3P5UA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Actinidin
total genus 70
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5uA00
4N4ZA 1U5IA 3RVXA 3KFQA 1VJVA 2XU4A 1QOLA 2R9CA 1Q6KA 4I07A 1KFXL 1NQCA 3IHPA 2DJFB 1F2AA 2Y5BA 1XKGA 1MDWA 2OP3A 1O0EA 3CBKA 4CZWA 1HUCB 1YALA 2P0RA 1MEMA 3N4CA 4YYVA 1KHPA 1F2CA 3RVWA 2R9MA 1CS8A 3IEJA 1NB3A 2NQIA 5F02A 4YYSA 1AU0A 2VHFA 2DC6A 1AECA 2HD5A 3BCNA 2AIMA 1YK8A 1TL9A 4MZSA 3ERVA 2DZZA 3I3TA 3KSEA 2DCCA 2NQDB 2G7YA 4YYWA 4ZUXU 4W5BA 3RVVA 4CDCB 2C0YA 2WBFX 1AYUA 4X6IA 3KWBX 3P5XA 1STFE 4BPVA 3BC3A 3CH3X 2G6DA 3H8BA 1BP4A 3CH2X 3H6SA 4X6JA 2R9FA 5CVMA 6PADA 1VSNA 1ME3A 4DMYA 3C9EA 1M6DA 2DCDA 4K7CA 5EGWA 1GMYA 4YYUA 1ZCMA 2CB5A 2E00A 2YJ9A 3S3QA 1PE6A 5CHVA 1ITOA 2F7DA 3OF9A 3BPFA 3KKUA 2YJBA 5FPWA 2XU5A 1NL6A 2FT2A 2FRAA 3B79A 1S4VA 4N8WA 2DZYA 4AXMA 2ARYA 3MHSA 3OISA 2Y6EA 1SP4B 3F5VA 4FIPA 2FO5A 3S3RA 5A24A 1KXRA 1AYWA 3N3KA 1K3BB 3USVA 4X6HA 4QRXA 4YYQA 4DMXA 4CDFB 1F29A 3GCBA 1AIMA 1MS6A 1CB5A 1PXVA 4PADA 4P6EA 3KX1A 1JQPA 3K24A 3HD3A 1BY8A 3BWKA 1THEA 1DF0A 1GLOA 1EWPA 3I06A 4AXLA 1MHWA 1ICFA 3QSDA 4I05A 3BOWA 4BS6A 1DEUA 2JQGR 3N3GA 2FRQA 2AVWA 3V6CA 1PIPA 1F2BA 4PP1A 2AUXA 2PADA 2AYNA 1EF7A 4QRVA 2IBIA 1CSBB 4HWYA 3MORA 1EWLA 2DC7A 3PDFA 1POPA 2BDLA 3K9MA 1U9VA 1SNKA 2YJCA 3KWZA 2VHSA 2BDZA 2B1NA 3WXGA 2AYOA 3E1ZB 1U9XA 1Y08A 4WA6A 3BPMA 4BS5A 4FK5A 7PCKA 2PNSA 3HWNA 3CBJA 2XU3A 2AU1A 1QMYA 1YT7A 1EWMA 2P7UA 2E03A 1AU2A 3OF8A 1YVBA 3PBHA 1KHQA 1CQDA 1YK7A 2F1GA 4Q8GA 4QRGA 3IMAA 3NHEA 4PI3A 3WXFA 1CTEA 4CDEB 1CVZA 1PPDA 1QDQA 5K16A 3OVXA 2YJ2A 3WXEA 2HH5A 1AU4A 2NQGA 1U9WA 3DF0A 2PBHA 1PCIA 1IWDA 3O0UA 4KLBA 2H7JA 4YYRA 4G54A 4BQVA 1PBHA 1U9QX 3LFYA 4XUIA 3TNXA 3H89A 2G8EA 2HXZA 1PPNA 4Q8HA 1NLJA 2R6NA 4MZOA 3LXSA 3O1GA 3QT4A 3D6SA 2HHNA 2E02A 2CIOA 3ZUAA 1AU3A 1PADA 2NQAA 1MIRA 1BQIA 4YVAA 3V6EA 3F75A 1NPZA 3H7DA 1PPPA 1GCBA 2FUDA 2FQ9A 2DC9A 2DJGB 3AI8A 2OULA 2PREA 1A6RA 5J94A 1FH0A 2JQFR 1CV8A 2XU1A 3H8CA 1PPOA 4OELA 4QBBA 9PAPA 1ME4A 4P6GA 4CDDB 3OVZA 2R9OA 1ATKA 1BGOA 8PCHA 3IOQA 3HHAA 2E01A 2AS8A 2DC8A 2OZ2A 4FJCA 4OEMA 2DCAA 2DCBA 4XR7A 3M99A 2ATOA 2GFOA 1ZIVA 3U8EA 3P5UA 1CPJA 2O6XA 3IV2A 2GHUA 2G8JA 3K8UA 3MTNA 2AUZA 5CVOB 5CVNB 5EF4A 1QXPA 1Y4HA 5JH3A 4QH6A 2R9NA 3KW9A 1EWOA 1TLOA 1GECE 1NB5A 4I04A 5CHTA 2ACTA 4BSQA 1CJLA 3IUTA 2FTDA 4RY2A 2FYEA 4W5CA 5PADA 3PNRA 3HHIA 1KFUL 3PW3A 2YJ8A 3MHHA 2P86A 4MSXA 3P5WA 3QJ3A 2IPPB 1AYVA 3P5VA 2B1MA 4PP2E 4YV8A 5JA7A 4N79A 1MEGA 4W4UA 1X9YA 1TU6A
chains in the Genus database with same CATH superfamily
2HWKA 4N4ZA 1U5IA 4IP3A 3RVXA 3KFQA 1VJVA 2XU4A 4PT5A 1QOLA 2R9CA 4D8IA 1Q6KA 4BOPA 4I07A 1KFXL 1NQCA 3IHPA 4OVZB 2DJFB 1F2AA 2Y5BA 1XKGA 1MDWA 2OP3A 1O0EA 4BOZA 3CBKA 3OQCA 4CZWA 1HUCB 1YALA 2P0RA 1MEMA 3N4CA 4YYVA 1KHPA 1F2CA 3PRPA 4R3DA 3RVWA 2R9MA 1CS8A 3IEJA 1NB3A 2NQIA 5F02A 4YYSA 1AU0A 4RF1A 2VHFA 2DC6A 1AECA 2HD5A 3BCNA 2AIMA 1YK8A 1DKIA 5EZQA 1TL9A 2JRIA 3ERVA 4MZSA 2DZZA 1UKFA 3I3TA 3KSEA 2DCCA 2NQDB 2G7YA 4YYWA 3MTVA 4ZUXU 4W5BA 3RVVA 4CDCB 2C0YA 2WBFX 1AYUA 4X6IA 3KWBX 3P5XA 1STFE 4BPVA 4BOSA 3BC3A 3CH3X 2G6DA 3H8BA 3TRKA 1BP4A 3CH2X 4P16A 3H6SA 4X6JA 2R9FA 5CVMA 6PADA 1VSNA 1ME3A 4GUAA 2JTCA 4DMYA 3C9EA 1M6DA 4OW0A 2DCDA 1PVJA 4K7CA 5EGWA 1GMYA 4YYUA 1ZCMA 2CB5A 2E00A 2YJ9A 3S3QA 1PE6A 5CHVA 1ITOA 2F7DA 3OF9A 3BPFA 3KKUA 2YJBA 5FPWA 2XU5A 1NL6A 2FT2A 2FRAA 3B79A 1S4VA 4N8WA 2DZYA 4AXMA 2ARYA 3MHSA 3OISA 2Y6EA 1SP4B 3F5VA 4FIPA 2FO5A 3S3RA 3BY4A 5A24A 1KXRA 4RNAA 1AYWA 3N3KA 1K3BB 3USVA 4X6HA 4QRXA 4YYQA 4DMXA 4CDFB 1F29A 3GCBA 1AIMA 1MS6A 1CB5A 1PXVA 4PADA 4P6EA 3KX1A 4OVZA 1JQPA 3K24A 3HD3A 4A5UA 4RKXA 3PHXA 1BY8A 3BWKA 1THEA 1DF0A 1GLOA 1EWPA 3I06A 4AXLA 1MHWA 1ICFA 3QSDA 4I05A 3BOWA 4BS6A 1DEUA 2JQGR 2J7QC 3N3GA 2FRQA 2AVWA 3V6CA 1PIPA 1F2BA 4PP1A 2AUXA 2PADA 2AYNA 1EF7A 4QRVA 2IBIA 1CSBB 4HWYA 2BU3A 3MORA 1EWLA 2DC7A 3PDFA 1POPA 2BDLA 3K9MA 3E9SA 1U9VA 1SNKA 2YJCA 3KWZA 5EZSA 3B21A 2VHSA 2BDZA 2B1NA 3WXGA 3W30A 2AYOA 3E1ZB 1U9XA 1Y08A 4WA6A 3BPMA 4BS5A 4FK5A 7PCKA 2PNSA 3HWNA 3CBJA 2XU3A 2AU1A 1QMYA 1YT7A 1EWMA 2P7UA 2E03A 3TMPA 1AU2A 3OF8A 1YVBA 3PBHA 1KHQA 1CQDA 1YK7A 2F1GA 4Q8GA 4QRGA 3IMAA 3NHEA 4PI3A 3WXFA 1CTEA 4CDEB 1CVZA 1PPDA 1QDQA 5K16A 3OVXA 2YJ2A 3WXEA 2HH5A 1AU4A 4IUMA 2NQGA 1U9WA 3DF0A 2PBHA 1PCIA 1IWDA 3O0UA 4KLBA 2H7JA 4YYRA 4G54A 4BQVA 3IFUA 1PBHA 1U9QX 3LFYA 4XUIA 3TNXA 3ZNHA 3H89A 2G8EA 2HXZA 1PPNA 4Q8HA 1NLJA 4WURA 2R6NA 4MZOA 3LXSA 3O1GA 3PRMA 3QT4A 4MI7A 4M0WA 3D6SA 2HHNA 2E02A 2CIOA 3ZUAA 4D8EA 1AU3A 3W31A 1PADA 2NQAA 1MIRA 1BQIA 3PSEA 4D8BA 4YVAA 3V6EA 3F75A 1NPZA 3H7DA 1PPPA 1GCBA 2FUDA 2FQ9A 2DC9A 2DJGB 3AI8A 2OULA 2PREA 1A6RA 5J94A 1FH0A 2JQFR 4BOUA 1CV8A 2XU1A 3H8CA 1PPOA 4OELA 4RF0A 4QBBA 9PAPA 1ME4A 4P6GA 3PHWA 4CDDB 2Z84A 2R9OA 3OVZA 1ATKA 1BGOA 8PCHA 3IOQA 3PT2A 3HHAA 2E01A 3PHUA 2AS8A 2DC8A 2OZ2A 4FJCA 3MP2A 4OEMA 2DCAA 2DCBA 4XR7A 3M99A 4REZA 2ATOA 2GFOA 1ZIVA 3U8EA 3P5UA 1CPJA 2O6XA 3IV2A 4XZXA 2GHUA 2G8JA 3K8UA 3MTNA 2AUZA 5CVOB 5CVNB 5EF4A 1QXPA 1Y4HA 5JH3A 2UZJA 4QH6A 2R9NA 3KW9A 1EWOA 1TLOA 1GECE 1NB5A 5KO3A 3C0RA 4I04A 5CHTA 2ACTA 4BSQA 1CJLA 3IUTA 2FTDA 4RY2A 2BTWB 4HXDB 2FYEA 3MJ5A 4W5CA 2BTWA 5PADA 3PNRA 2AGAA 4MM3B 3BB7A 5E6JA 3HHIA 1KFUL 3PW3A 2YJ8A 3MHHA 2P86A 4MSXA 3P5WA 1YZBA 3QJ3A 4BOQA 2IPPB 3O65A 1AYVA 3P5VA 2B1MA 4PP2E 4YV8A 3RNVA 2FE8A 3BBAA 5JA7A 2J7QA 4N79A 5JZEA 1MEGA 2DOSA 4W4UA 4ZTBA 1X9YA 1TU6A
chains in the Genus database with same CATH topology
4N4ZA 1U5IA 3RVXA 3KFQA 1VJVA 2XU4A 1QOLA 2R9CA 1Q6KA 4I07A 1KFXL 1NQCA 3IHPA 4NV7A 2DJFB 1F2AA 2Y5BA 1XKGA 1MDWA 2OP3A 1O0EA 3CBKA 4CZWA 1HUCB 1YALA 2P0RA 1MEMA 3N4CA 4YYVA 1KHPA 1F2CA 3RVWA 2R9MA 1CS8A 3IEJA 1NB3A 2NQIA 5F02A 4YYSA 1AU0A 2VHFA 2DC6A 1AECA 2HD5A 3BCNA 2AIMA 1YK8A 1TL9A 4MZSA 3ERVA 2DZZA 3I3TA 3KSEA 2DCCA 2NQDB 2G7YA 4YYWA 4ZUXU 4W5BA 3RVVA 4CDCB 2C0YA 2WBFX 1AYUA 4X6IA 3KWBX 3P5XA 1STFE 4BPVA 3BC3A 3CH3X 2G6DA 3H8BA 1BP4A 3CH2X 3H6SA 4X6JA 2R9FA 5CVMA 6PADA 1VSNA 1ME3A 1W6FA 4DMYA 3C9EA 1M6DA 2DCDA 4K7CA 5EGWA 1GMYA 4YYUA 1ZCMA 2CB5A 2E00A 2YJ9A 3S3QA 1PE6A 5CHVA 1ITOA 2F7DA 3OF9A 3BPFA 3KKUA 2YJBA 4BGFA 5FPWA 2XU5A 1NL6A 2FT2A 2FRAA 3B79A 1S4VA 4N8WA 2DZYA 4NV8A 4AXMA 2ARYA 3MHSA 3OISA 2Y6EA 1SP4B 3F5VA 4FIPA 2FO5A 3S3RA 5A24A 1KXRA 1AYWA 3N3KA 1K3BB 3USVA 4X6HA 4QRXA 4C5PA 4YYQA 4DMXA 4CDFB 1F29A 3GCBA 1AIMA 1MS6A 1CB5A 1W5RA 1PXVA 4PADA 4P6EA 3KX1A 1JQPA 3K24A 3HD3A 1BY8A 3BWKA 1THEA 1DF0A 2VFCA 1GLOA 1EWPA 3I06A 4AXLA 1MHWA 1ICFA 3QSDA 4I05A 3BOWA 4BS6A 1DEUA 2JQGR 3N3GA 2FRQA 2AVWA 3V6CA 1PIPA 1F2BA 4PP1A 2AUXA 2PADA 2AYNA 1EF7A 4QRVA 2IBIA 1GX3A 1CSBB 4HWYA 3MORA 1EWLA 2DC7A 3PDFA 1POPA 2BDLA 3K9MA 1U9VA 1SNKA 2YJCA 3KWZA 2VHSA 2BDZA 2B1NA 3WXGA 2AYOA 3E1ZB 1U9XA 1Y08A 4WA6A 3BPMA 4BS5A 4FK5A 7PCKA 2PNSA 3HWNA 3CBJA 2XU3A 2AU1A 1QMYA 1YT7A 1EWMA 2P7UA 2E03A 1AU2A 3OF8A 1YVBA 2VFBA 3PBHA 1KHQA 1CQDA 1YK7A 2F1GA 4Q8GA 4QRGA 3IMAA 3NHEA 4PI3A 3WXFA 1CTEA 4CDEB 1CVZA 1PPDA 1QDQA 5K16A 3OVXA 2YJ2A 4B55A 3WXEA 2HH5A 1AU4A 2NQGA 1U9WA 3DF0A 2PBHA 1PCIA 1IWDA 3O0UA 4KLBA 2H7JA 4YYRA 4G54A 4BQVA 1PBHA 1U9QX 3LFYA 4XUIA 3TNXA 3H89A 2G8EA 2HXZA 1PPNA 4Q8HA 1NLJA 2R6NA 4MZOA 3LXSA 3O1GA 3QT4A 3D6SA 2HHNA 2E02A 2CIOA 3ZUAA 1AU3A 1PADA 2NQAA 1MIRA 1BQIA 4YVAA 3V6EA 3F75A 1NPZA 3H7DA 1PPPA 1GCBA 2FUDA 2FQ9A 3D9WA 2DC9A 2DJGB 3AI8A 2OULA 2PREA 1A6RA 5J94A 1FH0A 2JQFR 1CV8A 2XU1A 3H8CA 1PPOA 4OELA 1W4TA 4QBBA 9PAPA 1ME4A 4P6GA 4CDDB 3OVZA 2R9OA 1ATKA 1BGOA 8PCHA 3IOQA 3HHAA 2E01A 2AS8A 2DC8A 3LTWA 2OZ2A 4FJCA 4OEMA 2DCAA 2DCBA 4XR7A 3M99A 2ATOA 2GFOA 1ZIVA 3U8EA 3P5UA 1CPJA 2O6XA 3IV2A 2GHUA 2G8JA 3K8UA 3MTNA 2AUZA 5CVOB 5CVNB 5EF4A 1QXPA 1Y4HA 5JH3A 4QH6A 2R9NA 3KW9A 1EWOA 1TLOA 1GECE 1NB5A 4I04A 5CHTA 2ACTA 4BSQA 1CJLA 3IUTA 2FTDA 4RY2A 2FYEA 4W5CA 5PADA 3PNRA 3HHIA 1KFUL 3PW3A 2YJ8A 3MHHA 2P86A 4MSXA 3P5WA 3QJ3A 2IPPB 1AYVA 3P5VA 2B1MA 4PP2E 4YV8A 4GUZA 5JA7A 1E2TA 4N79A 1MEGA 4W4UA 2BSZA 1X9YA 1TU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4Z A;  1U5I A;  3RVX A;  3KFQ A;  1VJV A;  2XU4 A;  1QOL A;  2R9C A;  1Q6K A;  4I07 A;  1KFX L;  1NQC A;  3IHP A;  2DJF B;  1F2A A;  2Y5B A;  1XKG A;  1MDW A;  2OP3 A;  1O0E A;  3CBK A;  4CZW A;  1HUC B;  1YAL A;  2P0R A;  1MEM A;  3N4C A;  4YYV A;  1KHP A;  1F2C A;  3RVW A;  2R9M A;  1CS8 A;  3IEJ A;  1NB3 A;  2NQI A;  5F02 A;  4YYS A;  1AU0 A;  2VHF A;  2DC6 A;  1AEC A;  2HD5 A;  3BCN A;  2AIM A;  1YK8 A;  1TL9 A;  4MZS A;  3ERV A;  2DZZ A;  3I3T A;  3KSE A;  2DCC A;  2NQD B;  2G7Y A;  4YYW A;  4ZUX U;  4W5B A;  3RVV A;  4CDC B;  2C0Y A;  2WBF X;  1AYU A;  4X6I A;  3KWB X;  3P5X A;  1STF E;  4BPV A;  3BC3 A;  3CH3 X;  2G6D A;  3H8B A;  1BP4 A;  3CH2 X;  3H6S A;  4X6J A;  2R9F A;  5CVM A;  6PAD A;  1VSN A;  1ME3 A;  4DMY A;  3C9E A;  1M6D A;  2DCD A;  4K7C A;  5EGW A;  1GMY A;  4YYU A;  1ZCM A;  2CB5 A;  2E00 A;  2YJ9 A;  3S3Q A;  1PE6 A;  5CHV A;  1ITO A;  2F7D A;  3OF9 A;  3BPF A;  3KKU A;  2YJB A;  5FPW A;  2XU5 A;  1NL6 A;  2FT2 A;  2FRA A;  3B79 A;  1S4V A;  4N8W A;  2DZY A;  4AXM A;  2ARY A;  3MHS A;  3OIS A;  2Y6E A;  1SP4 B;  3F5V A;  4FIP A;  2FO5 A;  3S3R A;  5A24 A;  1KXR A;  1AYW A;  3N3K A;  1K3B B;  3USV A;  4X6H A;  4QRX A;  4YYQ A;  4DMX A;  4CDF B;  1F29 A;  3GCB A;  1AIM A;  1MS6 A;  1CB5 A;  1PXV A;  4PAD A;  4P6E A;  3KX1 A;  1JQP A;  3K24 A;  3HD3 A;  1BY8 A;  3BWK A;  1THE A;  1DF0 A;  1GLO A;  1EWP A;  3I06 A;  4AXL A;  1MHW A;  1ICF A;  3QSD A;  4I05 A;  3BOW A;  4BS6 A;  1DEU A;  2JQG R;  3N3G A;  2FRQ A;  2AVW A;  3V6C A;  1PIP A;  1F2B A;  4PP1 A;  2AUX A;  2PAD A;  2AYN A;  1EF7 A;  4QRV A;  2IBI A;  1CSB B;  4HWY A;  3MOR A;  1EWL A;  2DC7 A;  3PDF A;  1POP A;  2BDL A;  3K9M A;  1U9V A;  1SNK A;  2YJC A;  3KWZ A;  2VHS A;  2BDZ A;  2B1N A;  3WXG A;  2AYO A;  3E1Z B;  1U9X A;  1Y08 A;  4WA6 A;  3BPM A;  4BS5 A;  4FK5 A;  7PCK A;  2PNS A;  3HWN A;  3CBJ A;  2XU3 A;  2AU1 A;  1QMY A;  1YT7 A;  1EWM A;  2P7U A;  2E03 A;  1AU2 A;  3OF8 A;  1YVB A;  3PBH A;  1KHQ A;  1CQD A;  1YK7 A;  2F1G A;  4Q8G A;  4QRG A;  3IMA A;  3NHE A;  4PI3 A;  3WXF A;  1CTE A;  4CDE B;  1CVZ A;  1PPD A;  1QDQ A;  5K16 A;  3OVX A;  2YJ2 A;  3WXE A;  2HH5 A;  1AU4 A;  2NQG A;  1U9W A;  3DF0 A;  2PBH A;  1PCI A;  1IWD A;  3O0U A;  4KLB A;  2H7J A;  4YYR A;  4G54 A;  4BQV A;  1PBH A;  1U9Q X;  3LFY A;  4XUI A;  3TNX A;  3H89 A;  2G8E A;  2HXZ A;  1PPN A;  4Q8H A;  1NLJ A;  2R6N A;  4MZO A;  3LXS A;  3O1G A;  3QT4 A;  3D6S A;  2HHN A;  2E02 A;  2CIO A;  3ZUA A;  1AU3 A;  1PAD A;  2NQA A;  1MIR A;  1BQI A;  4YVA A;  3V6E A;  3F75 A;  1NPZ A;  3H7D A;  1PPP A;  1GCB A;  2FUD A;  2FQ9 A;  2DC9 A;  2DJG B;  3AI8 A;  2OUL A;  2PRE A;  1A6R A;  5J94 A;  1FH0 A;  2JQF R;  1CV8 A;  2XU1 A;  3H8C A;  1PPO A;  4OEL A;  4QBB A;  9PAP A;  1ME4 A;  4P6G A;  4CDD B;  3OVZ A;  2R9O A;  1ATK A;  1BGO A;  8PCH A;  3IOQ A;  3HHA A;  2E01 A;  2AS8 A;  2DC8 A;  2OZ2 A;  4FJC A;  4OEM A;  2DCA A;  2DCB A;  4XR7 A;  3M99 A;  2ATO A;  2GFO A;  1ZIV A;  3U8E A;  3P5U A;  1CPJ A;  2O6X A;  3IV2 A;  2GHU A;  2G8J A;  3K8U A;  3MTN A;  2AUZ A;  5CVO B;  5CVN B;  5EF4 A;  1QXP A;  1Y4H A;  5JH3 A;  4QH6 A;  2R9N A;  3KW9 A;  1EWO A;  1TLO A;  1GEC E;  1NB5 A;  4I04 A;  5CHT A;  2ACT A;  4BSQ A;  1CJL A;  3IUT A;  2FTD A;  4RY2 A;  2FYE A;  4W5C A;  5PAD A;  3PNR A;  3HHI A;  1KFU L;  3PW3 A;  2YJ8 A;  3MHH A;  2P86 A;  4MSX A;  3P5W A;  3QJ3 A;  2IPP B;  1AYV A;  3P5V A;  2B1M A;  4PP2 E;  4YV8 A;  5JA7 A;  4N79 A;  1MEG A;  4W4U A;  1X9Y A;  1TU6 A; 
#chains in the Genus database with same CATH topology
 2HWK A;  4N4Z A;  1U5I A;  4IP3 A;  3RVX A;  3KFQ A;  1VJV A;  2XU4 A;  4PT5 A;  1QOL A;  2R9C A;  4D8I A;  1Q6K A;  4BOP A;  4I07 A;  1KFX L;  1NQC A;  3IHP A;  4OVZ B;  2DJF B;  1F2A A;  2Y5B A;  1XKG A;  1MDW A;  2OP3 A;  1O0E A;  4BOZ A;  3CBK A;  3OQC A;  4CZW A;  1HUC B;  1YAL A;  2P0R A;  1MEM A;  3N4C A;  4YYV A;  1KHP A;  1F2C A;  3PRP A;  4R3D A;  3RVW A;  2R9M A;  1CS8 A;  3IEJ A;  1NB3 A;  2NQI A;  5F02 A;  4YYS A;  1AU0 A;  4RF1 A;  2VHF A;  2DC6 A;  1AEC A;  2HD5 A;  3BCN A;  2AIM A;  1YK8 A;  1DKI A;  5EZQ A;  1TL9 A;  2JRI A;  3ERV A;  4MZS A;  2DZZ A;  1UKF A;  3I3T A;  3KSE A;  2DCC A;  2NQD B;  2G7Y A;  4YYW A;  3MTV A;  4ZUX U;  4W5B A;  3RVV A;  4CDC B;  2C0Y A;  2WBF X;  1AYU A;  4X6I A;  3KWB X;  3P5X A;  1STF E;  4BPV A;  4BOS A;  3BC3 A;  3CH3 X;  2G6D A;  3H8B A;  3TRK A;  1BP4 A;  3CH2 X;  4P16 A;  3H6S A;  4X6J A;  2R9F A;  5CVM A;  6PAD A;  1VSN A;  1ME3 A;  4GUA A;  2JTC A;  4DMY A;  3C9E A;  1M6D A;  4OW0 A;  2DCD A;  1PVJ A;  4K7C A;  5EGW A;  1GMY A;  4YYU A;  1ZCM A;  2CB5 A;  2E00 A;  2YJ9 A;  3S3Q A;  1PE6 A;  5CHV A;  1ITO A;  2F7D A;  3OF9 A;  3BPF A;  3KKU A;  2YJB A;  5FPW A;  2XU5 A;  1NL6 A;  2FT2 A;  2FRA A;  3B79 A;  1S4V A;  4N8W A;  2DZY A;  4AXM A;  2ARY A;  3MHS A;  3OIS A;  2Y6E A;  1SP4 B;  3F5V A;  4FIP A;  2FO5 A;  3S3R A;  3BY4 A;  5A24 A;  1KXR A;  4RNA A;  1AYW A;  3N3K A;  1K3B B;  3USV A;  4X6H A;  4QRX A;  4YYQ A;  4DMX A;  4CDF B;  1F29 A;  3GCB A;  1AIM A;  1MS6 A;  1CB5 A;  1PXV A;  4PAD A;  4P6E A;  3KX1 A;  4OVZ A;  1JQP A;  3K24 A;  3HD3 A;  4A5U A;  4RKX A;  3PHX A;  1BY8 A;  3BWK A;  1THE A;  1DF0 A;  1GLO A;  1EWP A;  3I06 A;  4AXL A;  1MHW A;  1ICF A;  3QSD A;  4I05 A;  3BOW A;  4BS6 A;  1DEU A;  2JQG R;  2J7Q C;  3N3G A;  2FRQ A;  2AVW A;  3V6C A;  1PIP A;  1F2B A;  4PP1 A;  2AUX A;  2PAD A;  2AYN A;  1EF7 A;  4QRV A;  2IBI A;  1CSB B;  4HWY A;  2BU3 A;  3MOR A;  1EWL A;  2DC7 A;  3PDF A;  1POP A;  2BDL A;  3K9M A;  3E9S A;  1U9V A;  1SNK A;  2YJC A;  3KWZ A;  5EZS A;  3B21 A;  2VHS A;  2BDZ A;  2B1N A;  3WXG A;  3W30 A;  2AYO A;  3E1Z B;  1U9X A;  1Y08 A;  4WA6 A;  3BPM A;  4BS5 A;  4FK5 A;  7PCK A;  2PNS A;  3HWN A;  3CBJ A;  2XU3 A;  2AU1 A;  1QMY A;  1YT7 A;  1EWM A;  2P7U A;  2E03 A;  3TMP A;  1AU2 A;  3OF8 A;  1YVB A;  3PBH A;  1KHQ A;  1CQD A;  1YK7 A;  2F1G A;  4Q8G A;  4QRG A;  3IMA A;  3NHE A;  4PI3 A;  3WXF A;  1CTE A;  4CDE B;  1CVZ A;  1PPD A;  1QDQ A;  5K16 A;  3OVX A;  2YJ2 A;  3WXE A;  2HH5 A;  1AU4 A;  4IUM A;  2NQG A;  1U9W A;  3DF0 A;  2PBH A;  1PCI A;  1IWD A;  3O0U A;  4KLB A;  2H7J A;  4YYR A;  4G54 A;  4BQV A;  3IFU A;  1PBH A;  1U9Q X;  3LFY A;  4XUI A;  3TNX A;  3ZNH A;  3H89 A;  2G8E A;  2HXZ A;  1PPN A;  4Q8H A;  1NLJ A;  4WUR A;  2R6N A;  4MZO A;  3LXS A;  3O1G A;  3PRM A;  3QT4 A;  4MI7 A;  4M0W A;  3D6S A;  2HHN A;  2E02 A;  2CIO A;  3ZUA A;  4D8E A;  1AU3 A;  3W31 A;  1PAD A;  2NQA A;  1MIR A;  1BQI A;  3PSE A;  4D8B A;  4YVA A;  3V6E A;  3F75 A;  1NPZ A;  3H7D A;  1PPP A;  1GCB A;  2FUD A;  2FQ9 A;  2DC9 A;  2DJG B;  3AI8 A;  2OUL A;  2PRE A;  1A6R A;  5J94 A;  1FH0 A;  2JQF R;  4BOU A;  1CV8 A;  2XU1 A;  3H8C A;  1PPO A;  4OEL A;  4RF0 A;  4QBB A;  9PAP A;  1ME4 A;  4P6G A;  3PHW A;  4CDD B;  2Z84 A;  2R9O A;  3OVZ A;  1ATK A;  1BGO A;  8PCH A;  3IOQ A;  3PT2 A;  3HHA A;  2E01 A;  3PHU A;  2AS8 A;  2DC8 A;  2OZ2 A;  4FJC A;  3MP2 A;  4OEM A;  2DCA A;  2DCB A;  4XR7 A;  3M99 A;  4REZ A;  2ATO A;  2GFO A;  1ZIV A;  3U8E A;  3P5U A;  1CPJ A;  2O6X A;  3IV2 A;  4XZX A;  2GHU A;  2G8J A;  3K8U A;  3MTN A;  2AUZ A;  5CVO B;  5CVN B;  5EF4 A;  1QXP A;  1Y4H A;  5JH3 A;  2UZJ A;  4QH6 A;  2R9N A;  3KW9 A;  1EWO A;  1TLO A;  1GEC E;  1NB5 A;  5KO3 A;  3C0R A;  4I04 A;  5CHT A;  2ACT A;  4BSQ A;  1CJL A;  3IUT A;  2FTD A;  4RY2 A;  2BTW B;  4HXD B;  2FYE A;  3MJ5 A;  4W5C A;  2BTW A;  5PAD A;  3PNR A;  2AGA A;  4MM3 B;  3BB7 A;  5E6J A;  3HHI A;  1KFU L;  3PW3 A;  2YJ8 A;  3MHH A;  2P86 A;  4MSX A;  3P5W A;  1YZB A;  3QJ3 A;  4BOQ A;  2IPP B;  3O65 A;  1AYV A;  3P5V A;  2B1M A;  4PP2 E;  4YV8 A;  3RNV A;  2FE8 A;  3BBA A;  5JA7 A;  2J7Q A;  4N79 A;  5JZE A;  1MEG A;  2DOS A;  4W4U A;  4ZTB A;  1X9Y A;  1TU6 A; 
#chains in the Genus database with same CATH homology
 4N4Z A;  1U5I A;  3RVX A;  3KFQ A;  1VJV A;  2XU4 A;  1QOL A;  2R9C A;  1Q6K A;  4I07 A;  1KFX L;  1NQC A;  3IHP A;  4NV7 A;  2DJF B;  1F2A A;  2Y5B A;  1XKG A;  1MDW A;  2OP3 A;  1O0E A;  3CBK A;  4CZW A;  1HUC B;  1YAL A;  2P0R A;  1MEM A;  3N4C A;  4YYV A;  1KHP A;  1F2C A;  3RVW A;  2R9M A;  1CS8 A;  3IEJ A;  1NB3 A;  2NQI A;  5F02 A;  4YYS A;  1AU0 A;  2VHF A;  2DC6 A;  1AEC A;  2HD5 A;  3BCN A;  2AIM A;  1YK8 A;  1TL9 A;  4MZS A;  3ERV A;  2DZZ A;  3I3T A;  3KSE A;  2DCC A;  2NQD B;  2G7Y A;  4YYW A;  4ZUX U;  4W5B A;  3RVV A;  4CDC B;  2C0Y A;  2WBF X;  1AYU A;  4X6I A;  3KWB X;  3P5X A;  1STF E;  4BPV A;  3BC3 A;  3CH3 X;  2G6D A;  3H8B A;  1BP4 A;  3CH2 X;  3H6S A;  4X6J A;  2R9F A;  5CVM A;  6PAD A;  1VSN A;  1ME3 A;  1W6F A;  4DMY A;  3C9E A;  1M6D A;  2DCD A;  4K7C A;  5EGW A;  1GMY A;  4YYU A;  1ZCM A;  2CB5 A;  2E00 A;  2YJ9 A;  3S3Q A;  1PE6 A;  5CHV A;  1ITO A;  2F7D A;  3OF9 A;  3BPF A;  3KKU A;  2YJB A;  4BGF A;  5FPW A;  2XU5 A;  1NL6 A;  2FT2 A;  2FRA A;  3B79 A;  1S4V A;  4N8W A;  2DZY A;  4NV8 A;  4AXM A;  2ARY A;  3MHS A;  3OIS A;  2Y6E A;  1SP4 B;  3F5V A;  4FIP A;  2FO5 A;  3S3R A;  5A24 A;  1KXR A;  1AYW A;  3N3K A;  1K3B B;  3USV A;  4X6H A;  4QRX A;  4C5P A;  4YYQ A;  4DMX A;  4CDF B;  1F29 A;  3GCB A;  1AIM A;  1MS6 A;  1CB5 A;  1W5R A;  1PXV A;  4PAD A;  4P6E A;  3KX1 A;  1JQP A;  3K24 A;  3HD3 A;  1BY8 A;  3BWK A;  1THE A;  1DF0 A;  2VFC A;  1GLO A;  1EWP A;  3I06 A;  4AXL A;  1MHW A;  1ICF A;  3QSD A;  4I05 A;  3BOW A;  4BS6 A;  1DEU A;  2JQG R;  3N3G A;  2FRQ A;  2AVW A;  3V6C A;  1PIP A;  1F2B A;  4PP1 A;  2AUX A;  2PAD A;  2AYN A;  1EF7 A;  4QRV A;  2IBI A;  1GX3 A;  1CSB B;  4HWY A;  3MOR A;  1EWL A;  2DC7 A;  3PDF A;  1POP A;  2BDL A;  3K9M A;  1U9V A;  1SNK A;  2YJC A;  3KWZ A;  2VHS A;  2BDZ A;  2B1N A;  3WXG A;  2AYO A;  3E1Z B;  1U9X A;  1Y08 A;  4WA6 A;  3BPM A;  4BS5 A;  4FK5 A;  7PCK A;  2PNS A;  3HWN A;  3CBJ A;  2XU3 A;  2AU1 A;  1QMY A;  1YT7 A;  1EWM A;  2P7U A;  2E03 A;  1AU2 A;  3OF8 A;  1YVB A;  2VFB A;  3PBH A;  1KHQ A;  1CQD A;  1YK7 A;  2F1G A;  4Q8G A;  4QRG A;  3IMA A;  3NHE A;  4PI3 A;  3WXF A;  1CTE A;  4CDE B;  1CVZ A;  1PPD A;  1QDQ A;  5K16 A;  3OVX A;  2YJ2 A;  4B55 A;  3WXE A;  2HH5 A;  1AU4 A;  2NQG A;  1U9W A;  3DF0 A;  2PBH A;  1PCI A;  1IWD A;  3O0U A;  4KLB A;  2H7J A;  4YYR A;  4G54 A;  4BQV A;  1PBH A;  1U9Q X;  3LFY A;  4XUI A;  3TNX A;  3H89 A;  2G8E A;  2HXZ A;  1PPN A;  4Q8H A;  1NLJ A;  2R6N A;  4MZO A;  3LXS A;  3O1G A;  3QT4 A;  3D6S A;  2HHN A;  2E02 A;  2CIO A;  3ZUA A;  1AU3 A;  1PAD A;  2NQA A;  1MIR A;  1BQI A;  4YVA A;  3V6E A;  3F75 A;  1NPZ A;  3H7D A;  1PPP A;  1GCB A;  2FUD A;  2FQ9 A;  3D9W A;  2DC9 A;  2DJG B;  3AI8 A;  2OUL A;  2PRE A;  1A6R A;  5J94 A;  1FH0 A;  2JQF R;  1CV8 A;  2XU1 A;  3H8C A;  1PPO A;  4OEL A;  1W4T A;  4QBB A;  9PAP A;  1ME4 A;  4P6G A;  4CDD B;  3OVZ A;  2R9O A;  1ATK A;  1BGO A;  8PCH A;  3IOQ A;  3HHA A;  2E01 A;  2AS8 A;  2DC8 A;  3LTW A;  2OZ2 A;  4FJC A;  4OEM A;  2DCA A;  2DCB A;  4XR7 A;  3M99 A;  2ATO A;  2GFO A;  1ZIV A;  3U8E A;  3P5U A;  1CPJ A;  2O6X A;  3IV2 A;  2GHU A;  2G8J A;  3K8U A;  3MTN A;  2AUZ A;  5CVO B;  5CVN B;  5EF4 A;  1QXP A;  1Y4H A;  5JH3 A;  4QH6 A;  2R9N A;  3KW9 A;  1EWO A;  1TLO A;  1GEC E;  1NB5 A;  4I04 A;  5CHT A;  2ACT A;  4BSQ A;  1CJL A;  3IUT A;  2FTD A;  4RY2 A;  2FYE A;  4W5C A;  5PAD A;  3PNR A;  3HHI A;  1KFU L;  3PW3 A;  2YJ8 A;  3MHH A;  2P86 A;  4MSX A;  3P5W A;  3QJ3 A;  2IPP B;  1AYV A;  3P5V A;  2B1M A;  4PP2 E;  4YV8 A;  4GUZ A;  5JA7 A;  1E2T A;  4N79 A;  1MEG A;  4W4U A;  2BSZ A;  1X9Y A;  1TU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...