3P5UA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Actinidin
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
total genus 70
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5uA00
3TNXA 1CJLA 2E02A 4ZUXU 2G6DA 4YYVA 9PAPA 2YJ9A 1PPOA 1NPZA 2ACTA 3IUTA 2NQDB 1NL6A 3N3KA 1NB3A 1PXVA 2AU1A 2XU3A 5CHVA 1MEGA 3OVXA 1X9YA 1U9QX 1QMYA 3KWZA 3N3GA 4X6IA 1U9WA 1PCIA 2WBFX 4I04A 4W5CA 1PPPA 2AUZA 2G8EA 2JQGR 1ME4A 2E03A 4YYQA 2PNSA 4CDDB 2Y6EA 4DMXA 2OP3A 2XU4A 2AVWA 1XKGA 2FO5A 3KFQA 1KHQA 1F2BA 1MS6A 1EWMA 3MTNA 2ARYA 1MIRA 1MEMA 3KW9A 1EWOA 2B1NA 1CQDA 2VHFA 3WXFA 1M6DA 2VHSA 4BS6A 1Q6KA 5CHTA 3N4CA 3OVZA 2AYNA 4MSXA 3H8BA 2BDLA 1BP4A 1KHPA 2DCBA 2R9NA 2DZYA 1GECE 2F7DA 3CBJA 3NHEA 3S3QA 2B1MA 2YJ2A 1THEA 1DEUA 4OELA 1MDWA 1NLJA 4CZWA 2IPPB 2AYOA 2Y5BA 3BPFA 3H6SA 4PP2E 1ME3A 5CVOB 1GLOA 3HD3A 4YYRA 3RVXA 4RY2A 3KKUA 3I06A 1TL9A 4AXLA 1JQPA 2HXZA 3PW3A 3DF0A 3O1GA 1QOLA 2E00A 2HD5A 4XR7A 2FRQA 2GFOA 3MHHA 2FYEA 1NQCA 3CH3X 3B79A 4I05A 1VSNA 3S3RA 3V6CA 4BSQA 2FRAA 1PPNA 4MZSA 3E1ZB 1PE6A 5EF4A 3RVWA 1ATKA 1K3BB 1U9XA 3P5XA 4Q8HA 3HWNA 1Y4HA 2FQ9A 1IWDA 3P5WA 4QRGA 3ERVA 2NQIA 4FJCA 5K16A 1AU4A 1AU0A 2YJBA 1A6RA 2PBHA 4PP1A 3K24A 3HHAA 1TLOA 1VJVA 1MHWA 1Y08A 1YK8A 1U5IA 4FK5A 1F29A 1GMYA 3LFYA 2P0RA 2FT2A 4P6EA 4N4ZA 8PCHA 3F75A 4CDEB 4YYWA 1ZCMA 3O0UA 4QRXA 6PADA 3MHSA 3BC3A 3PNRA 4BS5A 3K8UA 5PADA 1YALA 2XU1A 2NQAA 3M99A 1EWLA 4W4UA 3BPMA 1PBHA 4WA6A 4QRVA 3BOWA 1CPJA 2PREA 1NB5A 4DMYA 2R9FA 2FUDA 2OZ2A 2GHUA 1F2CA 3V6EA 1TU6A 4W5BA 1CVZA 3U8EA 1AIMA 1AU2A 2DCAA 3GCBA 3F5VA 5FPWA 1F2AA 1CV8A 2E01A 1STFE 1POPA 5A24A 2HHNA 2DC6A 5CVMA 3BWKA 1SNKA 1QXPA 3KWBX 2BDZA 1BGOA 3H7DA 2NQGA 1EWPA 4OEMA 3WXGA 4K7CA 2DJGB 1AECA 2P86A 1BQIA 2DJFB 4YVAA 3AI8A 3HHIA 2DZZA 3WXEA 5EGWA 4AXMA 4HWYA 1YT7A 2H7JA 4N79A 3OF8A 3IMAA 2YJ8A 2HH5A 4KLBA 4XUIA 1PIPA 3IV2A 1YVBA 3QT4A 1EF7A 4PI3A 4YYSA 4CDFB 1SP4B 2R9MA 4X6JA 4BPVA 1QDQA 1PADA 2R9CA 1ICFA 1AYVA 1AYUA 1O0EA 5CVNB 3PBHA 2F1GA 2R9OA 2DC7A 3LXSA 5JA7A 3I3TA 7PCKA 3D6SA 1ZIVA 1DF0A 2PADA 4FIPA 2IBIA 4CDCB 1CS8A 2AS8A 3PDFA 3P5VA 2YJCA 3IEJA 2CIOA 4N8WA 4MZOA 3MORA 4X6HA 1AYWA 1CTEA 3QSDA 4G54A 2O6XA 3QJ3A 3H8CA 3OISA 3IOQA 3ZUAA 1U9VA 2FTDA 2CB5A 3P5UA 4BQVA 2R6NA 4YV8A 3RVVA 5JH3A 1GCBA 2G7YA 3IHPA 1AU3A 1CSBB 1KXRA 2JQFR 4YYUA 1FH0A 3OF9A 2ATOA 1HUCB 1S4VA 1YK7A 1PPDA 5F02A 1CB5A 2G8JA 4Q8GA 4P6GA 2DCCA 3CBKA 1KFXL 3C9EA 2OULA 4QH6A 1KFUL 2P7UA 2DC9A 1BY8A 4QBBA 2AUXA 3KX1A 1ITOA 2DC8A 2AIMA 2C0YA 2XU5A 2DCDA 3USVA 4I07A 4PADA 3KSEA 5J94A 3K9MA 3BCNA 3H89A 3CH2X
chains in the Genus database with same CATH superfamily
2BTWA 3TNXA 3W31A 2J7QC 1CJLA 2E02A 4ZUXU 2G6DA 4YYVA 9PAPA 2YJ9A 1PPOA 1NPZA 3PHWA 5EZQA 2ACTA 3IUTA 2NQDB 1NL6A 3N3KA 1NB3A 1PXVA 2AU1A 2XU3A 5CHVA 1MEGA 3OVXA 1X9YA 1U9QX 1QMYA 3KWZA 3N3GA 4X6IA 1U9WA 1PCIA 2WBFX 4I04A 4RKXA 4W5CA 1PPPA 2AUZA 2G8EA 2JQGR 3B21A 1ME4A 2E03A 4YYQA 2PNSA 4CDDB 2Y6EA 4DMXA 2OP3A 2XU4A 2AVWA 4OW0A 4BOZA 1XKGA 2FO5A 3KFQA 1KHQA 1F2BA 1MS6A 1EWMA 3MTNA 2ARYA 1MIRA 1MEMA 3KW9A 3MP2A 1EWOA 2B1NA 1CQDA 2VHFA 3WXFA 1M6DA 2VHSA 4GUAA 4BS6A 1Q6KA 5CHTA 3N4CA 3OVZA 2AYNA 4MSXA 3H8BA 2BDLA 1BP4A 1KHPA 2DCBA 2R9NA 2DZYA 5JZEA 1GECE 2F7DA 3CBJA 3NHEA 3MTVA 3S3QA 2B1MA 2YJ2A 1THEA 1DEUA 4OELA 1MDWA 1NLJA 4CZWA 2IPPB 2AYOA 2Y5BA 3BPFA 3H6SA 4PP2E 1ME3A 5CVOB 1GLOA 3HD3A 3PT2A 2Z84A 4YYRA 4D8IA 3RVXA 4RY2A 3KKUA 3I06A 1TL9A 4AXLA 1JQPA 2HXZA 4RNAA 3PW3A 3DF0A 3O1GA 3BBAA 4PT5A 1QOLA 3PSEA 2E00A 2HD5A 4XR7A 2FRQA 2GFOA 3MHHA 2FYEA 3O65A 1NQCA 2JRIA 3CH3X 3B79A 4I05A 1VSNA 3S3RA 3V6CA 5E6JA 4BSQA 2FRAA 4IP3A 1PPNA 4MZSA 3E1ZB 1PE6A 4OVZB 5EF4A 3RVWA 1ATKA 1K3BB 2FE8A 1U9XA 3P5XA 4Q8HA 3HWNA 1Y4HA 2FQ9A 1IWDA 3W30A 4M0WA 3P5WA 4QRGA 3ERVA 2NQIA 4FJCA 5K16A 1AU4A 1AU0A 2YJBA 1A6RA 2PBHA 4PP1A 3K24A 3HHAA 3PRMA 1TLOA 1VJVA 1MHWA 1Y08A 1YK8A 1U5IA 4FK5A 1F29A 1GMYA 3LFYA 2P0RA 2FT2A 4P6EA 4N4ZA 8PCHA 3RNVA 3F75A 4CDEB 4YYWA 1ZCMA 3O0UA 4QRXA 1YZBA 6PADA 3MHSA 3BC3A 4MM3B 3PNRA 4BS5A 3K8UA 5PADA 1YALA 2XU1A 2NQAA 3BB7A 4BOSA 3M99A 1EWLA 4W4UA 3BPMA 1PBHA 4WA6A 4QRVA 4REZA 3BOWA 1CPJA 2PREA 4D8BA 1NB5A 4DMYA 2R9FA 3IFUA 2FUDA 2OZ2A 2GHUA 1F2CA 3V6EA 4HXDB 1TU6A 4W5BA 1UKFA 1CVZA 3U8EA 1AIMA 1AU2A 2DCAA 3GCBA 3F5VA 5FPWA 1F2AA 1CV8A 2E01A 1STFE 3PRPA 1POPA 5A24A 2UZJA 2HHNA 2DC6A 5CVMA 3BWKA 1SNKA 1QXPA 3KWBX 2BDZA 1BGOA 3H7DA 2NQGA 1EWPA 4OEMA 4BOQA 3WXGA 4ZTBA 4XZXA 1DKIA 2BTWB 4K7CA 2DJGB 1AECA 2P86A 1BQIA 2DJFB 4YVAA 3AI8A 3HHIA 2DZZA 4R3DA 3WXEA 5EGWA 4RF0A 4AXMA 1YT7A 2H7JA 4HWYA 4N79A 3OF8A 3IMAA 2YJ8A 2HH5A 4KLBA 3OQCA 4XUIA 1PIPA 3IV2A 1YVBA 3QT4A 1EF7A 3TMPA 4PI3A 4YYSA 2JTCA 4CDFB 4BOUA 1SP4B 2R9MA 4X6JA 4BPVA 1QDQA 1PADA 2R9CA 3TRKA 1ICFA 1AYVA 1AYUA 1O0EA 5CVNB 3PBHA 4OVZA 3MJ5A 2F1GA 2R9OA 2DC7A 3LXSA 5JA7A 3I3TA 7PCKA 3D6SA 1ZIVA 2J7QA 1DF0A 2PADA 4FIPA 2IBIA 4CDCB 1CS8A 2AS8A 3PDFA 5KO3A 3P5VA 2YJCA 3IEJA 2CIOA 4N8WA 4MZOA 3MORA 4X6HA 1AYWA 1CTEA 3QSDA 4G54A 2O6XA 3QJ3A 3H8CA 3OISA 3IOQA 4RF1A 4D8EA 2HWKA 4P16A 3ZUAA 1U9VA 2FTDA 2CB5A 3P5UA 4BQVA 2R6NA 4YV8A 3RVVA 5JH3A 4A5UA 1GCBA 2G7YA 3IHPA 1AU3A 1CSBB 1KXRA 2JQFR 5EZSA 4YYUA 1FH0A 3OF9A 2ATOA 2DOSA 2AGAA 1HUCB 1S4VA 1YK7A 3PHXA 4IUMA 3C0RA 1PPDA 5F02A 1CB5A 2G8JA 3ZNHA 4MI7A 2BU3A 4Q8GA 4P6GA 2DCCA 4WURA 3CBKA 1KFXL 3C9EA 1PVJA 2OULA 4QH6A 1KFUL 2P7UA 2DC9A 1BY8A 4QBBA 2AUXA 3KX1A 3PHUA 1ITOA 2DC8A 2AIMA 2C0YA 2XU5A 2DCDA 4BOPA 3USVA 4I07A 4PADA 3KSEA 5J94A 3K9MA 3BCNA 3BY4A 3H89A 3E9SA 3CH2X
chains in the Genus database with same CATH topology
3TNXA 2BSZA 1CJLA 2E02A 4ZUXU 2G6DA 1E2TA 4YYVA 9PAPA 2YJ9A 1PPOA 1NPZA 2ACTA 3IUTA 2NQDB 1NL6A 3N3KA 1NB3A 4C5PA 1PXVA 2AU1A 2XU3A 5CHVA 1MEGA 3OVXA 1X9YA 1U9QX 1QMYA 3KWZA 3N3GA 4X6IA 1U9WA 1PCIA 2WBFX 4I04A 4W5CA 1PPPA 2AUZA 2G8EA 2JQGR 1ME4A 2E03A 4YYQA 2PNSA 4CDDB 2Y6EA 4DMXA 2OP3A 2XU4A 2AVWA 1XKGA 2FO5A 3KFQA 1KHQA 1F2BA 1MS6A 1EWMA 3MTNA 2ARYA 1MIRA 1MEMA 3KW9A 4NV7A 1EWOA 2B1NA 1CQDA 2VHFA 3WXFA 1M6DA 2VHSA 3D9WA 4BS6A 1Q6KA 4GUZA 5CHTA 3N4CA 3OVZA 2AYNA 4MSXA 3H8BA 2BDLA 1BP4A 1KHPA 2DCBA 2R9NA 2DZYA 1GECE 2F7DA 3CBJA 3NHEA 3S3QA 2B1MA 2YJ2A 1THEA 1DEUA 4OELA 1MDWA 1NLJA 4CZWA 2IPPB 2AYOA 2Y5BA 3BPFA 3H6SA 1W4TA 4PP2E 1ME3A 5CVOB 1GLOA 3HD3A 4YYRA 3RVXA 4RY2A 3KKUA 3I06A 1TL9A 4AXLA 1JQPA 2HXZA 3PW3A 3DF0A 3O1GA 1QOLA 2E00A 2HD5A 4XR7A 2FRQA 2GFOA 3MHHA 2FYEA 1NQCA 3CH3X 3B79A 4I05A 1VSNA 3S3RA 3V6CA 4BSQA 2FRAA 1PPNA 4MZSA 3E1ZB 1PE6A 5EF4A 3RVWA 1ATKA 1K3BB 1U9XA 3P5XA 4Q8HA 3HWNA 1Y4HA 2FQ9A 1IWDA 3P5WA 4QRGA 3ERVA 2NQIA 4FJCA 5K16A 1AU4A 1AU0A 2YJBA 1A6RA 2PBHA 4PP1A 3K24A 3HHAA 1TLOA 1VJVA 1MHWA 1Y08A 1YK8A 1U5IA 4FK5A 1F29A 1GMYA 3LFYA 2P0RA 2FT2A 4P6EA 4N4ZA 8PCHA 3F75A 4CDEB 4YYWA 1ZCMA 3O0UA 4QRXA 6PADA 3MHSA 3BC3A 3PNRA 3LTWA 4BS5A 3K8UA 5PADA 1YALA 2XU1A 2NQAA 3M99A 1EWLA 4W4UA 3BPMA 1PBHA 4WA6A 4QRVA 3BOWA 1CPJA 2PREA 1NB5A 4DMYA 2R9FA 2FUDA 2OZ2A 2GHUA 1F2CA 3V6EA 1TU6A 4W5BA 1CVZA 2VFCA 3U8EA 1AIMA 1AU2A 2DCAA 3GCBA 3F5VA 5FPWA 1F2AA 1CV8A 2E01A 1STFE 1GX3A 1POPA 5A24A 2HHNA 2DC6A 5CVMA 3BWKA 1SNKA 1QXPA 3KWBX 2BDZA 1BGOA 3H7DA 2NQGA 1EWPA 4OEMA 3WXGA 4K7CA 2DJGB 1AECA 2P86A 4BGFA 1BQIA 2DJFB 4YVAA 3AI8A 3HHIA 2DZZA 3WXEA 5EGWA 4AXMA 4HWYA 1YT7A 2H7JA 4N79A 3OF8A 3IMAA 2YJ8A 2HH5A 4KLBA 4XUIA 1PIPA 3IV2A 1YVBA 3QT4A 1EF7A 4PI3A 4YYSA 4CDFB 1SP4B 2R9MA 4X6JA 4BPVA 1QDQA 1PADA 2R9CA 1ICFA 1AYVA 1AYUA 1W5RA 1O0EA 5CVNB 3PBHA 2F1GA 2R9OA 2DC7A 3LXSA 5JA7A 3I3TA 7PCKA 3D6SA 1ZIVA 1DF0A 2PADA 4FIPA 2IBIA 4CDCB 1CS8A 2AS8A 3PDFA 3P5VA 2YJCA 3IEJA 2CIOA 4N8WA 4MZOA 3MORA 4X6HA 1AYWA 1CTEA 3QSDA 4NV8A 4G54A 2O6XA 3QJ3A 3H8CA 3OISA 3IOQA 3ZUAA 1U9VA 2FTDA 2CB5A 3P5UA 4BQVA 2R6NA 4YV8A 3RVVA 5JH3A 1GCBA 2G7YA 3IHPA 1AU3A 4B55A 1CSBB 1KXRA 2JQFR 4YYUA 1FH0A 3OF9A 2ATOA 1HUCB 1S4VA 1YK7A 1PPDA 5F02A 1CB5A 2G8JA 4Q8GA 4P6GA 2DCCA 3CBKA 1KFXL 3C9EA 2OULA 4QH6A 1KFUL 2P7UA 2DC9A 1BY8A 4QBBA 2AUXA 3KX1A 1ITOA 2DC8A 2AIMA 2C0YA 2XU5A 1W6FA 2DCDA 2VFBA 3USVA 4I07A 4PADA 3KSEA 5J94A 3K9MA 3BCNA 3H89A 3CH2X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TNX A;  1CJL A;  2E02 A;  4ZUX U;  2G6D A;  4YYV A;  9PAP A;  2YJ9 A;  1PPO A;  1NPZ A;  2ACT A;  3IUT A;  2NQD B;  1NL6 A;  3N3K A;  1NB3 A;  1PXV A;  2AU1 A;  2XU3 A;  5CHV A;  1MEG A;  3OVX A;  1X9Y A;  1U9Q X;  1QMY A;  3KWZ A;  3N3G A;  4X6I A;  1U9W A;  1PCI A;  2WBF X;  4I04 A;  4W5C A;  1PPP A;  2AUZ A;  2G8E A;  2JQG R;  1ME4 A;  2E03 A;  4YYQ A;  2PNS A;  4CDD B;  2Y6E A;  4DMX A;  2OP3 A;  2XU4 A;  2AVW A;  1XKG A;  2FO5 A;  3KFQ A;  1KHQ A;  1F2B A;  1MS6 A;  1EWM A;  3MTN A;  2ARY A;  1MIR A;  1MEM A;  3KW9 A;  1EWO A;  2B1N A;  1CQD A;  2VHF A;  3WXF A;  1M6D A;  2VHS A;  4BS6 A;  1Q6K A;  5CHT A;  3N4C A;  3OVZ A;  2AYN A;  4MSX A;  3H8B A;  2BDL A;  1BP4 A;  1KHP A;  2DCB A;  2R9N A;  2DZY A;  1GEC E;  2F7D A;  3CBJ A;  3NHE A;  3S3Q A;  2B1M A;  2YJ2 A;  1THE A;  1DEU A;  4OEL A;  1MDW A;  1NLJ A;  4CZW A;  2IPP B;  2AYO A;  2Y5B A;  3BPF A;  3H6S A;  4PP2 E;  1ME3 A;  5CVO B;  1GLO A;  3HD3 A;  4YYR A;  3RVX A;  4RY2 A;  3KKU A;  3I06 A;  1TL9 A;  4AXL A;  1JQP A;  2HXZ A;  3PW3 A;  3DF0 A;  3O1G A;  1QOL A;  2E00 A;  2HD5 A;  4XR7 A;  2FRQ A;  2GFO A;  3MHH A;  2FYE A;  1NQC A;  3CH3 X;  3B79 A;  4I05 A;  1VSN A;  3S3R A;  3V6C A;  4BSQ A;  2FRA A;  1PPN A;  4MZS A;  3E1Z B;  1PE6 A;  5EF4 A;  3RVW A;  1ATK A;  1K3B B;  1U9X A;  3P5X A;  4Q8H A;  3HWN A;  1Y4H A;  2FQ9 A;  1IWD A;  3P5W A;  4QRG A;  3ERV A;  2NQI A;  4FJC A;  5K16 A;  1AU4 A;  1AU0 A;  2YJB A;  1A6R A;  2PBH A;  4PP1 A;  3K24 A;  3HHA A;  1TLO A;  1VJV A;  1MHW A;  1Y08 A;  1YK8 A;  1U5I A;  4FK5 A;  1F29 A;  1GMY A;  3LFY A;  2P0R A;  2FT2 A;  4P6E A;  4N4Z A;  8PCH A;  3F75 A;  4CDE B;  4YYW A;  1ZCM A;  3O0U A;  4QRX A;  6PAD A;  3MHS A;  3BC3 A;  3PNR A;  4BS5 A;  3K8U A;  5PAD A;  1YAL A;  2XU1 A;  2NQA A;  3M99 A;  1EWL A;  4W4U A;  3BPM A;  1PBH A;  4WA6 A;  4QRV A;  3BOW A;  1CPJ A;  2PRE A;  1NB5 A;  4DMY A;  2R9F A;  2FUD A;  2OZ2 A;  2GHU A;  1F2C A;  3V6E A;  1TU6 A;  4W5B A;  1CVZ A;  3U8E A;  1AIM A;  1AU2 A;  2DCA A;  3GCB A;  3F5V A;  5FPW A;  1F2A A;  1CV8 A;  2E01 A;  1STF E;  1POP A;  5A24 A;  2HHN A;  2DC6 A;  5CVM A;  3BWK A;  1SNK A;  1QXP A;  3KWB X;  2BDZ A;  1BGO A;  3H7D A;  2NQG A;  1EWP A;  4OEM A;  3WXG A;  4K7C A;  2DJG B;  1AEC A;  2P86 A;  1BQI A;  2DJF B;  4YVA A;  3AI8 A;  3HHI A;  2DZZ A;  3WXE A;  5EGW A;  4AXM A;  4HWY A;  1YT7 A;  2H7J A;  4N79 A;  3OF8 A;  3IMA A;  2YJ8 A;  2HH5 A;  4KLB A;  4XUI A;  1PIP A;  3IV2 A;  1YVB A;  3QT4 A;  1EF7 A;  4PI3 A;  4YYS A;  4CDF B;  1SP4 B;  2R9M A;  4X6J A;  4BPV A;  1QDQ A;  1PAD A;  2R9C A;  1ICF A;  1AYV A;  1AYU A;  1O0E A;  5CVN B;  3PBH A;  2F1G A;  2R9O A;  2DC7 A;  3LXS A;  5JA7 A;  3I3T A;  7PCK A;  3D6S A;  1ZIV A;  1DF0 A;  2PAD A;  4FIP A;  2IBI A;  4CDC B;  1CS8 A;  2AS8 A;  3PDF A;  3P5V A;  2YJC A;  3IEJ A;  2CIO A;  4N8W A;  4MZO A;  3MOR A;  4X6H A;  1AYW A;  1CTE A;  3QSD A;  4G54 A;  2O6X A;  3QJ3 A;  3H8C A;  3OIS A;  3IOQ A;  3ZUA A;  1U9V A;  2FTD A;  2CB5 A;  3P5U A;  4BQV A;  2R6N A;  4YV8 A;  3RVV A;  5JH3 A;  1GCB A;  2G7Y A;  3IHP A;  1AU3 A;  1CSB B;  1KXR A;  2JQF R;  4YYU A;  1FH0 A;  3OF9 A;  2ATO A;  1HUC B;  1S4V A;  1YK7 A;  1PPD A;  5F02 A;  1CB5 A;  2G8J A;  4Q8G A;  4P6G A;  2DCC A;  3CBK A;  1KFX L;  3C9E A;  2OUL A;  4QH6 A;  1KFU L;  2P7U A;  2DC9 A;  1BY8 A;  4QBB A;  2AUX A;  3KX1 A;  1ITO A;  2DC8 A;  2AIM A;  2C0Y A;  2XU5 A;  2DCD A;  3USV A;  4I07 A;  4PAD A;  3KSE A;  5J94 A;  3K9M A;  3BCN A;  3H89 A;  3CH2 X; 
#chains in the Genus database with same CATH topology
 2BTW A;  3TNX A;  3W31 A;  2J7Q C;  1CJL A;  2E02 A;  4ZUX U;  2G6D A;  4YYV A;  9PAP A;  2YJ9 A;  1PPO A;  1NPZ A;  3PHW A;  5EZQ A;  2ACT A;  3IUT A;  2NQD B;  1NL6 A;  3N3K A;  1NB3 A;  1PXV A;  2AU1 A;  2XU3 A;  5CHV A;  1MEG A;  3OVX A;  1X9Y A;  1U9Q X;  1QMY A;  3KWZ A;  3N3G A;  4X6I A;  1U9W A;  1PCI A;  2WBF X;  4I04 A;  4RKX A;  4W5C A;  1PPP A;  2AUZ A;  2G8E A;  2JQG R;  3B21 A;  1ME4 A;  2E03 A;  4YYQ A;  2PNS A;  4CDD B;  2Y6E A;  4DMX A;  2OP3 A;  2XU4 A;  2AVW A;  4OW0 A;  4BOZ A;  1XKG A;  2FO5 A;  3KFQ A;  1KHQ A;  1F2B A;  1MS6 A;  1EWM A;  3MTN A;  2ARY A;  1MIR A;  1MEM A;  3KW9 A;  3MP2 A;  1EWO A;  2B1N A;  1CQD A;  2VHF A;  3WXF A;  1M6D A;  2VHS A;  4GUA A;  4BS6 A;  1Q6K A;  5CHT A;  3N4C A;  3OVZ A;  2AYN A;  4MSX A;  3H8B A;  2BDL A;  1BP4 A;  1KHP A;  2DCB A;  2R9N A;  2DZY A;  5JZE A;  1GEC E;  2F7D A;  3CBJ A;  3NHE A;  3MTV A;  3S3Q A;  2B1M A;  2YJ2 A;  1THE A;  1DEU A;  4OEL A;  1MDW A;  1NLJ A;  4CZW A;  2IPP B;  2AYO A;  2Y5B A;  3BPF A;  3H6S A;  4PP2 E;  1ME3 A;  5CVO B;  1GLO A;  3HD3 A;  3PT2 A;  2Z84 A;  4YYR A;  4D8I A;  3RVX A;  4RY2 A;  3KKU A;  3I06 A;  1TL9 A;  4AXL A;  1JQP A;  2HXZ A;  4RNA A;  3PW3 A;  3DF0 A;  3O1G A;  3BBA A;  4PT5 A;  1QOL A;  3PSE A;  2E00 A;  2HD5 A;  4XR7 A;  2FRQ A;  2GFO A;  3MHH A;  2FYE A;  3O65 A;  1NQC A;  2JRI A;  3CH3 X;  3B79 A;  4I05 A;  1VSN A;  3S3R A;  3V6C A;  5E6J A;  4BSQ A;  2FRA A;  4IP3 A;  1PPN A;  4MZS A;  3E1Z B;  1PE6 A;  4OVZ B;  5EF4 A;  3RVW A;  1ATK A;  1K3B B;  2FE8 A;  1U9X A;  3P5X A;  4Q8H A;  3HWN A;  1Y4H A;  2FQ9 A;  1IWD A;  3W30 A;  4M0W A;  3P5W A;  4QRG A;  3ERV A;  2NQI A;  4FJC A;  5K16 A;  1AU4 A;  1AU0 A;  2YJB A;  1A6R A;  2PBH A;  4PP1 A;  3K24 A;  3HHA A;  3PRM A;  1TLO A;  1VJV A;  1MHW A;  1Y08 A;  1YK8 A;  1U5I A;  4FK5 A;  1F29 A;  1GMY A;  3LFY A;  2P0R A;  2FT2 A;  4P6E A;  4N4Z A;  8PCH A;  3RNV A;  3F75 A;  4CDE B;  4YYW A;  1ZCM A;  3O0U A;  4QRX A;  1YZB A;  6PAD A;  3MHS A;  3BC3 A;  4MM3 B;  3PNR A;  4BS5 A;  3K8U A;  5PAD A;  1YAL A;  2XU1 A;  2NQA A;  3BB7 A;  4BOS A;  3M99 A;  1EWL A;  4W4U A;  3BPM A;  1PBH A;  4WA6 A;  4QRV A;  4REZ A;  3BOW A;  1CPJ A;  2PRE A;  4D8B A;  1NB5 A;  4DMY A;  2R9F A;  3IFU A;  2FUD A;  2OZ2 A;  2GHU A;  1F2C A;  3V6E A;  4HXD B;  1TU6 A;  4W5B A;  1UKF A;  1CVZ A;  3U8E A;  1AIM A;  1AU2 A;  2DCA A;  3GCB A;  3F5V A;  5FPW A;  1F2A A;  1CV8 A;  2E01 A;  1STF E;  3PRP A;  1POP A;  5A24 A;  2UZJ A;  2HHN A;  2DC6 A;  5CVM A;  3BWK A;  1SNK A;  1QXP A;  3KWB X;  2BDZ A;  1BGO A;  3H7D A;  2NQG A;  1EWP A;  4OEM A;  4BOQ A;  3WXG A;  4ZTB A;  4XZX A;  1DKI A;  2BTW B;  4K7C A;  2DJG B;  1AEC A;  2P86 A;  1BQI A;  2DJF B;  4YVA A;  3AI8 A;  3HHI A;  2DZZ A;  4R3D A;  3WXE A;  5EGW A;  4RF0 A;  4AXM A;  1YT7 A;  2H7J A;  4HWY A;  4N79 A;  3OF8 A;  3IMA A;  2YJ8 A;  2HH5 A;  4KLB A;  3OQC A;  4XUI A;  1PIP A;  3IV2 A;  1YVB A;  3QT4 A;  1EF7 A;  3TMP A;  4PI3 A;  4YYS A;  2JTC A;  4CDF B;  4BOU A;  1SP4 B;  2R9M A;  4X6J A;  4BPV A;  1QDQ A;  1PAD A;  2R9C A;  3TRK A;  1ICF A;  1AYV A;  1AYU A;  1O0E A;  5CVN B;  3PBH A;  4OVZ A;  3MJ5 A;  2F1G A;  2R9O A;  2DC7 A;  3LXS A;  5JA7 A;  3I3T A;  7PCK A;  3D6S A;  1ZIV A;  2J7Q A;  1DF0 A;  2PAD A;  4FIP A;  2IBI A;  4CDC B;  1CS8 A;  2AS8 A;  3PDF A;  5KO3 A;  3P5V A;  2YJC A;  3IEJ A;  2CIO A;  4N8W A;  4MZO A;  3MOR A;  4X6H A;  1AYW A;  1CTE A;  3QSD A;  4G54 A;  2O6X A;  3QJ3 A;  3H8C A;  3OIS A;  3IOQ A;  4RF1 A;  4D8E A;  2HWK A;  4P16 A;  3ZUA A;  1U9V A;  2FTD A;  2CB5 A;  3P5U A;  4BQV A;  2R6N A;  4YV8 A;  3RVV A;  5JH3 A;  4A5U A;  1GCB A;  2G7Y A;  3IHP A;  1AU3 A;  1CSB B;  1KXR A;  2JQF R;  5EZS A;  4YYU A;  1FH0 A;  3OF9 A;  2ATO A;  2DOS A;  2AGA A;  1HUC B;  1S4V A;  1YK7 A;  3PHX A;  4IUM A;  3C0R A;  1PPD A;  5F02 A;  1CB5 A;  2G8J A;  3ZNH A;  4MI7 A;  2BU3 A;  4Q8G A;  4P6G A;  2DCC A;  4WUR A;  3CBK A;  1KFX L;  3C9E A;  1PVJ A;  2OUL A;  4QH6 A;  1KFU L;  2P7U A;  2DC9 A;  1BY8 A;  4QBB A;  2AUX A;  3KX1 A;  3PHU A;  1ITO A;  2DC8 A;  2AIM A;  2C0Y A;  2XU5 A;  2DCD A;  4BOP A;  3USV A;  4I07 A;  4PAD A;  3KSE A;  5J94 A;  3K9M A;  3BCN A;  3BY4 A;  3H89 A;  3E9S A;  3CH2 X; 
#chains in the Genus database with same CATH homology
 3TNX A;  2BSZ A;  1CJL A;  2E02 A;  4ZUX U;  2G6D A;  1E2T A;  4YYV A;  9PAP A;  2YJ9 A;  1PPO A;  1NPZ A;  2ACT A;  3IUT A;  2NQD B;  1NL6 A;  3N3K A;  1NB3 A;  4C5P A;  1PXV A;  2AU1 A;  2XU3 A;  5CHV A;  1MEG A;  3OVX A;  1X9Y A;  1U9Q X;  1QMY A;  3KWZ A;  3N3G A;  4X6I A;  1U9W A;  1PCI A;  2WBF X;  4I04 A;  4W5C A;  1PPP A;  2AUZ A;  2G8E A;  2JQG R;  1ME4 A;  2E03 A;  4YYQ A;  2PNS A;  4CDD B;  2Y6E A;  4DMX A;  2OP3 A;  2XU4 A;  2AVW A;  1XKG A;  2FO5 A;  3KFQ A;  1KHQ A;  1F2B A;  1MS6 A;  1EWM A;  3MTN A;  2ARY A;  1MIR A;  1MEM A;  3KW9 A;  4NV7 A;  1EWO A;  2B1N A;  1CQD A;  2VHF A;  3WXF A;  1M6D A;  2VHS A;  3D9W A;  4BS6 A;  1Q6K A;  4GUZ A;  5CHT A;  3N4C A;  3OVZ A;  2AYN A;  4MSX A;  3H8B A;  2BDL A;  1BP4 A;  1KHP A;  2DCB A;  2R9N A;  2DZY A;  1GEC E;  2F7D A;  3CBJ A;  3NHE A;  3S3Q A;  2B1M A;  2YJ2 A;  1THE A;  1DEU A;  4OEL A;  1MDW A;  1NLJ A;  4CZW A;  2IPP B;  2AYO A;  2Y5B A;  3BPF A;  3H6S A;  1W4T A;  4PP2 E;  1ME3 A;  5CVO B;  1GLO A;  3HD3 A;  4YYR A;  3RVX A;  4RY2 A;  3KKU A;  3I06 A;  1TL9 A;  4AXL A;  1JQP A;  2HXZ A;  3PW3 A;  3DF0 A;  3O1G A;  1QOL A;  2E00 A;  2HD5 A;  4XR7 A;  2FRQ A;  2GFO A;  3MHH A;  2FYE A;  1NQC A;  3CH3 X;  3B79 A;  4I05 A;  1VSN A;  3S3R A;  3V6C A;  4BSQ A;  2FRA A;  1PPN A;  4MZS A;  3E1Z B;  1PE6 A;  5EF4 A;  3RVW A;  1ATK A;  1K3B B;  1U9X A;  3P5X A;  4Q8H A;  3HWN A;  1Y4H A;  2FQ9 A;  1IWD A;  3P5W A;  4QRG A;  3ERV A;  2NQI A;  4FJC A;  5K16 A;  1AU4 A;  1AU0 A;  2YJB A;  1A6R A;  2PBH A;  4PP1 A;  3K24 A;  3HHA A;  1TLO A;  1VJV A;  1MHW A;  1Y08 A;  1YK8 A;  1U5I A;  4FK5 A;  1F29 A;  1GMY A;  3LFY A;  2P0R A;  2FT2 A;  4P6E A;  4N4Z A;  8PCH A;  3F75 A;  4CDE B;  4YYW A;  1ZCM A;  3O0U A;  4QRX A;  6PAD A;  3MHS A;  3BC3 A;  3PNR A;  3LTW A;  4BS5 A;  3K8U A;  5PAD A;  1YAL A;  2XU1 A;  2NQA A;  3M99 A;  1EWL A;  4W4U A;  3BPM A;  1PBH A;  4WA6 A;  4QRV A;  3BOW A;  1CPJ A;  2PRE A;  1NB5 A;  4DMY A;  2R9F A;  2FUD A;  2OZ2 A;  2GHU A;  1F2C A;  3V6E A;  1TU6 A;  4W5B A;  1CVZ A;  2VFC A;  3U8E A;  1AIM A;  1AU2 A;  2DCA A;  3GCB A;  3F5V A;  5FPW A;  1F2A A;  1CV8 A;  2E01 A;  1STF E;  1GX3 A;  1POP A;  5A24 A;  2HHN A;  2DC6 A;  5CVM A;  3BWK A;  1SNK A;  1QXP A;  3KWB X;  2BDZ A;  1BGO A;  3H7D A;  2NQG A;  1EWP A;  4OEM A;  3WXG A;  4K7C A;  2DJG B;  1AEC A;  2P86 A;  4BGF A;  1BQI A;  2DJF B;  4YVA A;  3AI8 A;  3HHI A;  2DZZ A;  3WXE A;  5EGW A;  4AXM A;  4HWY A;  1YT7 A;  2H7J A;  4N79 A;  3OF8 A;  3IMA A;  2YJ8 A;  2HH5 A;  4KLB A;  4XUI A;  1PIP A;  3IV2 A;  1YVB A;  3QT4 A;  1EF7 A;  4PI3 A;  4YYS A;  4CDF B;  1SP4 B;  2R9M A;  4X6J A;  4BPV A;  1QDQ A;  1PAD A;  2R9C A;  1ICF A;  1AYV A;  1AYU A;  1W5R A;  1O0E A;  5CVN B;  3PBH A;  2F1G A;  2R9O A;  2DC7 A;  3LXS A;  5JA7 A;  3I3T A;  7PCK A;  3D6S A;  1ZIV A;  1DF0 A;  2PAD A;  4FIP A;  2IBI A;  4CDC B;  1CS8 A;  2AS8 A;  3PDF A;  3P5V A;  2YJC A;  3IEJ A;  2CIO A;  4N8W A;  4MZO A;  3MOR A;  4X6H A;  1AYW A;  1CTE A;  3QSD A;  4NV8 A;  4G54 A;  2O6X A;  3QJ3 A;  3H8C A;  3OIS A;  3IOQ A;  3ZUA A;  1U9V A;  2FTD A;  2CB5 A;  3P5U A;  4BQV A;  2R6N A;  4YV8 A;  3RVV A;  5JH3 A;  1GCB A;  2G7Y A;  3IHP A;  1AU3 A;  4B55 A;  1CSB B;  1KXR A;  2JQF R;  4YYU A;  1FH0 A;  3OF9 A;  2ATO A;  1HUC B;  1S4V A;  1YK7 A;  1PPD A;  5F02 A;  1CB5 A;  2G8J A;  4Q8G A;  4P6G A;  2DCC A;  3CBK A;  1KFX L;  3C9E A;  2OUL A;  4QH6 A;  1KFU L;  2P7U A;  2DC9 A;  1BY8 A;  4QBB A;  2AUX A;  3KX1 A;  1ITO A;  2DC8 A;  2AIM A;  2C0Y A;  2XU5 A;  1W6F A;  2DCD A;  2VFB A;  3USV A;  4I07 A;  4PAD A;  3KSE A;  5J94 A;  3K9M A;  3BCN A;  3H89 A;  3CH2 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...