5JZEA

Erve virus viral otu domain protease in complex with mouse isg15
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
159
Chain Sequence
b'VNRLDAIVWENIEGNLSRAFLTLDLHAFFNVNKEVGDGNCFYRALSRLHSESRTSNEHLYYRLLIPDAVDKYFDIEPEAIGLGLNKQEYVSKAILDGEWAGSLEASMLSKFLDITIIIWIVDDSGTIISANRYGEGRPSQAYNLCMVGNAHFDSLYIRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ISG15
publication title Biochemical and Structural Insights into the Preference of Nairoviral DeISGylases for Interferon-Stimulated Gene Product 15 Originating from Certain Species.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 47
structure length 159
sequence length 159
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5jzeA00
3PT2A 4BOPA 3C0RA 4BOSA 3PHWA 3PRPA 3PSEA 3PHUA 3TMPA 5JZEA 4BOQA 4HXDB 4BOZA 4BOUA 3PRMA 3ZNHA 3BY4A 3PHXA
chains in the Genus database with same CATH superfamily
2IBIA 1CVZA 3KX1A 1BQIA 1QMYA 1NQCA 4PI3A 4RY2A 3QT4A 4P16A 3C0RA 1F29A 2CB5A 1ZCMA 1THEA 3PT2A 4PP1A 9PAPA 3OISA 2P7UA 2DC8A 3IEJA 1QDQA 3PHXA 3BCNA 1F2BA 4X6JA 3RVWA 5FPWA 3PRMA 4BS5A 5CVMA 3ZUAA 4CDCB 2E02A 1GLOA 3S3QA 4MM3B 1F2CA 5A24A 1GMYA 4REZA 2R9FA 1PBHA 1NB5A 4MZOA 3ERVA 3KSEA 4BSQA 1NLJA 4MSXA 5J94A 4MI7A 1PADA 1DEUA 1TLOA 4I05A 2BTWA 2DC6A 1EWMA 2AUZA 2JQGR 2E03A 4CZWA 3HD3A 2NQAA 2DZYA 2HH5A 2OZ2A 3BC3A 3DF0A 5JA7A 1PPPA 4PT5A 1ICFA 3ZNHA 2DCCA 2GHUA 2VHFA 1CS8A 2FUDA 3MP2A 3RVVA 4BOZA 3IHPA 3OF9A 3PW3A 4D8IA 4RKXA 2UZJA 3LFYA 4HWYA 2XU5A 4DMYA 1AIMA 3O1GA 4CDFB 1DF0A 3IV2A 4YYRA 3BOWA 1Y08A 3CBKA 1AU0A 3KKUA 1NB3A 3BB7A 4QH6A 2Y5BA 2DZZA 3PHUA 2G8JA 3RVXA 4X6IA 3I3TA 2NQDB 1EWPA 2YJ2A 1PVJA 4CDEB 4OVZB 1MEGA 1CB5A 2GFOA 3P5WA 1F2AA 3WXGA 1ZIVA 4YVAA 3O0UA 5CVOB 5F02A 3PBHA 4WA6A 4W5CA 2BDZA 3E9SA 1DKIA 3K8UA 1AYUA 4YV8A 2AIMA 4MZSA 4I07A 1MIRA 4RF1A 1PCIA 3H8CA 4XR7A 2PADA 5CVNB 1AU2A 3B21A 2VHSA 2ACTA 3MORA 3CH3X 4A5UA 3MJ5A 2JQFR 2PREA 2JTCA 1BY8A 3HHAA 4M0WA 3IMAA 2FE8A 1KXRA 2OULA 1STFE 1ME3A 5EZSA 3BBAA 3TNXA 3MTNA 3S3RA 2R9OA 3KWBX 1EF7A 7PCKA 3IOQA 4BPVA 1Q6KA 1K3BB 3E1ZB 4N8WA 4QRGA 4BOPA 1MHWA 4YYWA 2HD5A 2AS8A 4IUMA 3QSDA 4HXDB 1AU3A 2PBHA 1YALA 3H7DA 2NQIA 4YYVA 1PPNA 3PNRA 1JQPA 2YJ8A 2AVWA 2DC7A 1CV8A 3AI8A 4XUIA 4OVZA 4FIPA 1XKGA 2BU3A 1QXPA 3CBJA 3W30A 4OELA 1VSNA 2DCBA 3QJ3A 2G7YA 1AYVA 2F7DA 1ATKA 2FYEA 2FRQA 1M6DA 3PRPA 1PIPA 2PNSA 1GECE 1NPZA 3RNVA 2DOSA 2IPPB 3OQCA 2E00A 4X6HA 5KO3A 2DJGB 4K7CA 1AYWA 2YJCA 1POPA 1EWLA 1KFXL 1CPJA 1QOLA 3H8BA 3N3KA 4W5BA 3K24A 1ME4A 3C9EA 3OVXA 3MTVA 4Q8GA 4P6GA 3BPFA 2P0RA 4FJCA 1YK7A 4WURA 3MHSA 3N3GA 1KHPA 4D8BA 2XU4A 3N4CA 3V6EA 2J7QC 4XZXA 1CJLA 1VJVA 3H6SA 4I04A 1PXVA 5CHTA 2R9MA 1YZBA 3CH2X 1PPDA 2DCDA 1O0EA 3USVA 1BP4A 1CTEA 4FK5A 2DC9A 3PSEA 1TL9A 4BQVA 1CQDA 3MHHA 3TMPA 1S4VA 2B1MA 4BOQA 1U5IA 4G54A 3P5XA 2P86A 4DMXA 3P5UA 1KFUL 8PCHA 1KHQA 4KLBA 1IWDA 4W4UA 3IUTA 1SNKA 3W31A 1YT7A 4ZUXU 1EWOA 2F1GA 1MDWA 3WXEA 2G6DA 1X9YA 4Q8HA 3HHIA 1Y4HA 1PE6A 2BDLA 2H7JA 2HHNA 2FTDA 3K9MA 5PADA 4GUAA 4ZTBA 2JRIA 1MS6A 4AXLA 5JH3A 4YYSA 1U9QX 1FH0A 2CIOA 5EF4A 4IP3A 3PDFA 1ITOA 4BOSA 4AXMA 3I06A 4N79A 3B79A 5JZEA 3BY4A 4RNAA 3BPMA 1A6RA 2Y6EA 3HWNA 1U9WA 2AU1A 3F75A 3KW9A 3H89A 4BS6A 1AECA 5EZQA 5E6JA 3WXFA 2E01A 2HWKA 4R3DA 3BWKA 3F5VA 3M99A 2C0YA 2OP3A 3IFUA 4RF0A 2DCAA 2WBFX 1TU6A 3U8EA 2R9CA 3NHEA 2R9NA 2ATOA 2XU3A 4YYUA 3KWZA 4N4ZA 4P6EA 1YVBA 2AYNA 4YYQA 2AYOA 2J7QA 1CSBB 2FRAA 4OEMA 5EGWA 1PPOA 2ARYA 2G8EA 4QRXA 1U9VA 1BGOA 1HUCB 1YK8A 4BOUA 5K16A 3V6CA 4QBBA 3TRKA 1AU4A 3PHWA 6PADA 2AGAA 4OW0A 2HXZA 1SP4B 2FQ9A 3OF8A 2AUXA 1UKFA 4PADA 2XU1A 3O65A 4D8EA 2DJFB 2FO5A 2BTWB 3D6SA 5CHVA 2YJBA 1GCBA 2NQGA 2YJ9A 2FT2A 4CDDB 3OVZA 2O6XA 4PP2E 3GCBA 4QRVA 2Z84A 3KFQA 1NL6A 1U9XA 2R6NA 1MEMA 2B1NA 3P5VA 3LXSA
chains in the Genus database with same CATH topology
3W30A 3BB7A 4P16A 3C0RA 4IP3A 3PHUA 1PVJA 3PT2A 4BOSA 4OVZB 3PRPA 5JZEA 3RNVA 2DOSA 3BY4A 3OQCA 3PHXA 4RNAA 5KO3A 3E9SA 1DKIA 5EZQA 5E6JA 3PRMA 4RF1A 2HWKA 4R3DA 3MTVA 3B21A 4MM3B 3IFUA 4RF0A 4WURA 4D8BA 4REZA 4A5UA 3MJ5A 2JTCA 2J7QC 4M0WA 4XZXA 2FE8A 2J7QA 4MI7A 5EZSA 1YZBA 3BBAA 4BOUA 2BTWA 3TRKA 3PHWA 2AGAA 3PSEA 4OW0A 4BOPA 3TMPA 4BOQA 4IUMA 4HXDB 1UKFA 4PT5A 3O65A 4D8EA 3ZNHA 2BTWB 3MP2A 4BOZA 3W31A 4D8IA 4RKXA 2UZJA 4OVZA 2Z84A 2BU3A 4GUAA 4ZTBA 2JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PT2 A;  4BOP A;  3C0R A;  4BOS A;  3PHW A;  3PRP A;  3PSE A;  3PHU A;  3TMP A;  5JZE A;  4BOQ A;  4HXD B;  4BOZ A;  4BOU A;  3PRM A;  3ZNH A;  3BY4 A;  3PHX A; 
#chains in the Genus database with same CATH topology
 2IBI A;  1CVZ A;  3KX1 A;  1BQI A;  1QMY A;  1NQC A;  4PI3 A;  4RY2 A;  3QT4 A;  4P16 A;  3C0R A;  1F29 A;  2CB5 A;  1ZCM A;  1THE A;  3PT2 A;  4PP1 A;  9PAP A;  3OIS A;  2P7U A;  2DC8 A;  3IEJ A;  1QDQ A;  3PHX A;  3BCN A;  1F2B A;  4X6J A;  3RVW A;  5FPW A;  3PRM A;  4BS5 A;  5CVM A;  3ZUA A;  4CDC B;  2E02 A;  1GLO A;  3S3Q A;  4MM3 B;  1F2C A;  5A24 A;  1GMY A;  4REZ A;  2R9F A;  1PBH A;  1NB5 A;  4MZO A;  3ERV A;  3KSE A;  4BSQ A;  1NLJ A;  4MSX A;  5J94 A;  4MI7 A;  1PAD A;  1DEU A;  1TLO A;  4I05 A;  2BTW A;  2DC6 A;  1EWM A;  2AUZ A;  2JQG R;  2E03 A;  4CZW A;  3HD3 A;  2NQA A;  2DZY A;  2HH5 A;  2OZ2 A;  3BC3 A;  3DF0 A;  5JA7 A;  1PPP A;  4PT5 A;  1ICF A;  3ZNH A;  2DCC A;  2GHU A;  2VHF A;  1CS8 A;  2FUD A;  3MP2 A;  3RVV A;  4BOZ A;  3IHP A;  3OF9 A;  3PW3 A;  4D8I A;  4RKX A;  2UZJ A;  3LFY A;  4HWY A;  2XU5 A;  4DMY A;  1AIM A;  3O1G A;  4CDF B;  1DF0 A;  3IV2 A;  4YYR A;  3BOW A;  1Y08 A;  3CBK A;  1AU0 A;  3KKU A;  1NB3 A;  3BB7 A;  4QH6 A;  2Y5B A;  2DZZ A;  3PHU A;  2G8J A;  3RVX A;  4X6I A;  3I3T A;  2NQD B;  1EWP A;  2YJ2 A;  1PVJ A;  4CDE B;  4OVZ B;  1MEG A;  1CB5 A;  2GFO A;  3P5W A;  1F2A A;  3WXG A;  1ZIV A;  4YVA A;  3O0U A;  5CVO B;  5F02 A;  3PBH A;  4WA6 A;  4W5C A;  2BDZ A;  3E9S A;  1DKI A;  3K8U A;  1AYU A;  4YV8 A;  2AIM A;  4MZS A;  4I07 A;  1MIR A;  4RF1 A;  1PCI A;  3H8C A;  4XR7 A;  2PAD A;  5CVN B;  1AU2 A;  3B21 A;  2VHS A;  2ACT A;  3MOR A;  3CH3 X;  4A5U A;  3MJ5 A;  2JQF R;  2PRE A;  2JTC A;  1BY8 A;  3HHA A;  4M0W A;  3IMA A;  2FE8 A;  1KXR A;  2OUL A;  1STF E;  1ME3 A;  5EZS A;  3BBA A;  3TNX A;  3MTN A;  3S3R A;  2R9O A;  3KWB X;  1EF7 A;  7PCK A;  3IOQ A;  4BPV A;  1Q6K A;  1K3B B;  3E1Z B;  4N8W A;  4QRG A;  4BOP A;  1MHW A;  4YYW A;  2HD5 A;  2AS8 A;  4IUM A;  3QSD A;  4HXD B;  1AU3 A;  2PBH A;  1YAL A;  3H7D A;  2NQI A;  4YYV A;  1PPN A;  3PNR A;  1JQP A;  2YJ8 A;  2AVW A;  2DC7 A;  1CV8 A;  3AI8 A;  4XUI A;  4OVZ A;  4FIP A;  1XKG A;  2BU3 A;  1QXP A;  3CBJ A;  3W30 A;  4OEL A;  1VSN A;  2DCB A;  3QJ3 A;  2G7Y A;  1AYV A;  2F7D A;  1ATK A;  2FYE A;  2FRQ A;  1M6D A;  3PRP A;  1PIP A;  2PNS A;  1GEC E;  1NPZ A;  3RNV A;  2DOS A;  2IPP B;  3OQC A;  2E00 A;  4X6H A;  5KO3 A;  2DJG B;  4K7C A;  1AYW A;  2YJC A;  1POP A;  1EWL A;  1KFX L;  1CPJ A;  1QOL A;  3H8B A;  3N3K A;  4W5B A;  3K24 A;  1ME4 A;  3C9E A;  3OVX A;  3MTV A;  4Q8G A;  4P6G A;  3BPF A;  2P0R A;  4FJC A;  1YK7 A;  4WUR A;  3MHS A;  3N3G A;  1KHP A;  4D8B A;  2XU4 A;  3N4C A;  3V6E A;  2J7Q C;  4XZX A;  1CJL A;  1VJV A;  3H6S A;  4I04 A;  1PXV A;  5CHT A;  2R9M A;  1YZB A;  3CH2 X;  1PPD A;  2DCD A;  1O0E A;  3USV A;  1BP4 A;  1CTE A;  4FK5 A;  2DC9 A;  3PSE A;  1TL9 A;  4BQV A;  1CQD A;  3MHH A;  3TMP A;  1S4V A;  2B1M A;  4BOQ A;  1U5I A;  4G54 A;  3P5X A;  2P86 A;  4DMX A;  3P5U A;  1KFU L;  8PCH A;  1KHQ A;  4KLB A;  1IWD A;  4W4U A;  3IUT A;  1SNK A;  3W31 A;  1YT7 A;  4ZUX U;  1EWO A;  2F1G A;  1MDW A;  3WXE A;  2G6D A;  1X9Y A;  4Q8H A;  3HHI A;  1Y4H A;  1PE6 A;  2BDL A;  2H7J A;  2HHN A;  2FTD A;  3K9M A;  5PAD A;  4GUA A;  4ZTB A;  2JRI A;  1MS6 A;  4AXL A;  5JH3 A;  4YYS A;  1U9Q X;  1FH0 A;  2CIO A;  5EF4 A;  4IP3 A;  3PDF A;  1ITO A;  4BOS A;  4AXM A;  3I06 A;  4N79 A;  3B79 A;  5JZE A;  3BY4 A;  4RNA A;  3BPM A;  1A6R A;  2Y6E A;  3HWN A;  1U9W A;  2AU1 A;  3F75 A;  3KW9 A;  3H89 A;  4BS6 A;  1AEC A;  5EZQ A;  5E6J A;  3WXF A;  2E01 A;  2HWK A;  4R3D A;  3BWK A;  3F5V A;  3M99 A;  2C0Y A;  2OP3 A;  3IFU A;  4RF0 A;  2DCA A;  2WBF X;  1TU6 A;  3U8E A;  2R9C A;  3NHE A;  2R9N A;  2ATO A;  2XU3 A;  4YYU A;  3KWZ A;  4N4Z A;  4P6E A;  1YVB A;  2AYN A;  4YYQ A;  2AYO A;  2J7Q A;  1CSB B;  2FRA A;  4OEM A;  5EGW A;  1PPO A;  2ARY A;  2G8E A;  4QRX A;  1U9V A;  1BGO A;  1HUC B;  1YK8 A;  4BOU A;  5K16 A;  3V6C A;  4QBB A;  3TRK A;  1AU4 A;  3PHW A;  6PAD A;  2AGA A;  4OW0 A;  2HXZ A;  1SP4 B;  2FQ9 A;  3OF8 A;  2AUX A;  1UKF A;  4PAD A;  2XU1 A;  3O65 A;  4D8E A;  2DJF B;  2FO5 A;  2BTW B;  3D6S A;  5CHV A;  2YJB A;  1GCB A;  2NQG A;  2YJ9 A;  2FT2 A;  4CDD B;  3OVZ A;  2O6X A;  4PP2 E;  3GCB A;  4QRV A;  2Z84 A;  3KFQ A;  1NL6 A;  1U9X A;  2R6N A;  1MEM A;  2B1N A;  3P5V A;  3LXS A; 
#chains in the Genus database with same CATH homology
 3W30 A;  3BB7 A;  4P16 A;  3C0R A;  4IP3 A;  3PHU A;  1PVJ A;  3PT2 A;  4BOS A;  4OVZ B;  3PRP A;  5JZE A;  3RNV A;  2DOS A;  3BY4 A;  3OQC A;  3PHX A;  4RNA A;  5KO3 A;  3E9S A;  1DKI A;  5EZQ A;  5E6J A;  3PRM A;  4RF1 A;  2HWK A;  4R3D A;  3MTV A;  3B21 A;  4MM3 B;  3IFU A;  4RF0 A;  4WUR A;  4D8B A;  4REZ A;  4A5U A;  3MJ5 A;  2JTC A;  2J7Q C;  4M0W A;  4XZX A;  2FE8 A;  2J7Q A;  4MI7 A;  5EZS A;  1YZB A;  3BBA A;  4BOU A;  2BTW A;  3TRK A;  3PHW A;  2AGA A;  3PSE A;  4OW0 A;  4BOP A;  3TMP A;  4BOQ A;  4IUM A;  4HXD B;  1UKF A;  4PT5 A;  3O65 A;  4D8E A;  3ZNH A;  2BTW B;  3MP2 A;  4BOZ A;  3W31 A;  4D8I A;  4RKX A;  2UZJ A;  4OVZ A;  2Z84 A;  2BU3 A;  4GUA A;  4ZTB A;  2JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...