA 2XU1A 2PNSA 6PADA 1AECA 2JQGR 3RVWA 4G54A 1S4VA 1TLOA 2YJBA 4NV7A 2PREA 5EGWA 3S3RA 2C0YA 3H89A 2VHFA 2HD5A 1W4TA 2AS8A 3PW3A 1EF7A 2AVWA 1PPOA 2XU4A 4AXLA 4N79A 4WA6A 4BS6A 1KFUL 2IPPB 1MEGA 4DMYA 1MIRA 4QH6A 1DEUA 1CQDA 1AU3A 2FTDA 1CTEA 1PADA 5J94A 8PCHA 1PPNA 2NQGA 1YALA 1SNKA 1BGOA 3P5UA 3RVXA 2F7DA 4FK5A 1AU0A 3D9WA 3KWZA 2AUZA 1CB5A 4B55A 3U8EA 2P86A 3MTNA 3KX1A 2AYOA 4FJCA 1QMYA 3USVA 1TU6A 3HD3A 1Y08A 3P5WA 3F5VA 2E00A 4X6HA 3RVVA 1U9VA 2BSZA 2P0RA 3N3GA 1XKGA 2NQIA 1ZIVA 3IUTA 4BSQA 3ZUAA 1F2AA 1F2BA 2FO5A 9PAPA 1CJLA 2GHUA 1M6DA 1X9YA 2DC8A 2XU5A 2G8JA 1AU2A 1AIMA 3MORA 4MZOA 4FIPA 3TNXA 1ATKA 2R9NA 4W4UA 2OZ2A 3LXSA 4P6GA 3K8UA 1PBHA 1QXPA 1O0EA 2HH5A 3P5VA 4PP1A 3OF8A 1A6RA 3IMAA 1DF0A 2XU3A 2YJ9A 1ITOA 1YK7A 2WBFX 2DCAA 3CBKA 5CVNB 2FYEA 1YVBA 1ICFA 3O1GA 2DCBA 4Q8GA 2OP3A 3V6CA 4BGFA 1YT7A 1BY8A 4C5PA 1PPDA 1ME3A 4NV8A 1U9QX 1KXRA 5CVMA 2G7YA 1NPZA 2R6NA 3KKUA 3GCBA 2AIMA 3BCNA 2DZYA 3PDFA 1NB5A 4BS5A 3IV2A 1EWLA 2NQDB 3LTWA 4BPVA 4Q8HA 2DJGB 5JH3A 2VHSA 1NB3A 3AI8A 4GUZA 2CIOA 5EF4A 3LFYA 2AYNA 3WXGA 2VFCA 4PI3A 2JQFR 4CDDB 3H6SA 2DCCA 4OEMA 1MEMA 1NLJA 1AYVA 2G8EA 4XUIA 1AU4A 2DCDA 1PPPA 2G6DA 3N4CA 3CH2X 1CPJA 1EWPA 3C9EA 4N8WA 1W6FA 3OISA 2FT2A 4BQVA 2YJ2A 3BPMA 2DC7A 1K3BB 3QSDA 1CSBB 2ATOA 1PXVA 1AYUA 5PADA 1EWOA 1GMYA 5K16A 2CB5A 5A24A 4ZUXU 4W5BA 1KHQA 3K24A 1VSNA 3KWBX 4I04A 1IWDA 1CVZA 5CHVA 3H7DA 4PP2E 1STFE 3F75A 2F1GA 2FUDA 3OVZA 4YV8A 3BC3A 3WXEA 4YYUA 1CS8A 5F02A 3OF9A 2DZZA 1TL9A 4QRXA 4CDCB 2DC6A 2DC9A 1YK8A 1F29A 2HHNA 3H8CA 2ACTA 3KFQA 1W5RA 3K9MA 3IOQA 2AU1A 2O6XA 3P5XA 4PADA 1MHWA 4X6IA 3HHAA 4HWYA 4RY2A 3KW9A 2Y5BA 3KSEA 1U9WA 4I07A 4MZSA 1QOLA 4MSXA 1ME4A 3HWNA 3PBHA 2P7UA 3I06A 2PBHA 1GECE 5CVOB 4P6EA 7PCKA 1F2CA 4YYRA 3OVXA 3ERVA 2R9OA 2H7JA 4CZWA 2B1NA 5CHTA 1U5IA 4QBBA 3WXFA 1AYWA 1U9XA 4YYQA 1SP4B 3N3KA 5JA7A 4XR7A 1NQCA 3S3QA 3MHSA 4W5CA 3QT4A 1HUCB 1MS6A 1CV8A 2DJFB 5FPWA 2IBIA 4YYWA 4AXMA 3DF0A 1Y4HA 1Q6KA 4QRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHP A;  3IHP A;  3O0U A;  3M99 A;  3CBJ A;  3NHE A;  1GCB A;  4X6J A;  2AUX A;  4CDF B;  3MHH A;  4KLB A;  4CDE B;  2YJ8 A;  3H8B A;  1NL6 A;  3BWK A;  3BPF A;  3V6E A;  1FH0 A;  1JQP A;  3PNR A;  2ARY A;  1VJV A;  3HHI A;  2B1M A;  1PIP A;  2FQ9 A;  3I3T A;  2OUL A;  1BP4 A;  2Y6E A;  1KFX L;  2GFO A;  4DMX A;  2BDZ A;  1MDW A;  2R9F A;  2PAD A;  3BOW A;  2HXZ A;  2NQA A;  4YYV A;  4QRG A;  1EWM A;  2FRQ A;  4OEL A;  4K7C A;  2FRA A;  4YYS A;  2R9C A;  3CH3 X;  1THE A;  1POP A;  1ZCM A;  3QJ3 A;  3D6S A;  1PCI A;  3E1Z B;  3B79 A;  2E02 A;  1QDQ A;  4I05 A;  2YJC A;  4N4Z A;  1BQI A;  1PE6 A;  2R9M A;  2BDL A;  2E01 A;  4YVA A;  2E03 A;  3IEJ A;  1GLO A;  2XU1 A;  2PNS A;  6PAD A;  1AEC A;  2JQG R;  3RVW A;  4G54 A;  1S4V A;  1TLO A;  2YJB A;  2PRE A;  5EGW A;  3S3R A;  2C0Y A;  3H89 A;  2VHF A;  2HD5 A;  2AS8 A;  3PW3 A;  1EF7 A;  2AVW A;  1PPO A;  2XU4 A;  4AXL A;  4N79 A;  4WA6 A;  4BS6 A;  1KFU L;  2IPP B;  1MEG A;  4DMY A;  1MIR A;  4QH6 A;  1DEU A;  1CQD A;  1AU3 A;  2FTD A;  1CTE A;  1PAD A;  5J94 A;  8PCH A;  1PPN A;  2NQG A;  1YAL A;  1SNK A;  1BGO A;  3P5U A;  3RVX A;  2F7D A;  4FK5 A;  1AU0 A;  3KWZ A;  2AUZ A;  1CB5 A;  3U8E A;  2P86 A;  3MTN A;  3KX1 A;  2AYO A;  4FJC A;  1QMY A;  3USV A;  1TU6 A;  3HD3 A;  1Y08 A;  3P5W A;  3F5V A;  2E00 A;  4X6H A;  3RVV A;  1U9V A;  2P0R A;  3N3G A;  1XKG A;  2NQI A;  1ZIV A;  3IUT A;  4BSQ A;  3ZUA A;  1F2A A;  1F2B A;  2FO5 A;  9PAP A;  1CJL A;  2GHU A;  1M6D A;  1X9Y A;  2DC8 A;  2XU5 A;  2G8J A;  1AU2 A;  1AIM A;  3MOR A;  4MZO A;  4FIP A;  3TNX A;  1ATK A;  2R9N A;  4W4U A;  2OZ2 A;  3LXS A;  4P6G A;  3K8U A;  1PBH A;  1QXP A;  1O0E A;  2HH5 A;  3P5V A;  4PP1 A;  3OF8 A;  1A6R A;  3IMA A;  1DF0 A;  2XU3 A;  2YJ9 A;  1ITO A;  1YK7 A;  2WBF X;  2DCA A;  3CBK A;  5CVN B;  2FYE A;  1YVB A;  1ICF A;  3O1G A;  2DCB A;  4Q8G A;  2OP3 A;  3V6C A;  1YT7 A;  1BY8 A;  1PPD A;  1ME3 A;  1U9Q X;  1KXR A;  5CVM A;  2G7Y A;  1NPZ A;  2R6N A;  3KKU A;  3GCB A;  2AIM A;  3BCN A;  2DZY A;  3PDF A;  1NB5 A;  4BS5 A;  3IV2 A;  1EWL A;  2NQD B;  4BPV A;  4Q8H A;  2DJG B;  5JH3 A;  2VHS A;  1NB3 A;  3AI8 A;  2CIO A;  5EF4 A;  3LFY A;  2AYN A;  3WXG A;  4PI3 A;  2JQF R;  4CDD B;  3H6S A;  2DCC A;  4OEM A;  1MEM A;  1NLJ A;  1AYV A;  2G8E A;  4XUI A;  1AU4 A;  2DCD A;  1PPP A;  2G6D A;  3N4C A;  3CH2 X;  1CPJ A;  1EWP A;  3C9E A;  4N8W A;  3OIS A;  2FT2 A;  4BQV A;  2YJ2 A;  3BPM A;  2DC7 A;  1K3B B;  3QSD A;  1CSB B;  2ATO A;  1PXV A;  1AYU A;  5PAD A;  1EWO A;  1GMY A;  5K16 A;  2CB5 A;  5A24 A;  4ZUX U;  4W5B A;  1KHQ A;  3K24 A;  1VSN A;  3KWB X;  4I04 A;  1IWD A;  1CVZ A;  5CHV A;  3H7D A;  4PP2 E;  1STF E;  3F75 A;  2F1G A;  2FUD A;  3OVZ A;  4YV8 A;  3BC3 A;  3WXE A;  4YYU A;  1CS8 A;  5F02 A;  3OF9 A;  2DZZ A;  1TL9 A;  4QRX A;  4CDC B;  2DC6 A;  2DC9 A;  1YK8 A;  1F29 A;  2HHN A;  3H8C A;  2ACT A;  3KFQ A;  3K9M A;  3IOQ A;  2AU1 A;  2O6X A;  3P5X A;  4PAD A;  1MHW A;  4X6I A;  3HHA A;  4HWY A;  4RY2 A;  3KW9 A;  2Y5B A;  3KSE A;  1U9W A;  4I07 A;  4MZS A;  1QOL A;  4MSX A;  1ME4 A;  3HWN A;  3PBH A;  2P7U A;  3I06 A;  2PBH A;  1GEC E;  5CVO B;  4P6E A;  7PCK A;  1F2C A;  4YYR A;  3OVX A;  3ERV A;  2R9O A;  2H7J A;  4CZW A;  2B1N A;  5CHT A;  1U5I A;  4QBB A;  3WXF A;  1AYW A;  1U9X A;  4YYQ A;  1SP4 B;  3N3K A;  5JA7 A;  4XR7 A;  1NQC A;  3S3Q A;  3MHS A;  4W5C A;  3QT4 A;  1HUC B;  1MS6 A;  1CV8 A;  2DJF B;  5FPW A;  2IBI A;  4YYW A;  4AXM A;  3DF0 A;  1Y4H A;  1Q6K A;  4QRV A; 
#chains in the Genus database with same CATH topology
 1KHP A;  4XZX A;  3IHP A;  3O0U A;  3M99 A;  3CBJ A;  3NHE A;  1GCB A;  4X6J A;  2AUX A;  4CDF B;  3MHH A;  4KLB A;  4CDE B;  2YJ8 A;  3H8B A;  1NL6 A;  3BWK A;  3BPF A;  3V6E A;  4PT5 A;  4RF1 A;  1FH0 A;  1JQP A;  3PNR A;  2ARY A;  1VJV A;  3HHI A;  2B1M A;  1PIP A;  2FQ9 A;  3I3T A;  2OUL A;  1BP4 A;  2Y6E A;  3TMP A;  1KFX L;  2GFO A;  4DMX A;  2BDZ A;  1MDW A;  2R9F A;  2PAD A;  3BOW A;  2HXZ A;  2NQA A;  4D8I A;  4YYV A;  4QRG A;  1EWM A;  2FRQ A;  5EZS A;  4OEL A;  4K7C A;  2FRA A;  4YYS A;  1DKI A;  2R9C A;  3CH3 X;  1THE A;  1POP A;  4R3D A;  1ZCM A;  3QJ3 A;  3D6S A;  1PCI A;  3E1Z B;  3B79 A;  2E02 A;  2UZJ A;  1QDQ A;  4I05 A;  2YJC A;  4N4Z A;  1BQI A;  3PRP A;  5EZQ A;  1PE6 A;  2R9M A;  2BDL A;  3MP2 A;  2E01 A;  4YVA A;  2E03 A;  3IEJ A;  1GLO A;  2XU1 A;  2PNS A;  6PAD A;  1PVJ A;  1AEC A;  2JQG R;  3RVW A;  4BOU A;  4G54 A;  4RNA A;  1S4V A;  1TLO A;  2YJB A;  2PRE A;  5EGW A;  3S3R A;  2C0Y A;  3W31 A;  3H89 A;  2VHF A;  2HD5 A;  2AS8 A;  4IUM A;  3PW3 A;  1EF7 A;  4IP3 A;  2AVW A;  1PPO A;  2XU4 A;  4AXL A;  2J7Q A;  4N79 A;  4WA6 A;  4BS6 A;  1KFU L;  2IPP B;  1MEG A;  4DMY A;  1MIR A;  4QH6 A;  1DEU A;  1CQD A;  1AU3 A;  2FTD A;  1CTE A;  2HWK A;  1PAD A;  5J94 A;  8PCH A;  4BOP A;  1PPN A;  2NQG A;  1YAL A;  1SNK A;  1BGO A;  3P5U A;  3RVX A;  2F7D A;  4FK5 A;  1AU0 A;  3KWZ A;  2AUZ A;  1CB5 A;  3U8E A;  2P86 A;  3MTN A;  3KX1 A;  2AYO A;  4FJC A;  1QMY A;  3USV A;  4BOQ A;  1TU6 A;  3HD3 A;  1Y08 A;  3P5W A;  3F5V A;  2E00 A;  4X6H A;  5E6J A;  3RVV A;  1U9V A;  2P0R A;  3N3G A;  1XKG A;  2NQI A;  1ZIV A;  3IUT A;  2BU3 A;  4BSQ A;  3ZUA A;  1F2A A;  1F2B A;  2FO5 A;  9PAP A;  1CJL A;  2GHU A;  1M6D A;  1X9Y A;  2DC8 A;  2XU5 A;  2G8J A;  1AU2 A;  1AIM A;  3MOR A;  4MZO A;  4FIP A;  3TNX A;  1ATK A;  2R9N A;  4W4U A;  2OZ2 A;  3LXS A;  4P6G A;  1UKF A;  3K8U A;  1PBH A;  1QXP A;  1O0E A;  2HH5 A;  3P5V A;  4PP1 A;  3OF8 A;  1A6R A;  3IMA A;  1DF0 A;  2XU3 A;  2AGA A;  1ITO A;  2YJ9 A;  1YK7 A;  2WBF X;  2DCA A;  4P16 A;  3CBK A;  4MI7 A;  5CVN B;  2FYE A;  1YVB A;  1ICF A;  3O1G A;  4OVZ B;  2DCB A;  4Q8G A;  2OP3 A;  3V6C A;  1YT7 A;  1BY8 A;  2FE8 A;  3MTV A;  3C0R A;  1PPD A;  1ME3 A;  1U9Q X;  1KXR A;  5CVM A;  2G7Y A;  1NPZ A;  5KO3 A;  2R6N A;  3KKU A;  3RNV A;  3GCB A;  2AIM A;  3BCN A;  2DZY A;  3PDF A;  1NB5 A;  4BS5 A;  3IV2 A;  1EWL A;  2NQD B;  4BPV A;  3OQC A;  4Q8H A;  2DJG B;  2J7Q C;  5JH3 A;  4BOZ A;  2VHS A;  4WUR A;  1NB3 A;  3AI8 A;  2CIO A;  5EF4 A;  3LFY A;  2AYN A;  2JTC A;  3WXG A;  4PI3 A;  3PHU A;  2JQF R;  4CDD B;  3H6S A;  2DCC A;  4OEM A;  4A5U A;  3PT2 A;  1MEM A;  1NLJ A;  2DOS A;  1AYV A;  2G8E A;  4XUI A;  1AU4 A;  2DCD A;  1PPP A;  2G6D A;  3N4C A;  3CH2 X;  1CPJ A;  1EWP A;  3C9E A;  4N8W A;  3OIS A;  2FT2 A;  4BQV A;  2YJ2 A;  3BPM A;  2DC7 A;  4GUA A;  1K3B B;  3QSD A;  1CSB B;  2ATO A;  1PXV A;  1YZB A;  1AYU A;  5PAD A;  1EWO A;  1GMY A;  5K16 A;  2CB5 A;  5A24 A;  4ZUX U;  4OW0 A;  4W5B A;  1KHQ A;  3K24 A;  1VSN A;  4HXD B;  2BTW B;  5JZE A;  3KWB X;  3MJ5 A;  4I04 A;  3B21 A;  3PRM A;  1IWD A;  1CVZ A;  5CHV A;  3H7D A;  4PP2 E;  1STF E;  3F75 A;  2JRI A;  2F1G A;  2FUD A;  4M0W A;  2BTW A;  3OVZ A;  3BBA A;  3PSE A;  4YV8 A;  3PHW A;  3BC3 A;  3WXE A;  4YYU A;  1CS8 A;  5F02 A;  3OF9 A;  2DZZ A;  1TL9 A;  4QRX A;  4CDC B;  2DC6 A;  2DC9 A;  1YK8 A;  1F29 A;  2HHN A;  3H8C A;  2ACT A;  4D8B A;  3KFQ A;  3E9S A;  3ZNH A;  3K9M A;  3W30 A;  3O65 A;  3IOQ A;  2AU1 A;  2O6X A;  3BB7 A;  3P5X A;  3PHX A;  4OVZ A;  4PAD A;  1MHW A;  4X6I A;  3HHA A;  4HWY A;  4RY2 A;  3KW9 A;  3BY4 A;  2Y5B A;  3KSE A;  1U9W A;  4MM3 B;  4I07 A;  4MZS A;  1QOL A;  4MSX A;  1ME4 A;  3HWN A;  3PBH A;  2P7U A;  3I06 A;  2PBH A;  1GEC E;  5CVO B;  4P6E A;  7PCK A;  1F2C A;  4YYR A;  3OVX A;  3ERV A;  2R9O A;  2H7J A;  4CZW A;  2B1N A;  5CHT A;  1U5I A;  4QBB A;  4RKX A;  3WXF A;  1AYW A;  1U9X A;  4REZ A;  4YYQ A;  1SP4 B;  3N3K A;  5JA7 A;  4XR7 A;  1NQC A;  3S3Q A;  3MHS A;  4W5C A;  3IFU A;  1HUC B;  3QT4 A;  4RF0 A;  4ZTB A;  1MS6 A;  3TRK A;  1CV8 A;  2DJF B;  2Z84 A;  5FPW A;  2IBI A;  4D8E A;  4YYW A;  4AXM A;  3DF0 A;  1Y4H A;  1Q6K A;  4QRV A;  4BOS A; 
#chains in the Genus database with same CATH homology
 1KHP A;  3IHP A;  3O0U A;  3M99 A;  3CBJ A;  3NHE A;  1GCB A;  4X6J A;  2AUX A;  4CDF B;  3MHH A;  4KLB A;  4CDE B;  2YJ8 A;  3H8B A;  1NL6 A;  3BWK A;  3BPF A;  3V6E A;  1FH0 A;  1JQP A;  3PNR A;  2ARY A;  1VJV A;  1E2T A;  3HHI A;  2B1M A;  1PIP A;  2FQ9 A;  3I3T A;  2OUL A;  1BP4 A;  2Y6E A;  1KFX L;  2GFO A;  4DMX A;  2BDZ A;  2VFB A;  1MDW A;  2R9F A;  2PAD A;  3BOW A;  2HXZ A;  2NQA A;  4YYV A;  4QRG A;  1EWM A;  2FRQ A;  4OEL A;  4K7C A;  2FRA A;  4YYS A;  1GX3 A;  2R9C A;  3CH3 X;  1THE A;  1POP A;  1ZCM A;  3QJ3 A;  3D6S A;  1PCI A;  3E1Z B;  3B79 A;  2E02 A;  1QDQ A;  4I05 A;  2YJC A;  4N4Z A;  1BQI A;  1PE6 A;  2R9M A;  2BDL A;  2E01 A;  4YVA A;  2E03 A;  3IEJ A;  1GLO A;  2XU1 A;  2PNS A;  6PAD A;  1AEC A;  2JQG R;  3RVW A;  4G54 A;  1S4V A;  1TLO A;  2YJB A;  4NV7 A;  2PRE A;  5EGW A;  3S3R A;  2C0Y A;  3H89 A;  2VHF A;  2HD5 A;  1W4T A;  2AS8 A;  3PW3 A;  1EF7 A;  2AVW A;  1PPO A;  2XU4 A;  4AXL A;  4N79 A;  4WA6 A;  4BS6 A;  1KFU L;  2IPP B;  1MEG A;  4DMY A;  1MIR A;  4QH6 A;  1DEU A;  1CQD A;  1AU3 A;  2FTD A;  1CTE A;  1PAD A;  5J94 A;  8PCH A;  1PPN A;  2NQG A;  1YAL A;  1SNK A;  1BGO A;  3P5U A;  3RVX A;  2F7D A;  4FK5 A;  1AU0 A;  3D9W A;  3KWZ A;  2AUZ A;  1CB5 A;  4B55 A;  3U8E A;  2P86 A;  3MTN A;  3KX1 A;  2AYO A;  4FJC A;  1QMY A;  3USV A;  1TU6 A;  3HD3 A;  1Y08 A;  3P5W A;  3F5V A;  2E00 A;  4X6H A;  3RVV A;  1U9V A;  2BSZ A;  2P0R A;  3N3G A;  1XKG A;  2NQI A;  1ZIV A;  3IUT A;  4BSQ A;  3ZUA A;  1F2A A;  1F2B A;  2FO5 A;  9PAP A;  1CJL A;  2GHU A;  1M6D A;  1X9Y A;  2DC8 A;  2XU5 A;  2G8J A;  1AU2 A;  1AIM A;  3MOR A;  4MZO A;  4FIP A;  3TNX A;  1ATK A;  2R9N A;  4W4U A;  2OZ2 A;  3LXS A;  4P6G A;  3K8U A;  1PBH A;  1QXP A;  1O0E A;  2HH5 A;  3P5V A;  4PP1 A;  3OF8 A;  1A6R A;  3IMA A;  1DF0 A;  2XU3 A;  2YJ9 A;  1ITO A;  1YK7 A;  2WBF X;  2DCA A;  3CBK A;  5CVN B;  2FYE A;  1YVB A;  1ICF A;  3O1G A;  2DCB A;  4Q8G A;  2OP3 A;  3V6C A;  4BGF A;  1YT7 A;  1BY8 A;  4C5P A;  1PPD A;  1ME3 A;  4NV8 A;  1U9Q X;  1KXR A;  5CVM A;  2G7Y A;  1NPZ A;  2R6N A;  3KKU A;  3GCB A;  2AIM A;  3BCN A;  2DZY A;  3PDF A;  1NB5 A;  4BS5 A;  3IV2 A;  1EWL A;  2NQD B;  3LTW A;  4BPV A;  4Q8H A;  2DJG B;  5JH3 A;  2VHS A;  1NB3 A;  3AI8 A;  4GUZ A;  2CIO A;  5EF4 A;  3LFY A;  2AYN A;  3WXG A;  2VFC A;  4PI3 A;  2JQF R;  4CDD B;  3H6S A;  2DCC A;  4OEM A;  1MEM A;  1NLJ A;  1AYV A;  2G8E A;  4XUI A;  1AU4 A;  2DCD A;  1PPP A;  2G6D A;  3N4C A;  3CH2 X;  1CPJ A;  1EWP A;  3C9E A;  4N8W A;  1W6F A;  3OIS A;  2FT2 A;  4BQV A;  2YJ2 A;  3BPM A;  2DC7 A;  1K3B B;  3QSD A;  1CSB B;  2ATO A;  1PXV A;  1AYU A;  5PAD A;  1EWO A;  1GMY A;  5K16 A;  2CB5 A;  5A24 A;  4ZUX U;  4W5B A;  1KHQ A;  3K24 A;  1VSN A;  3KWB X;  4I04 A;  1IWD A;  1CVZ A;  5CHV A;  3H7D A;  4PP2 E;  1STF E;  3F75 A;  2F1G A;  2FUD A;  3OVZ A;  4YV8 A;  3BC3 A;  3WXE A;  4YYU A;  1CS8 A;  5F02 A;  3OF9 A;  2DZZ A;  1TL9 A;  4QRX A;  4CDC B;  2DC6 A;  2DC9 A;  1YK8 A;  1F29 A;  2HHN A;  3H8C A;  2ACT A;  3KFQ A;  1W5R A;  3K9M A;  3IOQ A;  2AU1 A;  2O6X A;  3P5X A;  4PAD A;  1MHW A;  4X6I A;  3HHA A;  4HWY A;  4RY2 A;  3KW9 A;  2Y5B A;  3KSE A;  1U9W A;  4I07 A;  4MZS A;  1QOL A;  4MSX A;  1ME4 A;  3HWN A;  3PBH A;  2P7U A;  3I06 A;  2PBH A;  1GEC E;  5CVO B;  4P6E A;  7PCK A;  1F2C A;  4YYR A;  3OVX A;  3ERV A;  2R9O A;  2H7J A;  4CZW A;  2B1N A;  5CHT A;  1U5I A;  4QBB A;  3WXF A;  1AYW A;  1U9X A;  4YYQ A;  1SP4 B;  3N3K A;  5JA7 A;  4XR7 A;  1NQC A;  3S3Q A;  3MHS A;  4W5C A;  3QT4 A;  1HUC B;  1MS6 A;  1CV8 A;  2DJF B;  5FPW A;  2IBI A;  4YYW A;  4AXM A;  3DF0 A;  1Y4H A;  1Q6K A;  4QRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...