5JZEA

Erve virus viral otu domain protease in complex with mouse isg15
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
159
Chain Sequence
VNRLDAIVWENIEGNLSRAFLTLDLHAFFNVNKEVGDGNCFYRALSRLHSESRTSNEHLYYRLLIPDAVDKYFDIEPEAIGLGLNKQEYVSKAILDGEWAGSLEASMLSKFLDITIIIWIVDDSGTIISANRYGEGRPSQAYNLCMVGNAHFDSLYIRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin-like protein ISG15
publication title Biochemical and Structural Insights into the Preference of Nairoviral DeISGylases for Interferon-Stimulated Gene Product 15 Originating from Certain Species.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 159
sequence length 159
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5jzeA00
4BOUA 4BOQA 3PRPA 5JZEA 3PHUA 4BOZA 3BY4A 3PHWA 3PHXA 3PRMA 4HXDB 3ZNHA 3PT2A 4BOPA 3TMPA 3PSEA 4BOSA 3C0RA
chains in the Genus database with same CATH superfamily
4QH6A 3TNXA 3V6CA 1MIRA 1HUCB 3ZUAA 4YYVA 4OELA 3KX1A 2R9OA 4HWYA 2R9CA 1KXRA 1IWDA 8PCHA 2E01A 1BGOA 1EWMA 4QRVA 2FT2A 3BC3A 1KFXL 3HHIA 2H7JA 5CVMA 2FYEA 1MDWA 3H8CA 1AECA 2XU4A 2DCCA 1Y08A 4OVZA 2BDZA 3BPMA 3LFYA 3IFUA 3KSEA 2HWKA 3BB7A 4ZTBA 1KFUL 2VHFA 1U9XA 1AYUA 5JA7A 2AYNA 1O0EA 1F2CA 1Y4HA 2NQIA 2B1MA 3IV2A 3WXEA 2G8EA 1CB5A 3IMAA 4Q8HA 3KWBX 3MHHA 1U9QX 4WURA 4BOZA 4P6EA 4FJCA 2PADA 3H89A 4BOSA 1NB5A 1TU6A 3PBHA 4CZWA 5EGWA 3WXFA 4XUIA 2FRQA 1AU0A 1AU4A 1AIMA 3TRKA 4YYSA 2DCDA 4N4ZA 3BPFA 4I05A 6PADA 3DF0A 4MZOA 1QMYA 3AI8A 3ZNHA 1AU3A 1BQIA 1U9WA 2CIOA 5CHVA 2AUXA 4FK5A 3KW9A 1YVBA 3P5VA 2BDLA 2DCAA 2J7QA 3PNRA 3H8BA 5E6JA 2AU1A 4BS5A 3MHSA 4XR7A 3D6SA 5EZQA 1YT7A 4RF1A 3MJ5A 4GUAA 1PXVA 1BY8A 1PPPA 2P0RA 3PHWA 2DCBA 1CPJA 4RKXA 2PNSA 1TL9A 1NLJA 1NL6A 2PREA 4HXDB 2WBFX 1GLOA 4QBBA 3NHEA 2Y6EA 2NQGA 2JTCA 2PBHA 4W5BA 3QSDA 4W4UA 1VJVA 2E00A 2DJFB 4M0WA 3U8EA 2HD5A 3O0UA 3CH3X 3O65A 3ERVA 1YK7A 4RF0A 2VHSA 4PT5A 3IEJA 4X6HA 2GHUA 3I3TA 3N3GA 4BSQA 3PHXA 3BBAA 2FE8A 3BOWA 3N3KA 5KO3A 3WXGA 2CB5A 2B1NA 3CH2X 1AYWA 2AVWA 3F5VA 3GCBA 3H6SA 4CDEB 4MSXA 1GECE 4IUMA 5K16A 4BQVA 3MTVA 2F7DA 1CJLA 3QJ3A 2AIMA 3P5XA 1PCIA 1F29A 4CDCB 2YJ2A 2AYOA 3B21A 2R6NA 1MS6A 4D8BA 1U5IA 3H7DA 1BP4A 1PPNA 3PRPA 4YYUA 1PPOA 1M6DA 1NQCA 1PBHA 4WA6A 3S3QA 1PPDA 1Q6KA 4YYWA 3OQCA 1MEMA 2G7YA 1GCBA 3K24A 1GMYA 1UKFA 4QRXA 5CHTA 3PT2A 2GFOA 2P7UA 2AGAA 1CV8A 4AXMA 2ATOA 4MM3B 3P5UA 3OVXA 2C0YA 4N8WA 1XKGA 2NQDB 2OZ2A 3QT4A 2DC8A 4P6GA 1YZBA 4BOUA 2AS8A 2FO5A 1AU2A 1PE6A 4BOQA 1POPA 2DZYA 2BTWA 5PADA 4FIPA 4DMYA 4MZSA 1A6RA 2FRAA 3IHPA 2YJCA 1NPZA 1CSBB 3K8UA 2BU3A 3IOQA 1QDQA 3PRMA 2DC6A 4YYRA 2FTDA 1PADA 4BS6A 2G6DA 2R9FA 5CVNB 1U9VA 3PW3A 4YVAA 2JQGR 4K7CA 4OVZB 2DJGB 4W5CA 2ARYA 3BWKA 3RNVA 3USVA 3O1GA 4CDFB 2YJ9A 4DMXA 1ME4A 2OP3A 1ZIVA 4I07A 1VSNA 1MEGA 3MORA 3CBJA 5JH3A 4YV8A 1DEUA 3KKUA 3C9EA 1YK8A 1JQPA 1NB3A 2XU3A 3W30A 2HHNA 2UZJA 3RVVA 3LXSA 5CVOB 4BPVA 1TLOA 1CS8A 4MI7A 4ZUXU 2IPPB 1QOLA 2JQFR 4RY2A 2E03A 2G8JA 4PP1A 2IBIA 4REZA 4PI3A 4KLBA 3MP2A 3PDFA 3S3RA 3OVZA 2YJ8A 3OF8A 3K9MA 1CQDA 1EWPA 4N79A 3C0RA 2HH5A 1FH0A 2R9NA 4X6IA 1PIPA 2R9MA 3OISA 3MTNA 1S4VA 2JRIA 2E02A 1F2BA 2Y5BA 3M99A 1X9YA 2DC7A 3N4CA 1KHPA 3KWZA 3HHAA 5J94A 4OW0A 3E9SA 4QRGA 2BTWB 1ITOA 2XU5A 3PSEA 3RVWA 5A24A 3OF9A 2P86A 4G54A 4D8IA 3P5WA 1QXPA 1MHWA 4R3DA 4I04A 1PVJA 1THEA 1SP4B 5EZSA 3TMPA 3HD3A 1ATKA 4PADA 5EF4A 4RNAA 1KHQA 1EWOA 1CVZA 2NQAA 2AUZA 2HXZA 2FUDA 2O6XA 2ACTA 4XZXA 1CTEA 3I06A 3PHUA 4Q8GA 1EWLA 3CBKA 2F1GA 4PP2E 1YALA 4D8EA 3W31A 4AXLA 5FPWA 3V6EA 1K3BB 4OEMA 1AYVA 3KFQA 3IUTA 4CDDB 2DC9A 1EF7A 1ICFA 5JZEA 3B79A 2FQ9A 4IP3A 1SNKA 2DZZA 2OULA 5F02A 7PCKA 4X6JA 2XU1A 4YYQA 9PAPA 4P16A 4A5UA 3BCNA 1F2AA 2DOSA 3RVXA 2J7QC 3F75A 3BY4A 1DF0A 1DKIA 1STFE 1ME3A 1ZCMA 3HWNA 2YJBA 2Z84A 4BOPA 3E1ZB
chains in the Genus database with same CATH topology
5EZQA 2AGAA 4RF1A 3C0RA 3MJ5A 4GUAA 4MM3B 2JRIA 3PHWA 4RKXA 4HXDB 1YZBA 4BOUA 4OW0A 3E9SA 2BTWB 2JTCA 3PSEA 4BOQA 2BTWA 4D8IA 4M0WA 4OVZA 3IFUA 3O65A 2HWKA 4RF0A 3BB7A 4ZTBA 4R3DA 4PT5A 2BU3A 1PVJA 3PRMA 5EZSA 3TMPA 3PHXA 3BBAA 4RNAA 2FE8A 4OVZB 5KO3A 4XZXA 3RNVA 4WURA 3PHUA 4BOZA 4BOSA 4D8EA 4IUMA 3MTVA 3W31A 5JZEA 3TRKA 3B21A 4IP3A 4D8BA 3W30A 2UZJA 3PRPA 3ZNHA 4P16A 4A5UA 2DOSA 4MI7A 2J7QC 5E6JA 3BY4A 3OQCA 1DKIA 1UKFA 4REZA 2J7QA 3PT2A 2Z84A 4BOPA 3MP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOU A;  4BOQ A;  3PRP A;  5JZE A;  3PHU A;  4BOZ A;  3BY4 A;  3PHW A;  3PHX A;  3PRM A;  4HXD B;  3ZNH A;  3PT2 A;  4BOP A;  3TMP A;  3PSE A;  4BOS A;  3C0R A; 
#chains in the Genus database with same CATH topology
 4QH6 A;  3TNX A;  3V6C A;  1MIR A;  1HUC B;  3ZUA A;  4YYV A;  4OEL A;  3KX1 A;  2R9O A;  4HWY A;  2R9C A;  1KXR A;  1IWD A;  8PCH A;  2E01 A;  1BGO A;  1EWM A;  4QRV A;  2FT2 A;  3BC3 A;  1KFX L;  3HHI A;  2H7J A;  5CVM A;  2FYE A;  1MDW A;  3H8C A;  1AEC A;  2XU4 A;  2DCC A;  1Y08 A;  4OVZ A;  2BDZ A;  3BPM A;  3LFY A;  3IFU A;  3KSE A;  2HWK A;  3BB7 A;  4ZTB A;  1KFU L;  2VHF A;  1U9X A;  1AYU A;  5JA7 A;  2AYN A;  1O0E A;  1F2C A;  1Y4H A;  2NQI A;  2B1M A;  3IV2 A;  3WXE A;  2G8E A;  1CB5 A;  3IMA A;  4Q8H A;  3KWB X;  3MHH A;  1U9Q X;  4WUR A;  4BOZ A;  4P6E A;  4FJC A;  2PAD A;  3H89 A;  4BOS A;  1NB5 A;  1TU6 A;  3PBH A;  4CZW A;  5EGW A;  3WXF A;  4XUI A;  2FRQ A;  1AU0 A;  1AU4 A;  1AIM A;  3TRK A;  4YYS A;  2DCD A;  4N4Z A;  3BPF A;  4I05 A;  6PAD A;  3DF0 A;  4MZO A;  1QMY A;  3AI8 A;  3ZNH A;  1AU3 A;  1BQI A;  1U9W A;  2CIO A;  5CHV A;  2AUX A;  4FK5 A;  3KW9 A;  1YVB A;  3P5V A;  2BDL A;  2DCA A;  2J7Q A;  3PNR A;  3H8B A;  5E6J A;  2AU1 A;  4BS5 A;  3MHS A;  4XR7 A;  3D6S A;  5EZQ A;  1YT7 A;  4RF1 A;  3MJ5 A;  4GUA A;  1PXV A;  1BY8 A;  1PPP A;  2P0R A;  3PHW A;  2DCB A;  1CPJ A;  4RKX A;  2PNS A;  1TL9 A;  1NLJ A;  1NL6 A;  2PRE A;  4HXD B;  2WBF X;  1GLO A;  4QBB A;  3NHE A;  2Y6E A;  2NQG A;  2JTC A;  2PBH A;  4W5B A;  3QSD A;  4W4U A;  1VJV A;  2E00 A;  2DJF B;  4M0W A;  3U8E A;  2HD5 A;  3O0U A;  3CH3 X;  3O65 A;  3ERV A;  1YK7 A;  4RF0 A;  2VHS A;  4PT5 A;  3IEJ A;  4X6H A;  2GHU A;  3I3T A;  3N3G A;  4BSQ A;  3PHX A;  3BBA A;  2FE8 A;  3BOW A;  3N3K A;  5KO3 A;  3WXG A;  2CB5 A;  2B1N A;  3CH2 X;  1AYW A;  2AVW A;  3F5V A;  3GCB A;  3H6S A;  4CDE B;  4MSX A;  1GEC E;  4IUM A;  5K16 A;  4BQV A;  3MTV A;  2F7D A;  1CJL A;  3QJ3 A;  2AIM A;  3P5X A;  1PCI A;  1F29 A;  4CDC B;  2YJ2 A;  2AYO A;  3B21 A;  2R6N A;  1MS6 A;  4D8B A;  1U5I A;  3H7D A;  1BP4 A;  1PPN A;  3PRP A;  4YYU A;  1PPO A;  1M6D A;  1NQC A;  1PBH A;  4WA6 A;  3S3Q A;  1PPD A;  1Q6K A;  4YYW A;  3OQC A;  1MEM A;  2G7Y A;  1GCB A;  3K24 A;  1GMY A;  1UKF A;  4QRX A;  5CHT A;  3PT2 A;  2GFO A;  2P7U A;  2AGA A;  1CV8 A;  4AXM A;  2ATO A;  4MM3 B;  3P5U A;  3OVX A;  2C0Y A;  4N8W A;  1XKG A;  2NQD B;  2OZ2 A;  3QT4 A;  2DC8 A;  4P6G A;  1YZB A;  4BOU A;  2AS8 A;  2FO5 A;  1AU2 A;  1PE6 A;  4BOQ A;  1POP A;  2DZY A;  2BTW A;  5PAD A;  4FIP A;  4DMY A;  4MZS A;  1A6R A;  2FRA A;  3IHP A;  2YJC A;  1NPZ A;  1CSB B;  3K8U A;  2BU3 A;  3IOQ A;  1QDQ A;  3PRM A;  2DC6 A;  4YYR A;  2FTD A;  1PAD A;  4BS6 A;  2G6D A;  2R9F A;  5CVN B;  1U9V A;  3PW3 A;  4YVA A;  2JQG R;  4K7C A;  4OVZ B;  2DJG B;  4W5C A;  2ARY A;  3BWK A;  3RNV A;  3USV A;  3O1G A;  4CDF B;  2YJ9 A;  4DMX A;  1ME4 A;  2OP3 A;  1ZIV A;  4I07 A;  1VSN A;  1MEG A;  3MOR A;  3CBJ A;  5JH3 A;  4YV8 A;  1DEU A;  3KKU A;  3C9E A;  1YK8 A;  1JQP A;  1NB3 A;  2XU3 A;  3W30 A;  2HHN A;  2UZJ A;  3RVV A;  3LXS A;  5CVO B;  4BPV A;  1TLO A;  1CS8 A;  4MI7 A;  4ZUX U;  2IPP B;  1QOL A;  2JQF R;  4RY2 A;  2E03 A;  2G8J A;  4PP1 A;  2IBI A;  4REZ A;  4PI3 A;  4KLB A;  3MP2 A;  3PDF A;  3S3R A;  3OVZ A;  2YJ8 A;  3OF8 A;  3K9M A;  1CQD A;  1EWP A;  4N79 A;  3C0R A;  2HH5 A;  1FH0 A;  2R9N A;  4X6I A;  1PIP A;  2R9M A;  3OIS A;  3MTN A;  1S4V A;  2JRI A;  2E02 A;  1F2B A;  2Y5B A;  3M99 A;  1X9Y A;  2DC7 A;  3N4C A;  1KHP A;  3KWZ A;  3HHA A;  5J94 A;  4OW0 A;  3E9S A;  4QRG A;  2BTW B;  1ITO A;  2XU5 A;  3PSE A;  3RVW A;  5A24 A;  3OF9 A;  2P86 A;  4G54 A;  4D8I A;  3P5W A;  1QXP A;  1MHW A;  4R3D A;  4I04 A;  1PVJ A;  1THE A;  1SP4 B;  5EZS A;  3TMP A;  3HD3 A;  1ATK A;  4PAD A;  5EF4 A;  4RNA A;  1KHQ A;  1EWO A;  1CVZ A;  2NQA A;  2AUZ A;  2HXZ A;  2FUD A;  2O6X A;  2ACT A;  4XZX A;  1CTE A;  3I06 A;  3PHU A;  4Q8G A;  1EWL A;  3CBK A;  2F1G A;  4PP2 E;  1YAL A;  4D8E A;  3W31 A;  4AXL A;  5FPW A;  3V6E A;  1K3B B;  4OEM A;  1AYV A;  3KFQ A;  3IUT A;  4CDD B;  2DC9 A;  1EF7 A;  1ICF A;  5JZE A;  3B79 A;  2FQ9 A;  4IP3 A;  1SNK A;  2DZZ A;  2OUL A;  5F02 A;  7PCK A;  4X6J A;  2XU1 A;  4YYQ A;  9PAP A;  4P16 A;  4A5U A;  3BCN A;  1F2A A;  2DOS A;  3RVX A;  2J7Q C;  3F75 A;  3BY4 A;  1DF0 A;  1DKI A;  1STF E;  1ME3 A;  1ZCM A;  3HWN A;  2YJB A;  2Z84 A;  4BOP A;  3E1Z B; 
#chains in the Genus database with same CATH homology
 5EZQ A;  2AGA A;  4RF1 A;  3C0R A;  3MJ5 A;  4GUA A;  4MM3 B;  2JRI A;  3PHW A;  4RKX A;  4HXD B;  1YZB A;  4BOU A;  4OW0 A;  3E9S A;  2BTW B;  2JTC A;  3PSE A;  4BOQ A;  2BTW A;  4D8I A;  4M0W A;  4OVZ A;  3IFU A;  3O65 A;  2HWK A;  4RF0 A;  3BB7 A;  4ZTB A;  4R3D A;  4PT5 A;  2BU3 A;  1PVJ A;  3PRM A;  5EZS A;  3TMP A;  3PHX A;  3BBA A;  4RNA A;  2FE8 A;  4OVZ B;  5KO3 A;  4XZX A;  3RNV A;  4WUR A;  3PHU A;  4BOZ A;  4BOS A;  4D8E A;  4IUM A;  3MTV A;  3W31 A;  5JZE A;  3TRK A;  3B21 A;  4IP3 A;  4D8B A;  3W30 A;  2UZJ A;  3PRP A;  3ZNH A;  4P16 A;  4A5U A;  2DOS A;  4MI7 A;  2J7Q C;  5E6J A;  3BY4 A;  3OQC A;  1DKI A;  1UKF A;  4REZ A;  2J7Q A;  3PT2 A;  2Z84 A;  4BOP A;  3MP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...