3P5UA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Actinidin
total genus 70
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5uA00
3KX1A 3H8BA 3H8CA 2PREA 3IEJA 2XU3A 3BC3A 5CHVA 5JA7A 4G54A 1HUCB 1DEUA 3LFYA 3S3QA 2DJFB 1NB5A 3CBJA 2H7JA 1X9YA 2OZ2A 1Q6KA 2AYOA 3MORA 4CDCB 2DZZA 2E00A 3DF0A 3WXGA 1EF7A 1EWOA 5A24A 1KFXL 1NPZA 2WBFX 4YYWA 4FK5A 1THEA 1PE6A 1S4VA 2DCCA 3C9EA 4QH6A 2B1MA 5CVNB 2PADA 4AXLA 3MTNA 1JQPA 3I06A 1CB5A 1AYVA 2PNSA 4PADA 4X6IA 4BSQA 2YJCA 1AU3A 2IPPB 3QJ3A 3P5UA 1F2AA 1GECE 2DCDA 1AYWA 2CB5A 7PCKA 1NL6A 3PBHA 2PBHA 3KKUA 4QRGA 5PADA 4QRVA 1A6RA 4RY2A 2O6XA 4N79A 4PP2E 1QMYA 2P0RA 1CTEA 1TL9A 1U9XA 3K24A 3BCNA 1SP4B 1ME3A 3CH2X 2R9MA 2R6NA 1FH0A 1XKGA 1BQIA 1YVBA 4W5CA 3IV2A 3RVWA 5CHTA 4YYRA 2ATOA 4QRXA 3OISA 3KFQA 2HHNA 2DCAA 1AIMA 2ARYA 2DJGB 1CPJA 1KHPA 2CIOA 2E01A 4KLBA 1ICFA 4DMYA 1VJVA 5CVMA 5K16A 2B1NA 2HXZA 1YALA 1NQCA 1CS8A 4BQVA 4CDEB 2R9NA 2DZYA 2XU1A 1EWMA 3IUTA 1PIPA 4Q8GA 3E1ZB 4CZWA 4CDFB 4FJCA 3I3TA 3S3RA 1CQDA 1QDQA 1ITOA 1AECA 3ERVA 2AS8A 3M99A 3WXEA 1YK8A 3F75A 3KWZA 2G7YA 2JQGR 3QSDA 1O0EA 4I05A 3F5VA 1POPA 4YYVA 4WA6A 3PW3A 4ZUXU 1MDWA 3O0UA 4K7CA 4FIPA 3KSEA 1DF0A 1GLOA 1U5IA 2FQ9A 2F1GA 1PXVA 3IOQA 1U9VA 4XR7A 4CDDB 2AIMA 1VSNA 3AI8A 2FUDA 1ZCMA 2G8JA 3D6SA 2YJBA 3ZUAA 2FRQA 2FO5A 3IMAA 4I04A 2FT2A 2R9OA 1PADA 1KFUL 3LXSA 2AUXA 5EF4A 3O1GA 1TLOA 2E03A 4X6HA 4P6GA 1NB3A 2FYEA 3IHPA 4N4ZA 2XU5A 4YV8A 3MHSA 3PDFA 1U9WA 4W5BA 1MS6A 5F02A 3OF9A 2JQFR 2P7UA 4Q8HA 1ME4A 2DC7A 5EGWA 4YYSA 1PPDA 5CVOB 1MIRA 2FTDA 3RVXA 1PPNA 1K3BB 3BWKA 3NHEA 1QXPA 4OELA 1EWLA 3KWBX 1M6DA 1TU6A 1KXRA 1F29A 4W4UA 3OVZA 1PPOA 2AU1A 1MEMA 4QBBA 3P5VA 8PCHA 4OEMA 2YJ8A 2VHFA 3TNXA 1YK7A 2Y5BA 4BS6A 3HHIA 2G8EA 1AYUA 3PNRA 4BPVA 3N3GA 1IWDA 4YYQA 4MSXA 1GCBA 3H6SA 1SNKA 1EWPA 2AVWA 2C0YA 2DC9A 3USVA 2BDLA 2OP3A 4BS5A 2ACTA 1F2CA 3GCBA 4P6EA 3HWNA 9PAPA 3QT4A 4X6JA 2NQDB 2Y6EA 3OF8A 2IBIA 2YJ2A 3P5XA 1KHQA 1CJLA 1PCIA 2NQIA 3U8EA 1AU0A 3B79A 3KW9A 3BPFA 2OULA 1CVZA 4HWYA 1CV8A 1ZIVA 4I07A 1NLJA 3BOWA 6PADA 2AUZA 1STFE 2BDZA 1AU4A 2HD5A 2NQGA 2R9CA 4XUIA 2GHUA 3WXFA 5JH3A 2AYNA 4MZOA 3CH3X 4N8WA 3H89A 1BGOA 1YT7A 3H7DA 3MHHA 2F7DA 1BP4A 2VHSA 4DMXA 1GMYA 3RVVA 3N3KA 2GFOA 1QOLA 1MEGA 4YYUA 3HD3A 2FRAA 1PPPA 5J94A 2E02A 1F2BA 2R9FA 2DC6A 1MHWA 5FPWA 1ATKA 2G6DA 3OVXA 1BY8A 3P5WA 3BPMA 4PP1A 2HH5A 1Y08A 3K9MA 2XU4A 1PBHA 2P86A 3V6CA 4AXMA 1CSBB 2DC8A 2DCBA 3HHAA 4YVAA 3V6EA 3K8UA 2NQAA 1Y4HA 2YJ9A 3CBKA 3N4CA 1U9QX 4MZSA 4PI3A 1AU2A
chains in the Genus database with same CATH superfamily
3KX1A 3H8BA 3H8CA 2PREA 3IEJA 2XU3A 3BC3A 3PHXA 4D8BA 5CHVA 5JA7A 3W30A 4G54A 4BOZA 1HUCB 3MTVA 1DEUA 3LFYA 3S3QA 2DJFB 1NB5A 3CBJA 2H7JA 1X9YA 2OZ2A 1Q6KA 4BOPA 2AYOA 3MORA 4CDCB 2DZZA 2E00A 2UZJA 3DF0A 3WXGA 1EF7A 1EWOA 2Z84A 5A24A 1KFXL 2J7QC 1NPZA 2WBFX 4YYWA 4FK5A 1THEA 1PE6A 1S4VA 2DCCA 3C9EA 4QH6A 3OQCA 2B1MA 5CVNB 2PADA 4AXLA 3MTNA 1JQPA 3I06A 1CB5A 3TRKA 1AYVA 2PNSA 4PADA 4X6IA 4BSQA 4D8EA 2HWKA 2YJCA 1AU3A 2IPPB 3QJ3A 3P5UA 1F2AA 1GECE 2DCDA 4WURA 1AYWA 2CB5A 7PCKA 1NL6A 3PBHA 2PBHA 3KKUA 4QRGA 5PADA 4QRVA 1A6RA 4RY2A 2O6XA 4N79A 4PP2E 1QMYA 3MJ5A 2P0RA 1CTEA 1TL9A 1UKFA 4ZTBA 1U9XA 3K24A 3BCNA 1SP4B 5EZQA 1ME3A 3CH2X 3BBAA 2R9MA 2R6NA 1FH0A 1XKGA 1BQIA 1YVBA 3E9SA 4W5CA 4P16A 3IV2A 3RVWA 5CHTA 4M0WA 3C0RA 4YYRA 2ATOA 4QRXA 3OISA 3KFQA 4BOSA 2HHNA 2DCAA 1AIMA 2ARYA 2DJGB 1CPJA 1KHPA 2CIOA 2E01A 4KLBA 1ICFA 4DMYA 1VJVA 5CVMA 5K16A 2B1NA 2HXZA 1YALA 1NQCA 1CS8A 4BQVA 4CDEB 2R9NA 2DZYA 2XU1A 1EWMA 3IUTA 1PIPA 2BU3A 4Q8GA 3E1ZB 4CZWA 4CDFB 4FJCA 3I3TA 3S3RA 1CQDA 5KO3A 1QDQA 4BOQA 1ITOA 1AECA 3ERVA 2AS8A 3M99A 3WXEA 1YK8A 3F75A 1PVJA 3KWZA 2G7YA 2JQGR 3QSDA 4RKXA 4RF0A 1O0EA 4I05A 3F5VA 2BTWA 1POPA 4A5UA 4YYVA 4WA6A 3PW3A 4ZUXU 1MDWA 3PRMA 3O0UA 3PT2A 4K7CA 4FIPA 3KSEA 1DF0A 1GLOA 1U5IA 2FQ9A 2F1GA 1PXVA 3BB7A 3IOQA 1U9VA 4XR7A 4CDDB 2AIMA 1VSNA 4GUAA 3AI8A 2FUDA 1ZCMA 2G8JA 3D6SA 2YJBA 3PHWA 3ZUAA 2FRQA 2FO5A 3IMAA 4MM3B 4I04A 2FT2A 2R9OA 1PADA 1KFUL 2AGAA 3LXSA 2AUXA 3B21A 4MI7A 5EF4A 2DOSA 4RNAA 3O1GA 1TLOA 2E03A 4X6HA 4P6GA 1NB3A 1YZBA 2FYEA 4HXDB 3IHPA 4N4ZA 2XU5A 4PT5A 2BTWB 4YV8A 3MHSA 3PDFA 1U9WA 4W5BA 1MS6A 5F02A 3OF9A 2JQFR 2P7UA 4Q8HA 1ME4A 2DC7A 5EGWA 4YYSA 1PPDA 5CVOB 1MIRA 2FTDA 3RVXA 5EZSA 1PPNA 1K3BB 4R3DA 3BWKA 3NHEA 1QXPA 4OELA 1EWLA 3KWBX 1M6DA 1TU6A 1KXRA 5E6JA 1F29A 4W4UA 3PRPA 3OVZA 1PPOA 2AU1A 1MEMA 4QBBA 4XZXA 4IP3A 3P5VA 8PCHA 4OEMA 2YJ8A 5JZEA 2VHFA 3TNXA 1YK7A 2Y5BA 4OVZA 3ZNHA 3HHIA 4BS6A 2G8EA 2JTCA 2FE8A 1AYUA 3PNRA 4BOUA 4BPVA 4RF1A 3N3GA 1IWDA 4YYQA 4MSXA 4REZA 1GCBA 3BY4A 3H6SA 1SNKA 1EWPA 2AVWA 2C0YA 2DC9A 3USVA 2BDLA 2OP3A 4BS5A 2ACTA 3PSEA 3RNVA 3IFUA 1F2CA 3GCBA 4P6EA 3HWNA 9PAPA 4OVZB 3QT4A 4X6JA 2NQDB 2Y6EA 3OF8A 2IBIA 2YJ2A 3P5XA 1KHQA 1CJLA 1PCIA 2NQIA 3U8EA 1AU0A 3B79A 3KW9A 3BPFA 2OULA 3TMPA 1CVZA 4HWYA 1CV8A 1ZIVA 4I07A 1NLJA 3BOWA 2J7QA 6PADA 2AUZA 1STFE 2BDZA 1AU4A 2HD5A 2NQGA 2R9CA 1DKIA 4XUIA 2GHUA 3WXFA 5JH3A 2AYNA 4MZOA 3CH3X 4N8WA 3H89A 4IUMA 1BGOA 1YT7A 3H7DA 3MHHA 2F7DA 1BP4A 2VHSA 4DMXA 1GMYA 3PHUA 3RVVA 3N3KA 2GFOA 1QOLA 1MEGA 4YYUA 3HD3A 2FRAA 1PPPA 4OW0A 5J94A 4D8IA 2E02A 1F2BA 2R9FA 2DC6A 1MHWA 5FPWA 1ATKA 2G6DA 3OVXA 1BY8A 3P5WA 3BPMA 4PP1A 2HH5A 1Y08A 3K9MA 2XU4A 2JRIA 3MP2A 1PBHA 2P86A 3V6CA 4AXMA 1CSBB 3W31A 2DC8A 2DCBA 3HHAA 4YVAA 3V6EA 3K8UA 2NQAA 1Y4HA 2YJ9A 3CBKA 3N4CA 1U9QX 4MZSA 4PI3A 3O65A 1AU2A
chains in the Genus database with same CATH topology
3KX1A 3H8BA 3H8CA 2PREA 3IEJA 2XU3A 3BC3A 5CHVA 5JA7A 4G54A 1HUCB 1DEUA 3LFYA 3S3QA 2DJFB 1NB5A 3CBJA 2H7JA 1X9YA 2OZ2A 1Q6KA 2AYOA 3MORA 4CDCB 2DZZA 2E00A 3DF0A 3WXGA 1EF7A 1EWOA 5A24A 1KFXL 1NPZA 2WBFX 4YYWA 4FK5A 1THEA 1PE6A 1S4VA 2DCCA 3C9EA 4QH6A 2B1MA 5CVNB 2PADA 4AXLA 3MTNA 1JQPA 3I06A 1CB5A 4BGFA 1AYVA 2PNSA 4PADA 4X6IA 4BSQA 2YJCA 1AU3A 2IPPB 3QJ3A 3P5UA 1F2AA 1GECE 2DCDA 1AYWA 2CB5A 7PCKA 1NL6A 3PBHA 2PBHA 3KKUA 4QRGA 5PADA 4QRVA 1A6RA 4RY2A 2O6XA 4N79A 4PP2E 1QMYA 2P0RA 1CTEA 1TL9A 1U9XA 3K24A 3BCNA 1SP4B 1ME3A 3CH2X 2R9MA 2R6NA 1FH0A 1XKGA 1BQIA 1YVBA 1E2TA 4W5CA 2VFCA 3IV2A 3RVWA 5CHTA 4YYRA 2ATOA 4QRXA 3OISA 3KFQA 2HHNA 2DCAA 1AIMA 2ARYA 2DJGB 1CPJA 1KHPA 2CIOA 2E01A 4KLBA 4NV7A 1ICFA 4DMYA 1VJVA 4GUZA 5CVMA 5K16A 2B1NA 2HXZA 1YALA 1NQCA 4B55A 1CS8A 4BQVA 4CDEB 2R9NA 2DZYA 2XU1A 1GX3A 1EWMA 3IUTA 1PIPA 4Q8GA 3E1ZB 4CZWA 4CDFB 4FJCA 3I3TA 3S3RA 1CQDA 1QDQA 1ITOA 1AECA 3ERVA 2AS8A 3D9WA 3M99A 3WXEA 1YK8A 3F75A 3KWZA 2G7YA 2JQGR 3QSDA 1O0EA 4I05A 3F5VA 1POPA 4YYVA 4WA6A 3PW3A 4ZUXU 1MDWA 3O0UA 4K7CA 4FIPA 3KSEA 1DF0A 1GLOA 1U5IA 2FQ9A 2F1GA 1PXVA 3IOQA 1U9VA 4XR7A 4CDDB 2AIMA 1VSNA 3AI8A 2FUDA 1ZCMA 2G8JA 3D6SA 2YJBA 3ZUAA 2FRQA 2FO5A 3IMAA 4I04A 2FT2A 2R9OA 1PADA 1KFUL 3LXSA 2AUXA 5EF4A 3O1GA 1TLOA 2E03A 4X6HA 4P6GA 1NB3A 2FYEA 3IHPA 4N4ZA 2XU5A 4YV8A 3MHSA 3PDFA 1U9WA 4W5BA 1MS6A 5F02A 3OF9A 2JQFR 2P7UA 4Q8HA 1ME4A 2DC7A 5EGWA 4YYSA 1PPDA 5CVOB 1MIRA 2FTDA 3RVXA 1PPNA 1K3BB 3BWKA 3NHEA 1QXPA 4OELA 1EWLA 3KWBX 1M6DA 1TU6A 1KXRA 1F29A 4W4UA 3OVZA 1PPOA 2AU1A 1MEMA 4QBBA 3P5VA 8PCHA 4OEMA 2YJ8A 2VHFA 3TNXA 1YK7A 2Y5BA 4BS6A 3HHIA 2G8EA 1AYUA 3PNRA 4BPVA 3N3GA 1IWDA 4YYQA 4MSXA 1GCBA 3H6SA 1SNKA 1EWPA 2AVWA 2C0YA 2DC9A 3USVA 2BDLA 2OP3A 4BS5A 2ACTA 4C5PA 1F2CA 3GCBA 4P6EA 3HWNA 9PAPA 3QT4A 4X6JA 2NQDB 1W5RA 2Y6EA 3OF8A 2VFBA 2IBIA 2YJ2A 3P5XA 1KHQA 1CJLA 1PCIA 2NQIA 4NV8A 3U8EA 1AU0A 3B79A 3KW9A 3BPFA 2OULA 1CVZA 4HWYA 1CV8A 1ZIVA 4I07A 1NLJA 3BOWA 6PADA 2AUZA 1STFE 2BDZA 1AU4A 2HD5A 2NQGA 2R9CA 4XUIA 2GHUA 3WXFA 5JH3A 2AYNA 4MZOA 3CH3X 4N8WA 3H89A 2BSZA 1BGOA 1YT7A 3H7DA 3MHHA 2F7DA 1BP4A 2VHSA 4DMXA 1GMYA 3RVVA 3N3KA 2GFOA 1QOLA 1MEGA 4YYUA 3HD3A 2FRAA 1PPPA 5J94A 1W4TA 1F2BA 2E02A 2R9FA 2DC6A 1MHWA 5FPWA 1ATKA 2G6DA 3OVXA 1BY8A 3P5WA 3BPMA 4PP1A 2HH5A 1Y08A 3LTWA 3K9MA 2XU4A 1PBHA 2P86A 3V6CA 4AXMA 1CSBB 2DC8A 2DCBA 3HHAA 4YVAA 1W6FA 3V6EA 3K8UA 2NQAA 1Y4HA 2YJ9A 3CBKA 3N4CA 1U9QX 4MZSA 4PI3A 1AU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KX1 A;  3H8B A;  3H8C A;  2PRE A;  3IEJ A;  2XU3 A;  3BC3 A;  5CHV A;  5JA7 A;  4G54 A;  1HUC B;  1DEU A;  3LFY A;  3S3Q A;  2DJF B;  1NB5 A;  3CBJ A;  2H7J A;  1X9Y A;  2OZ2 A;  1Q6K A;  2AYO A;  3MOR A;  4CDC B;  2DZZ A;  2E00 A;  3DF0 A;  3WXG A;  1EF7 A;  1EWO A;  5A24 A;  1KFX L;  1NPZ A;  2WBF X;  4YYW A;  4FK5 A;  1THE A;  1PE6 A;  1S4V A;  2DCC A;  3C9E A;  4QH6 A;  2B1M A;  5CVN B;  2PAD A;  4AXL A;  3MTN A;  1JQP A;  3I06 A;  1CB5 A;  1AYV A;  2PNS A;  4PAD A;  4X6I A;  4BSQ A;  2YJC A;  1AU3 A;  2IPP B;  3QJ3 A;  3P5U A;  1F2A A;  1GEC E;  2DCD A;  1AYW A;  2CB5 A;  7PCK A;  1NL6 A;  3PBH A;  2PBH A;  3KKU A;  4QRG A;  5PAD A;  4QRV A;  1A6R A;  4RY2 A;  2O6X A;  4N79 A;  4PP2 E;  1QMY A;  2P0R A;  1CTE A;  1TL9 A;  1U9X A;  3K24 A;  3BCN A;  1SP4 B;  1ME3 A;  3CH2 X;  2R9M A;  2R6N A;  1FH0 A;  1XKG A;  1BQI A;  1YVB A;  4W5C A;  3IV2 A;  3RVW A;  5CHT A;  4YYR A;  2ATO A;  4QRX A;  3OIS A;  3KFQ A;  2HHN A;  2DCA A;  1AIM A;  2ARY A;  2DJG B;  1CPJ A;  1KHP A;  2CIO A;  2E01 A;  4KLB A;  1ICF A;  4DMY A;  1VJV A;  5CVM A;  5K16 A;  2B1N A;  2HXZ A;  1YAL A;  1NQC A;  1CS8 A;  4BQV A;  4CDE B;  2R9N A;  2DZY A;  2XU1 A;  1EWM A;  3IUT A;  1PIP A;  4Q8G A;  3E1Z B;  4CZW A;  4CDF B;  4FJC A;  3I3T A;  3S3R A;  1CQD A;  1QDQ A;  1ITO A;  1AEC A;  3ERV A;  2AS8 A;  3M99 A;  3WXE A;  1YK8 A;  3F75 A;  3KWZ A;  2G7Y A;  2JQG R;  3QSD A;  1O0E A;  4I05 A;  3F5V A;  1POP A;  4YYV A;  4WA6 A;  3PW3 A;  4ZUX U;  1MDW A;  3O0U A;  4K7C A;  4FIP A;  3KSE A;  1DF0 A;  1GLO A;  1U5I A;  2FQ9 A;  2F1G A;  1PXV A;  3IOQ A;  1U9V A;  4XR7 A;  4CDD B;  2AIM A;  1VSN A;  3AI8 A;  2FUD A;  1ZCM A;  2G8J A;  3D6S A;  2YJB A;  3ZUA A;  2FRQ A;  2FO5 A;  3IMA A;  4I04 A;  2FT2 A;  2R9O A;  1PAD A;  1KFU L;  3LXS A;  2AUX A;  5EF4 A;  3O1G A;  1TLO A;  2E03 A;  4X6H A;  4P6G A;  1NB3 A;  2FYE A;  3IHP A;  4N4Z A;  2XU5 A;  4YV8 A;  3MHS A;  3PDF A;  1U9W A;  4W5B A;  1MS6 A;  5F02 A;  3OF9 A;  2JQF R;  2P7U A;  4Q8H A;  1ME4 A;  2DC7 A;  5EGW A;  4YYS A;  1PPD A;  5CVO B;  1MIR A;  2FTD A;  3RVX A;  1PPN A;  1K3B B;  3BWK A;  3NHE A;  1QXP A;  4OEL A;  1EWL A;  3KWB X;  1M6D A;  1TU6 A;  1KXR A;  1F29 A;  4W4U A;  3OVZ A;  1PPO A;  2AU1 A;  1MEM A;  4QBB A;  3P5V A;  8PCH A;  4OEM A;  2YJ8 A;  2VHF A;  3TNX A;  1YK7 A;  2Y5B A;  4BS6 A;  3HHI A;  2G8E A;  1AYU A;  3PNR A;  4BPV A;  3N3G A;  1IWD A;  4YYQ A;  4MSX A;  1GCB A;  3H6S A;  1SNK A;  1EWP A;  2AVW A;  2C0Y A;  2DC9 A;  3USV A;  2BDL A;  2OP3 A;  4BS5 A;  2ACT A;  1F2C A;  3GCB A;  4P6E A;  3HWN A;  9PAP A;  3QT4 A;  4X6J A;  2NQD B;  2Y6E A;  3OF8 A;  2IBI A;  2YJ2 A;  3P5X A;  1KHQ A;  1CJL A;  1PCI A;  2NQI A;  3U8E A;  1AU0 A;  3B79 A;  3KW9 A;  3BPF A;  2OUL A;  1CVZ A;  4HWY A;  1CV8 A;  1ZIV A;  4I07 A;  1NLJ A;  3BOW A;  6PAD A;  2AUZ A;  1STF E;  2BDZ A;  1AU4 A;  2HD5 A;  2NQG A;  2R9C A;  4XUI A;  2GHU A;  3WXF A;  5JH3 A;  2AYN A;  4MZO A;  3CH3 X;  4N8W A;  3H89 A;  1BGO A;  1YT7 A;  3H7D A;  3MHH A;  2F7D A;  1BP4 A;  2VHS A;  4DMX A;  1GMY A;  3RVV A;  3N3K A;  2GFO A;  1QOL A;  1MEG A;  4YYU A;  3HD3 A;  2FRA A;  1PPP A;  5J94 A;  2E02 A;  1F2B A;  2R9F A;  2DC6 A;  1MHW A;  5FPW A;  1ATK A;  2G6D A;  3OVX A;  1BY8 A;  3P5W A;  3BPM A;  4PP1 A;  2HH5 A;  1Y08 A;  3K9M A;  2XU4 A;  1PBH A;  2P86 A;  3V6C A;  4AXM A;  1CSB B;  2DC8 A;  2DCB A;  3HHA A;  4YVA A;  3V6E A;  3K8U A;  2NQA A;  1Y4H A;  2YJ9 A;  3CBK A;  3N4C A;  1U9Q X;  4MZS A;  4PI3 A;  1AU2 A; 
#chains in the Genus database with same CATH topology
 3KX1 A;  3H8B A;  3H8C A;  2PRE A;  3IEJ A;  2XU3 A;  3BC3 A;  3PHX A;  4D8B A;  5CHV A;  5JA7 A;  3W30 A;  4G54 A;  4BOZ A;  1HUC B;  3MTV A;  1DEU A;  3LFY A;  3S3Q A;  2DJF B;  1NB5 A;  3CBJ A;  2H7J A;  1X9Y A;  2OZ2 A;  1Q6K A;  4BOP A;  2AYO A;  3MOR A;  4CDC B;  2DZZ A;  2E00 A;  2UZJ A;  3DF0 A;  3WXG A;  1EF7 A;  1EWO A;  2Z84 A;  5A24 A;  1KFX L;  2J7Q C;  1NPZ A;  2WBF X;  4YYW A;  4FK5 A;  1THE A;  1PE6 A;  1S4V A;  2DCC A;  3C9E A;  4QH6 A;  3OQC A;  2B1M A;  5CVN B;  2PAD A;  4AXL A;  3MTN A;  1JQP A;  3I06 A;  1CB5 A;  3TRK A;  1AYV A;  2PNS A;  4PAD A;  4X6I A;  4BSQ A;  4D8E A;  2HWK A;  2YJC A;  1AU3 A;  2IPP B;  3QJ3 A;  3P5U A;  1F2A A;  1GEC E;  2DCD A;  4WUR A;  1AYW A;  2CB5 A;  7PCK A;  1NL6 A;  3PBH A;  2PBH A;  3KKU A;  4QRG A;  5PAD A;  4QRV A;  1A6R A;  4RY2 A;  2O6X A;  4N79 A;  4PP2 E;  1QMY A;  3MJ5 A;  2P0R A;  1CTE A;  1TL9 A;  1UKF A;  4ZTB A;  1U9X A;  3K24 A;  3BCN A;  1SP4 B;  5EZQ A;  1ME3 A;  3CH2 X;  3BBA A;  2R9M A;  2R6N A;  1FH0 A;  1XKG A;  1BQI A;  1YVB A;  3E9S A;  4W5C A;  4P16 A;  3IV2 A;  3RVW A;  5CHT A;  4M0W A;  3C0R A;  4YYR A;  2ATO A;  4QRX A;  3OIS A;  3KFQ A;  4BOS A;  2HHN A;  2DCA A;  1AIM A;  2ARY A;  2DJG B;  1CPJ A;  1KHP A;  2CIO A;  2E01 A;  4KLB A;  1ICF A;  4DMY A;  1VJV A;  5CVM A;  5K16 A;  2B1N A;  2HXZ A;  1YAL A;  1NQC A;  1CS8 A;  4BQV A;  4CDE B;  2R9N A;  2DZY A;  2XU1 A;  1EWM A;  3IUT A;  1PIP A;  2BU3 A;  4Q8G A;  3E1Z B;  4CZW A;  4CDF B;  4FJC A;  3I3T A;  3S3R A;  1CQD A;  5KO3 A;  1QDQ A;  4BOQ A;  1ITO A;  1AEC A;  3ERV A;  2AS8 A;  3M99 A;  3WXE A;  1YK8 A;  3F75 A;  1PVJ A;  3KWZ A;  2G7Y A;  2JQG R;  3QSD A;  4RKX A;  4RF0 A;  1O0E A;  4I05 A;  3F5V A;  2BTW A;  1POP A;  4A5U A;  4YYV A;  4WA6 A;  3PW3 A;  4ZUX U;  1MDW A;  3PRM A;  3O0U A;  3PT2 A;  4K7C A;  4FIP A;  3KSE A;  1DF0 A;  1GLO A;  1U5I A;  2FQ9 A;  2F1G A;  1PXV A;  3BB7 A;  3IOQ A;  1U9V A;  4XR7 A;  4CDD B;  2AIM A;  1VSN A;  4GUA A;  3AI8 A;  2FUD A;  1ZCM A;  2G8J A;  3D6S A;  2YJB A;  3PHW A;  3ZUA A;  2FRQ A;  2FO5 A;  3IMA A;  4MM3 B;  4I04 A;  2FT2 A;  2R9O A;  1PAD A;  1KFU L;  2AGA A;  3LXS A;  2AUX A;  3B21 A;  4MI7 A;  5EF4 A;  2DOS A;  4RNA A;  3O1G A;  1TLO A;  2E03 A;  4X6H A;  4P6G A;  1NB3 A;  1YZB A;  2FYE A;  4HXD B;  3IHP A;  4N4Z A;  2XU5 A;  4PT5 A;  2BTW B;  4YV8 A;  3MHS A;  3PDF A;  1U9W A;  4W5B A;  1MS6 A;  5F02 A;  3OF9 A;  2JQF R;  2P7U A;  4Q8H A;  1ME4 A;  2DC7 A;  5EGW A;  4YYS A;  1PPD A;  5CVO B;  1MIR A;  2FTD A;  3RVX A;  5EZS A;  1PPN A;  1K3B B;  4R3D A;  3BWK A;  3NHE A;  1QXP A;  4OEL A;  1EWL A;  3KWB X;  1M6D A;  1TU6 A;  1KXR A;  5E6J A;  1F29 A;  4W4U A;  3PRP A;  3OVZ A;  1PPO A;  2AU1 A;  1MEM A;  4QBB A;  4XZX A;  4IP3 A;  3P5V A;  8PCH A;  4OEM A;  2YJ8 A;  5JZE A;  2VHF A;  3TNX A;  1YK7 A;  2Y5B A;  4OVZ A;  3ZNH A;  3HHI A;  4BS6 A;  2G8E A;  2JTC A;  2FE8 A;  1AYU A;  3PNR A;  4BOU A;  4BPV A;  4RF1 A;  3N3G A;  1IWD A;  4YYQ A;  4MSX A;  4REZ A;  1GCB A;  3BY4 A;  3H6S A;  1SNK A;  1EWP A;  2AVW A;  2C0Y A;  2DC9 A;  3USV A;  2BDL A;  2OP3 A;  4BS5 A;  2ACT A;  3PSE A;  3RNV A;  3IFU A;  1F2C A;  3GCB A;  4P6E A;  3HWN A;  9PAP A;  4OVZ B;  3QT4 A;  4X6J A;  2NQD B;  2Y6E A;  3OF8 A;  2IBI A;  2YJ2 A;  3P5X A;  1KHQ A;  1CJL A;  1PCI A;  2NQI A;  3U8E A;  1AU0 A;  3B79 A;  3KW9 A;  3BPF A;  2OUL A;  3TMP A;  1CVZ A;  4HWY A;  1CV8 A;  1ZIV A;  4I07 A;  1NLJ A;  3BOW A;  2J7Q A;  6PAD A;  2AUZ A;  1STF E;  2BDZ A;  1AU4 A;  2HD5 A;  2NQG A;  2R9C A;  1DKI A;  4XUI A;  2GHU A;  3WXF A;  5JH3 A;  2AYN A;  4MZO A;  3CH3 X;  4N8W A;  3H89 A;  4IUM A;  1BGO A;  1YT7 A;  3H7D A;  3MHH A;  2F7D A;  1BP4 A;  2VHS A;  4DMX A;  1GMY A;  3PHU A;  3RVV A;  3N3K A;  2GFO A;  1QOL A;  1MEG A;  4YYU A;  3HD3 A;  2FRA A;  1PPP A;  4OW0 A;  5J94 A;  4D8I A;  2E02 A;  1F2B A;  2R9F A;  2DC6 A;  1MHW A;  5FPW A;  1ATK A;  2G6D A;  3OVX A;  1BY8 A;  3P5W A;  3BPM A;  4PP1 A;  2HH5 A;  1Y08 A;  3K9M A;  2XU4 A;  2JRI A;  3MP2 A;  1PBH A;  2P86 A;  3V6C A;  4AXM A;  1CSB B;  3W31 A;  2DC8 A;  2DCB A;  3HHA A;  4YVA A;  3V6E A;  3K8U A;  2NQA A;  1Y4H A;  2YJ9 A;  3CBK A;  3N4C A;  1U9Q X;  4MZS A;  4PI3 A;  3O65 A;  1AU2 A; 
#chains in the Genus database with same CATH homology
 3KX1 A;  3H8B A;  3H8C A;  2PRE A;  3IEJ A;  2XU3 A;  3BC3 A;  5CHV A;  5JA7 A;  4G54 A;  1HUC B;  1DEU A;  3LFY A;  3S3Q A;  2DJF B;  1NB5 A;  3CBJ A;  2H7J A;  1X9Y A;  2OZ2 A;  1Q6K A;  2AYO A;  3MOR A;  4CDC B;  2DZZ A;  2E00 A;  3DF0 A;  3WXG A;  1EF7 A;  1EWO A;  5A24 A;  1KFX L;  1NPZ A;  2WBF X;  4YYW A;  4FK5 A;  1THE A;  1PE6 A;  1S4V A;  2DCC A;  3C9E A;  4QH6 A;  2B1M A;  5CVN B;  2PAD A;  4AXL A;  3MTN A;  1JQP A;  3I06 A;  1CB5 A;  4BGF A;  1AYV A;  2PNS A;  4PAD A;  4X6I A;  4BSQ A;  2YJC A;  1AU3 A;  2IPP B;  3QJ3 A;  3P5U A;  1F2A A;  1GEC E;  2DCD A;  1AYW A;  2CB5 A;  7PCK A;  1NL6 A;  3PBH A;  2PBH A;  3KKU A;  4QRG A;  5PAD A;  4QRV A;  1A6R A;  4RY2 A;  2O6X A;  4N79 A;  4PP2 E;  1QMY A;  2P0R A;  1CTE A;  1TL9 A;  1U9X A;  3K24 A;  3BCN A;  1SP4 B;  1ME3 A;  3CH2 X;  2R9M A;  2R6N A;  1FH0 A;  1XKG A;  1BQI A;  1YVB A;  1E2T A;  4W5C A;  2VFC A;  3IV2 A;  3RVW A;  5CHT A;  4YYR A;  2ATO A;  4QRX A;  3OIS A;  3KFQ A;  2HHN A;  2DCA A;  1AIM A;  2ARY A;  2DJG B;  1CPJ A;  1KHP A;  2CIO A;  2E01 A;  4KLB A;  4NV7 A;  1ICF A;  4DMY A;  1VJV A;  4GUZ A;  5CVM A;  5K16 A;  2B1N A;  2HXZ A;  1YAL A;  1NQC A;  4B55 A;  1CS8 A;  4BQV A;  4CDE B;  2R9N A;  2DZY A;  2XU1 A;  1GX3 A;  1EWM A;  3IUT A;  1PIP A;  4Q8G A;  3E1Z B;  4CZW A;  4CDF B;  4FJC A;  3I3T A;  3S3R A;  1CQD A;  1QDQ A;  1ITO A;  1AEC A;  3ERV A;  2AS8 A;  3D9W A;  3M99 A;  3WXE A;  1YK8 A;  3F75 A;  3KWZ A;  2G7Y A;  2JQG R;  3QSD A;  1O0E A;  4I05 A;  3F5V A;  1POP A;  4YYV A;  4WA6 A;  3PW3 A;  4ZUX U;  1MDW A;  3O0U A;  4K7C A;  4FIP A;  3KSE A;  1DF0 A;  1GLO A;  1U5I A;  2FQ9 A;  2F1G A;  1PXV A;  3IOQ A;  1U9V A;  4XR7 A;  4CDD B;  2AIM A;  1VSN A;  3AI8 A;  2FUD A;  1ZCM A;  2G8J A;  3D6S A;  2YJB A;  3ZUA A;  2FRQ A;  2FO5 A;  3IMA A;  4I04 A;  2FT2 A;  2R9O A;  1PAD A;  1KFU L;  3LXS A;  2AUX A;  5EF4 A;  3O1G A;  1TLO A;  2E03 A;  4X6H A;  4P6G A;  1NB3 A;  2FYE A;  3IHP A;  4N4Z A;  2XU5 A;  4YV8 A;  3MHS A;  3PDF A;  1U9W A;  4W5B A;  1MS6 A;  5F02 A;  3OF9 A;  2JQF R;  2P7U A;  4Q8H A;  1ME4 A;  2DC7 A;  5EGW A;  4YYS A;  1PPD A;  5CVO B;  1MIR A;  2FTD A;  3RVX A;  1PPN A;  1K3B B;  3BWK A;  3NHE A;  1QXP A;  4OEL A;  1EWL A;  3KWB X;  1M6D A;  1TU6 A;  1KXR A;  1F29 A;  4W4U A;  3OVZ A;  1PPO A;  2AU1 A;  1MEM A;  4QBB A;  3P5V A;  8PCH A;  4OEM A;  2YJ8 A;  2VHF A;  3TNX A;  1YK7 A;  2Y5B A;  4BS6 A;  3HHI A;  2G8E A;  1AYU A;  3PNR A;  4BPV A;  3N3G A;  1IWD A;  4YYQ A;  4MSX A;  1GCB A;  3H6S A;  1SNK A;  1EWP A;  2AVW A;  2C0Y A;  2DC9 A;  3USV A;  2BDL A;  2OP3 A;  4BS5 A;  2ACT A;  4C5P A;  1F2C A;  3GCB A;  4P6E A;  3HWN A;  9PAP A;  3QT4 A;  4X6J A;  2NQD B;  1W5R A;  2Y6E A;  3OF8 A;  2VFB A;  2IBI A;  2YJ2 A;  3P5X A;  1KHQ A;  1CJL A;  1PCI A;  2NQI A;  4NV8 A;  3U8E A;  1AU0 A;  3B79 A;  3KW9 A;  3BPF A;  2OUL A;  1CVZ A;  4HWY A;  1CV8 A;  1ZIV A;  4I07 A;  1NLJ A;  3BOW A;  6PAD A;  2AUZ A;  1STF E;  2BDZ A;  1AU4 A;  2HD5 A;  2NQG A;  2R9C A;  4XUI A;  2GHU A;  3WXF A;  5JH3 A;  2AYN A;  4MZO A;  3CH3 X;  4N8W A;  3H89 A;  2BSZ A;  1BGO A;  1YT7 A;  3H7D A;  3MHH A;  2F7D A;  1BP4 A;  2VHS A;  4DMX A;  1GMY A;  3RVV A;  3N3K A;  2GFO A;  1QOL A;  1MEG A;  4YYU A;  3HD3 A;  2FRA A;  1PPP A;  5J94 A;  1W4T A;  1F2B A;  2E02 A;  2R9F A;  2DC6 A;  1MHW A;  5FPW A;  1ATK A;  2G6D A;  3OVX A;  1BY8 A;  3P5W A;  3BPM A;  4PP1 A;  2HH5 A;  1Y08 A;  3LTW A;  3K9M A;  2XU4 A;  1PBH A;  2P86 A;  3V6C A;  4AXM A;  1CSB B;  2DC8 A;  2DCB A;  3HHA A;  4YVA A;  1W6F A;  3V6E A;  3K8U A;  2NQA A;  1Y4H A;  2YJ9 A;  3CBK A;  3N4C A;  1U9Q X;  4MZS A;  4PI3 A;  1AU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...