1Y4HA

Wild type staphopain-staphostatin complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
QVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords cysteine protease
publication title A comparison of staphostatin B with standard mechanism serine protease inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 53
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1y4hA00
4MZOA 3WXGA 1MDWA 1Q6KA 4YVAA 1QMYA 3KSEA 2FRAA 3CBKA 1EF7A 2F1GA 3PDFA 3IUTA 4W5CA 2OZ2A 1ME3A 1AU2A 2NQDB 1TLOA 2R9MA 3BCNA 4Q8GA 3CBJA 2HH5A 4I07A 5JH3A 3KW9A 1U9VA 8PCHA 2O6XA 1NLJA 2OULA 2ARYA 3QT4A 1BP4A 1DF0A 1NB3A 3LXSA 4QRVA 1Y4HA 4DMYA 1NB5A 3KWZA 5FPWA 1YT7A 3OVXA 1GMYA 4ZUXU 1U9XA 3I06A 3LFYA 4FIPA 3HHAA 2GHUA 4QBBA 1NL6A 5K16A 1CQDA 2NQAA 1O0EA 4AXLA 2G7YA 3PBHA 2YJCA 2FT2A 1AYVA 1MHWA 2DCAA 3IEJA 3CH3X 4X6HA 2DJGB 2FO5A 1KHQA 4YYWA 3QJ3A 2F7DA 2FYEA 4YYQA 4DMXA 1KXRA 2Y6EA 3QSDA 3P5VA 2CB5A 3K24A 4BS5A 2P0RA 4BQVA 1EWLA 4OEMA 4QRXA 3H7DA 3H8BA 5CHVA 3B79A 2G8JA 3RVWA 2DZYA 3S3QA 2BDLA 2AIMA 4YYSA 4N8WA 5CVMA 3WXEA 3KKUA 1AU0A 1F2CA 2DZZA 1VSNA 4CZWA 2R9NA 1PPDA 4BSQA 3BPMA 1AECA 2ATOA 1PIPA 4FJCA 2PADA 4X6IA 4CDEB 2VHFA 1U5IA 1TU6A 1CS8A 2CIOA 4QH6A 1F29A 4I04A 3TNXA 4KLBA 4PP2E 4MZSA 2PREA 1X9YA 1POPA 1CVZA 3N3KA 1MIRA 1U9QX 2XU5A 2YJ8A 2YJ2A 2YJBA 4HWYA 2G6DA 3BC3A 2AUZA 2HXZA 2IPPB 3ERVA 1NQCA 1QOLA 4K7CA 3N3GA 2DCCA 1PADA 5F02A 1DEUA 4X6JA 2DC6A 5J94A 2R9CA 2AYNA 3BWKA 4OELA 1XKGA 1YK8A 2BDZA 4WA6A 3I3TA 3N4CA 3HD3A 5EGWA 4QRGA 1A6RA 2G8EA 5JA7A 4XR7A 1EWPA 4Q8HA 4YYVA 2XU1A 3C9EA 2HHNA 1GCBA 1Y08A 1EWMA 4YV8A 3P5XA 1ZCMA 3IOQA 4YYUA 3S3RA 1CTEA 2P86A 4RY2A 1KFUL 1KHPA 1F2AA 1JQPA 2B1MA 3H89A 1EWOA 3IHPA 4MSXA 3M99A 5CVNB 4BS6A 3P5UA 3USVA 2B1NA 2AYOA 3OVZA 1S4VA 3MHSA 3MORA 2JQGR 1FH0A 4PI3A 3O0UA 1AU3A 1QDQA 3OISA 1NPZA 3V6CA 3DF0A 1ICFA 1PPOA 2AVWA 5A24A 3D6SA 2NQGA 2DC8A 1GECE 2AU1A 1BQIA 3K9MA 3MTNA 3H6SA 3KFQA 4PP1A 1PPNA 2E00A 1YALA 2R9OA 4PADA 2R9FA 3RVVA 1BY8A 1CV8A 1SP4B 3HHIA 1HUCB 2DJFB 6PADA 2JQFR 3RVXA 3O1GA 4P6GA 2XU4A 2P7UA 1BGOA 1ZIVA 4W4UA 2FQ9A 1MS6A 4G54A 1AYWA 2YJ9A 1CPJA 1K3BB 1IWDA 3IMAA 4CDFB 1M6DA 7PCKA 3U8EA 1F2BA 1ME4A 4I05A 2WBFX 1VJVA 2Y5BA 3NHEA 1TL9A 4W5BA 1PXVA 2DCBA 2R6NA 3H8CA 1YVBA 3WXFA 3BPFA 3KX1A 1ITOA 3BOWA 1CJLA 2ACTA 3V6EA 3PW3A 2E03A 2FTDA 3E1ZB 4CDDB 3GCBA 4XUIA 1YK7A 4P6EA 1AIMA 1PPPA 5CHTA 1PCIA 1CB5A 1ATKA 1MEMA 1GLOA 1MEGA 2HD5A 5CVOB 1CSBB 2PBHA 1AU4A 3IV2A 3OF8A 3CH2X 1THEA 3OF9A 3HWNA 1PE6A 2FRQA 2FUDA 3ZUAA 3KWBX 1SNKA 2XU3A 1U9WA 1QXPA 1AYUA 4N4ZA 4CDCB 3P5WA 2IBIA 2C0YA 4N79A 3AI8A 1STFE 2DCDA 2OP3A 5EF4A 2E02A 5PADA 3MHHA 2AUXA 2H7JA 1PBHA 4BPVA 2AS8A 1KFXL 4AXMA 3PNRA 3F5VA 2DC9A 2DC7A 2VHSA 4YYRA 2GFOA 3K8UA 9PAPA 2NQIA 2PNSA 3F75A 4FK5A 2E01A
chains in the Genus database with same CATH superfamily
4MZOA 2HWKA 3WXGA 1MDWA 1Q6KA 4YVAA 1QMYA 3KSEA 2FRAA 3CBKA 1EF7A 2F1GA 3PDFA 4BOUA 3IUTA 4W5CA 2OZ2A 1ME3A 1AU2A 2NQDB 1TLOA 2R9MA 3BCNA 4Q8GA 4A5UA 3CBJA 2HH5A 4I07A 3PT2A 5JH3A 3KW9A 1U9VA 4REZA 8PCHA 2O6XA 1NLJA 2OULA 2ARYA 3QT4A 1BP4A 1DF0A 5EZSA 1NB3A 3BY4A 1YZBA 3LXSA 4QRVA 1Y4HA 4DMYA 1NB5A 3KWZA 5FPWA 1YT7A 3OVXA 1GMYA 4ZUXU 4WURA 4D8IA 1U9XA 3I06A 3LFYA 4FIPA 3HHAA 2GHUA 4QBBA 1NL6A 5K16A 1CQDA 4RNAA 2NQAA 1O0EA 4M0WA 1DKIA 4AXLA 2G7YA 3PBHA 2YJCA 2FT2A 1AYVA 1MHWA 2DCAA 3IEJA 3CH3X 4X6HA 3IFUA 2DJGB 2FO5A 1KHQA 4MM3B 4P16A 4YYWA 2J7QC 3PHUA 3QJ3A 2F7DA 2FYEA 4YYQA 4DMXA 1KXRA 2Y6EA 3QSDA 3P5VA 2CB5A 3K24A 3MP2A 4OVZB 4BS5A 4MI7A 2P0RA 4BOZA 4BQVA 1EWLA 4OEMA 4QRXA 3H7DA 3H8BA 5CHVA 3B79A 2G8JA 3RVWA 2DZYA 3S3QA 4RF0A 2BDLA 2BTWB 2AIMA 4YYSA 4N8WA 5CVMA 3WXEA 3KKUA 1AU0A 4IP3A 1F2CA 2DZZA 1VSNA 3TRKA 4CZWA 2R9NA 4XZXA 1PPDA 4BSQA 3BPMA 1AECA 2ATOA 3MTVA 1PVJA 1PIPA 4FJCA 2UZJA 2PADA 4X6IA 4CDEB 3TMPA 2VHFA 1U5IA 1TU6A 1CS8A 2CIOA 4QH6A 1F29A 4I04A 3TNXA 4KLBA 1UKFA 4PP2E 4MZSA 2PREA 1X9YA 1POPA 1CVZA 3N3KA 4BOQA 1MIRA 3ZNHA 4RKXA 1U9QX 2XU5A 2YJ8A 2YJ2A 2YJBA 4HWYA 2G6DA 3BC3A 2AUZA 2HXZA 2IPPB 3ERVA 1NQCA 1QOLA 4K7CA 3N3GA 4IUMA 2DCCA 1PADA 5F02A 3PHXA 1DEUA 4X6JA 2DC6A 5J94A 2R9CA 2AYNA 4D8EA 3BWKA 4OELA 2JTCA 3B21A 1XKGA 1YK8A 2BDZA 4WA6A 3I3TA 3N4CA 3HD3A 5EGWA 2JRIA 4HXDB 4QRGA 1A6RA 2G8EA 5JA7A 4XR7A 1EWPA 4Q8HA 4YYVA 2XU1A 3C9EA 2HHNA 1GCBA 1Y08A 1EWMA 4YV8A 3P5XA 1ZCMA 3IOQA 4YYUA 4ZTBA 3S3RA 4BOSA 1CTEA 2P86A 3BBAA 4RY2A 1KFUL 1KHPA 1F2AA 1JQPA 2B1MA 3H89A 1EWOA 2BTWA 4BOPA 4OW0A 2Z84A 3IHPA 4MSXA 3M99A 5CVNB 3W30A 2AGAA 4BS6A 3P5UA 3USVA 2B1NA 2AYOA 3OVZA 1S4VA 3MHSA 3MORA 2JQGR 1FH0A 4D8BA 4PI3A 3O0UA 1AU3A 1QDQA 3OISA 1NPZA 3V6CA 3DF0A 1ICFA 1PPOA 2AVWA 5A24A 3D6SA 3PRPA 2NQGA 4RF1A 2DC8A 1GECE 2AU1A 1BQIA 3W31A 3K9MA 4GUAA 3PSEA 3MTNA 3H6SA 3MJ5A 3KFQA 3PHWA 4PP1A 1PPNA 2E00A 1YALA 2R9OA 4PADA 3E9SA 2R9FA 3RVVA 1BY8A 1CV8A 1SP4B 3C0RA 3HHIA 1HUCB 2DJFB 6PADA 4PT5A 2JQFR 3RVXA 3O1GA 4P6GA 2XU4A 2P7UA 1BGOA 1ZIVA 4W4UA 2FQ9A 1MS6A 4G54A 1AYWA 2YJ9A 2J7QA 1CPJA 1K3BB 1IWDA 3IMAA 3RNVA 4CDFB 1M6DA 7PCKA 3U8EA 1F2BA 1ME4A 4I05A 2WBFX 1VJVA 2Y5BA 2DOSA 3NHEA 1TL9A 4W5BA 1PXVA 2DCBA 2R6NA 3H8CA 1YVBA 3WXFA 3BPFA 3KX1A 3BB7A 1ITOA 3BOWA 1CJLA 2ACTA 3V6EA 4OVZA 3PW3A 2E03A 2FTDA 3E1ZB 4CDDB 3GCBA 4XUIA 1YK7A 4P6EA 1AIMA 1PPPA 5CHTA 5JZEA 1PCIA 1CB5A 1ATKA 1MEMA 1GLOA 1MEGA 2HD5A 5CVOB 3OQCA 1CSBB 2PBHA 1AU4A 3IV2A 3OF8A 3CH2X 1THEA 3OF9A 3HWNA 2BU3A 1PE6A 2FRQA 2FUDA 3ZUAA 3KWBX 1SNKA 2XU3A 1U9WA 2FE8A 1QXPA 1AYUA 4N4ZA 4CDCB 3P5WA 2IBIA 2C0YA 4R3DA 5E6JA 4N79A 5KO3A 3AI8A 1STFE 2DCDA 2OP3A 5EF4A 2E02A 5PADA 5EZQA 3MHHA 2AUXA 2H7JA 1PBHA 4BPVA 3PRMA 2AS8A 1KFXL 4AXMA 3PNRA 3F5VA 2DC9A 2DC7A 2VHSA 4YYRA 2GFOA 3K8UA 9PAPA 2NQIA 3O65A 2PNSA 3F75A 4FK5A 2E01A
chains in the Genus database with same CATH topology
4MZOA 3WXGA 1MDWA 1Q6KA 4YVAA 1QMYA 3KSEA 1GX3A 2FRAA 3CBKA 1EF7A 2F1GA 3PDFA 3IUTA 4W5CA 2OZ2A 1ME3A 1AU2A 2NQDB 1TLOA 2R9MA 3BCNA 4Q8GA 3CBJA 1E2TA 2HH5A 4I07A 5JH3A 3KW9A 1U9VA 8PCHA 2O6XA 1NLJA 2OULA 2ARYA 3QT4A 1BP4A 1DF0A 1NB3A 3LXSA 4QRVA 1Y4HA 4DMYA 1NB5A 3KWZA 5FPWA 1YT7A 3OVXA 1GMYA 4ZUXU 1U9XA 3I06A 3LFYA 4FIPA 3HHAA 2GHUA 4QBBA 1NL6A 5K16A 1CQDA 2NQAA 1O0EA 4AXLA 2G7YA 3PBHA 2YJCA 2VFBA 2FT2A 1AYVA 1MHWA 2DCAA 3IEJA 3CH3X 4X6HA 2DJGB 2FO5A 1KHQA 4YYWA 3QJ3A 2F7DA 2FYEA 4YYQA 4DMXA 1KXRA 2Y6EA 3QSDA 3P5VA 2CB5A 3K24A 4BS5A 2P0RA 4BQVA 4NV8A 1EWLA 4OEMA 4QRXA 3H7DA 3H8BA 5CHVA 3B79A 2G8JA 3RVWA 2DZYA 3S3QA 2BDLA 2AIMA 4YYSA 4N8WA 5CVMA 3WXEA 3KKUA 3LTWA 1AU0A 1F2CA 2DZZA 1VSNA 4CZWA 2R9NA 1PPDA 4BSQA 3BPMA 1AECA 2ATOA 1PIPA 4FJCA 2PADA 4X6IA 4CDEB 2VHFA 1U5IA 1TU6A 4GUZA 1CS8A 2CIOA 4QH6A 1F29A 4I04A 3TNXA 4KLBA 2BSZA 4PP2E 4MZSA 2PREA 1X9YA 1POPA 1CVZA 3N3KA 4NV7A 1MIRA 1U9QX 2XU5A 2YJ8A 2YJ2A 2YJBA 4HWYA 2G6DA 3BC3A 2AUZA 2HXZA 1W5RA 2IPPB 3ERVA 1NQCA 1QOLA 4K7CA 3N3GA 2DCCA 1PADA 5F02A 1W6FA 1DEUA 4X6JA 2DC6A 5J94A 2R9CA 2AYNA 3BWKA 4OELA 1XKGA 1YK8A 2BDZA 4WA6A 3I3TA 3N4CA 3HD3A 5EGWA 4QRGA 1A6RA 2G8EA 5JA7A 4XR7A 1EWPA 4Q8HA 4YYVA 2XU1A 3C9EA 2HHNA 1GCBA 1Y08A 1EWMA 4YV8A 3P5XA 1ZCMA 3IOQA 4YYUA 3S3RA 1CTEA 2P86A 4RY2A 1KFUL 1KHPA 1F2AA 1JQPA 2B1MA 3H89A 1EWOA 3IHPA 4MSXA 4C5PA 4B55A 3M99A 5CVNB 4BS6A 3P5UA 3USVA 2B1NA 2AYOA 3OVZA 1S4VA 3MHSA 3MORA 2JQGR 1FH0A 4PI3A 3O0UA 1AU3A 1QDQA 3OISA 1NPZA 3V6CA 3DF0A 1ICFA 1PPOA 2AVWA 5A24A 3D6SA 2NQGA 2DC8A 1GECE 2AU1A 1BQIA 3K9MA 3MTNA 3H6SA 3KFQA 4PP1A 1PPNA 2E00A 1YALA 2R9OA 4PADA 2R9FA 3RVVA 1BY8A 1CV8A 1SP4B 3HHIA 1HUCB 2DJFB 6PADA 2JQFR 3RVXA 3O1GA 4P6GA 2XU4A 2P7UA 1BGOA 1ZIVA 4W4UA 2FQ9A 1MS6A 4G54A 1AYWA 2YJ9A 1CPJA 1K3BB 1IWDA 3IMAA 4CDFB 1M6DA 7PCKA 3U8EA 1F2BA 1ME4A 4I05A 2WBFX 1VJVA 2Y5BA 3NHEA 4BGFA 1TL9A 4W5BA 1PXVA 2DCBA 2R6NA 3H8CA 1W4TA 1YVBA 3WXFA 3BPFA 3KX1A 1ITOA 3BOWA 1CJLA 2ACTA 3V6EA 3PW3A 2E03A 2FTDA 3E1ZB 4CDDB 3GCBA 4XUIA 1YK7A 4P6EA 1AIMA 1PPPA 5CHTA 1PCIA 1CB5A 1ATKA 1MEMA 1GLOA 1MEGA 2HD5A 5CVOB 1CSBB 2PBHA 1AU4A 3IV2A 3OF8A 3D9WA 3CH2X 1THEA 3OF9A 3HWNA 1PE6A 2FRQA 2FUDA 3ZUAA 3KWBX 1SNKA 2XU3A 1U9WA 1QXPA 1AYUA 4N4ZA 4CDCB 3P5WA 2IBIA 2C0YA 4N79A 3AI8A 1STFE 2DCDA 2OP3A 5EF4A 2E02A 5PADA 3MHHA 2AUXA 2H7JA 1PBHA 4BPVA 2AS8A 1KFXL 4AXMA 3PNRA 3F5VA 2DC9A 2DC7A 2VHSA 4YYRA 2GFOA 3K8UA 9PAPA 2VFCA 2NQIA 2PNSA 3F75A 4FK5A 2E01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZO A;  3WXG A;  1MDW A;  1Q6K A;  4YVA A;  1QMY A;  3KSE A;  2FRA A;  3CBK A;  1EF7 A;  2F1G A;  3PDF A;  3IUT A;  4W5C A;  2OZ2 A;  1ME3 A;  1AU2 A;  2NQD B;  1TLO A;  2R9M A;  3BCN A;  4Q8G A;  3CBJ A;  2HH5 A;  4I07 A;  5JH3 A;  3KW9 A;  1U9V A;  8PCH A;  2O6X A;  1NLJ A;  2OUL A;  2ARY A;  3QT4 A;  1BP4 A;  1DF0 A;  1NB3 A;  3LXS A;  4QRV A;  1Y4H A;  4DMY A;  1NB5 A;  3KWZ A;  5FPW A;  1YT7 A;  3OVX A;  1GMY A;  4ZUX U;  1U9X A;  3I06 A;  3LFY A;  4FIP A;  3HHA A;  2GHU A;  4QBB A;  1NL6 A;  5K16 A;  1CQD A;  2NQA A;  1O0E A;  4AXL A;  2G7Y A;  3PBH A;  2YJC A;  2FT2 A;  1AYV A;  1MHW A;  2DCA A;  3IEJ A;  3CH3 X;  4X6H A;  2DJG B;  2FO5 A;  1KHQ A;  4YYW A;  3QJ3 A;  2F7D A;  2FYE A;  4YYQ A;  4DMX A;  1KXR A;  2Y6E A;  3QSD A;  3P5V A;  2CB5 A;  3K24 A;  4BS5 A;  2P0R A;  4BQV A;  1EWL A;  4OEM A;  4QRX A;  3H7D A;  3H8B A;  5CHV A;  3B79 A;  2G8J A;  3RVW A;  2DZY A;  3S3Q A;  2BDL A;  2AIM A;  4YYS A;  4N8W A;  5CVM A;  3WXE A;  3KKU A;  1AU0 A;  1F2C A;  2DZZ A;  1VSN A;  4CZW A;  2R9N A;  1PPD A;  4BSQ A;  3BPM A;  1AEC A;  2ATO A;  1PIP A;  4FJC A;  2PAD A;  4X6I A;  4CDE B;  2VHF A;  1U5I A;  1TU6 A;  1CS8 A;  2CIO A;  4QH6 A;  1F29 A;  4I04 A;  3TNX A;  4KLB A;  4PP2 E;  4MZS A;  2PRE A;  1X9Y A;  1POP A;  1CVZ A;  3N3K A;  1MIR A;  1U9Q X;  2XU5 A;  2YJ8 A;  2YJ2 A;  2YJB A;  4HWY A;  2G6D A;  3BC3 A;  2AUZ A;  2HXZ A;  2IPP B;  3ERV A;  1NQC A;  1QOL A;  4K7C A;  3N3G A;  2DCC A;  1PAD A;  5F02 A;  1DEU A;  4X6J A;  2DC6 A;  5J94 A;  2R9C A;  2AYN A;  3BWK A;  4OEL A;  1XKG A;  1YK8 A;  2BDZ A;  4WA6 A;  3I3T A;  3N4C A;  3HD3 A;  5EGW A;  4QRG A;  1A6R A;  2G8E A;  5JA7 A;  4XR7 A;  1EWP A;  4Q8H A;  4YYV A;  2XU1 A;  3C9E A;  2HHN A;  1GCB A;  1Y08 A;  1EWM A;  4YV8 A;  3P5X A;  1ZCM A;  3IOQ A;  4YYU A;  3S3R A;  1CTE A;  2P86 A;  4RY2 A;  1KFU L;  1KHP A;  1F2A A;  1JQP A;  2B1M A;  3H89 A;  1EWO A;  3IHP A;  4MSX A;  3M99 A;  5CVN B;  4BS6 A;  3P5U A;  3USV A;  2B1N A;  2AYO A;  3OVZ A;  1S4V A;  3MHS A;  3MOR A;  2JQG R;  1FH0 A;  4PI3 A;  3O0U A;  1AU3 A;  1QDQ A;  3OIS A;  1NPZ A;  3V6C A;  3DF0 A;  1ICF A;  1PPO A;  2AVW A;  5A24 A;  3D6S A;  2NQG A;  2DC8 A;  1GEC E;  2AU1 A;  1BQI A;  3K9M A;  3MTN A;  3H6S A;  3KFQ A;  4PP1 A;  1PPN A;  2E00 A;  1YAL A;  2R9O A;  4PAD A;  2R9F A;  3RVV A;  1BY8 A;  1CV8 A;  1SP4 B;  3HHI A;  1HUC B;  2DJF B;  6PAD A;  2JQF R;  3RVX A;  3O1G A;  4P6G A;  2XU4 A;  2P7U A;  1BGO A;  1ZIV A;  4W4U A;  2FQ9 A;  1MS6 A;  4G54 A;  1AYW A;  2YJ9 A;  1CPJ A;  1K3B B;  1IWD A;  3IMA A;  4CDF B;  1M6D A;  7PCK A;  3U8E A;  1F2B A;  1ME4 A;  4I05 A;  2WBF X;  1VJV A;  2Y5B A;  3NHE A;  1TL9 A;  4W5B A;  1PXV A;  2DCB A;  2R6N A;  3H8C A;  1YVB A;  3WXF A;  3BPF A;  3KX1 A;  1ITO A;  3BOW A;  1CJL A;  2ACT A;  3V6E A;  3PW3 A;  2E03 A;  2FTD A;  3E1Z B;  4CDD B;  3GCB A;  4XUI A;  1YK7 A;  4P6E A;  1AIM A;  1PPP A;  5CHT A;  1PCI A;  1CB5 A;  1ATK A;  1MEM A;  1GLO A;  1MEG A;  2HD5 A;  5CVO B;  1CSB B;  2PBH A;  1AU4 A;  3IV2 A;  3OF8 A;  3CH2 X;  1THE A;  3OF9 A;  3HWN A;  1PE6 A;  2FRQ A;  2FUD A;  3ZUA A;  3KWB X;  1SNK A;  2XU3 A;  1U9W A;  1QXP A;  1AYU A;  4N4Z A;  4CDC B;  3P5W A;  2IBI A;  2C0Y A;  4N79 A;  3AI8 A;  1STF E;  2DCD A;  2OP3 A;  5EF4 A;  2E02 A;  5PAD A;  3MHH A;  2AUX A;  2H7J A;  1PBH A;  4BPV A;  2AS8 A;  1KFX L;  4AXM A;  3PNR A;  3F5V A;  2DC9 A;  2DC7 A;  2VHS A;  4YYR A;  2GFO A;  3K8U A;  9PAP A;  2NQI A;  2PNS A;  3F75 A;  4FK5 A;  2E01 A; 
#chains in the Genus database with same CATH topology
 4MZO A;  2HWK A;  3WXG A;  1MDW A;  1Q6K A;  4YVA A;  1QMY A;  3KSE A;  2FRA A;  3CBK A;  1EF7 A;  2F1G A;  3PDF A;  4BOU A;  3IUT A;  4W5C A;  2OZ2 A;  1ME3 A;  1AU2 A;  2NQD B;  1TLO A;  2R9M A;  3BCN A;  4Q8G A;  4A5U A;  3CBJ A;  2HH5 A;  4I07 A;  3PT2 A;  5JH3 A;  3KW9 A;  1U9V A;  4REZ A;  8PCH A;  2O6X A;  1NLJ A;  2OUL A;  2ARY A;  3QT4 A;  1BP4 A;  1DF0 A;  5EZS A;  1NB3 A;  3BY4 A;  1YZB A;  3LXS A;  4QRV A;  1Y4H A;  4DMY A;  1NB5 A;  3KWZ A;  5FPW A;  1YT7 A;  3OVX A;  1GMY A;  4ZUX U;  4WUR A;  4D8I A;  1U9X A;  3I06 A;  3LFY A;  4FIP A;  3HHA A;  2GHU A;  4QBB A;  1NL6 A;  5K16 A;  1CQD A;  4RNA A;  2NQA A;  1O0E A;  4M0W A;  1DKI A;  4AXL A;  2G7Y A;  3PBH A;  2YJC A;  2FT2 A;  1AYV A;  1MHW A;  2DCA A;  3IEJ A;  3CH3 X;  4X6H A;  3IFU A;  2DJG B;  2FO5 A;  1KHQ A;  4MM3 B;  4P16 A;  4YYW A;  2J7Q C;  3PHU A;  3QJ3 A;  2F7D A;  2FYE A;  4YYQ A;  4DMX A;  1KXR A;  2Y6E A;  3QSD A;  3P5V A;  2CB5 A;  3K24 A;  3MP2 A;  4OVZ B;  4BS5 A;  4MI7 A;  2P0R A;  4BOZ A;  4BQV A;  1EWL A;  4OEM A;  4QRX A;  3H7D A;  3H8B A;  5CHV A;  3B79 A;  2G8J A;  3RVW A;  2DZY A;  3S3Q A;  4RF0 A;  2BDL A;  2BTW B;  2AIM A;  4YYS A;  4N8W A;  5CVM A;  3WXE A;  3KKU A;  1AU0 A;  4IP3 A;  1F2C A;  2DZZ A;  1VSN A;  3TRK A;  4CZW A;  2R9N A;  4XZX A;  1PPD A;  4BSQ A;  3BPM A;  1AEC A;  2ATO A;  3MTV A;  1PVJ A;  1PIP A;  4FJC A;  2UZJ A;  2PAD A;  4X6I A;  4CDE B;  3TMP A;  2VHF A;  1U5I A;  1TU6 A;  1CS8 A;  2CIO A;  4QH6 A;  1F29 A;  4I04 A;  3TNX A;  4KLB A;  1UKF A;  4PP2 E;  4MZS A;  2PRE A;  1X9Y A;  1POP A;  1CVZ A;  3N3K A;  4BOQ A;  1MIR A;  3ZNH A;  4RKX A;  1U9Q X;  2XU5 A;  2YJ8 A;  2YJ2 A;  2YJB A;  4HWY A;  2G6D A;  3BC3 A;  2AUZ A;  2HXZ A;  2IPP B;  3ERV A;  1NQC A;  1QOL A;  4K7C A;  3N3G A;  4IUM A;  2DCC A;  1PAD A;  5F02 A;  3PHX A;  1DEU A;  4X6J A;  2DC6 A;  5J94 A;  2R9C A;  2AYN A;  4D8E A;  3BWK A;  4OEL A;  2JTC A;  3B21 A;  1XKG A;  1YK8 A;  2BDZ A;  4WA6 A;  3I3T A;  3N4C A;  3HD3 A;  5EGW A;  2JRI A;  4HXD B;  4QRG A;  1A6R A;  2G8E A;  5JA7 A;  4XR7 A;  1EWP A;  4Q8H A;  4YYV A;  2XU1 A;  3C9E A;  2HHN A;  1GCB A;  1Y08 A;  1EWM A;  4YV8 A;  3P5X A;  1ZCM A;  3IOQ A;  4YYU A;  4ZTB A;  3S3R A;  4BOS A;  1CTE A;  2P86 A;  3BBA A;  4RY2 A;  1KFU L;  1KHP A;  1F2A A;  1JQP A;  2B1M A;  3H89 A;  1EWO A;  2BTW A;  4BOP A;  4OW0 A;  2Z84 A;  3IHP A;  4MSX A;  3M99 A;  5CVN B;  3W30 A;  2AGA A;  4BS6 A;  3P5U A;  3USV A;  2B1N A;  2AYO A;  3OVZ A;  1S4V A;  3MHS A;  3MOR A;  2JQG R;  1FH0 A;  4D8B A;  4PI3 A;  3O0U A;  1AU3 A;  1QDQ A;  3OIS A;  1NPZ A;  3V6C A;  3DF0 A;  1ICF A;  1PPO A;  2AVW A;  5A24 A;  3D6S A;  3PRP A;  2NQG A;  4RF1 A;  2DC8 A;  1GEC E;  2AU1 A;  1BQI A;  3W31 A;  3K9M A;  4GUA A;  3PSE A;  3MTN A;  3H6S A;  3MJ5 A;  3KFQ A;  3PHW A;  4PP1 A;  1PPN A;  2E00 A;  1YAL A;  2R9O A;  4PAD A;  3E9S A;  2R9F A;  3RVV A;  1BY8 A;  1CV8 A;  1SP4 B;  3C0R A;  3HHI A;  1HUC B;  2DJF B;  6PAD A;  4PT5 A;  2JQF R;  3RVX A;  3O1G A;  4P6G A;  2XU4 A;  2P7U A;  1BGO A;  1ZIV A;  4W4U A;  2FQ9 A;  1MS6 A;  4G54 A;  1AYW A;  2YJ9 A;  2J7Q A;  1CPJ A;  1K3B B;  1IWD A;  3IMA A;  3RNV A;  4CDF B;  1M6D A;  7PCK A;  3U8E A;  1F2B A;  1ME4 A;  4I05 A;  2WBF X;  1VJV A;  2Y5B A;  2DOS A;  3NHE A;  1TL9 A;  4W5B A;  1PXV A;  2DCB A;  2R6N A;  3H8C A;  1YVB A;  3WXF A;  3BPF A;  3KX1 A;  3BB7 A;  1ITO A;  3BOW A;  1CJL A;  2ACT A;  3V6E A;  4OVZ A;  3PW3 A;  2E03 A;  2FTD A;  3E1Z B;  4CDD B;  3GCB A;  4XUI A;  1YK7 A;  4P6E A;  1AIM A;  1PPP A;  5CHT A;  5JZE A;  1PCI A;  1CB5 A;  1ATK A;  1MEM A;  1GLO A;  1MEG A;  2HD5 A;  5CVO B;  3OQC A;  1CSB B;  2PBH A;  1AU4 A;  3IV2 A;  3OF8 A;  3CH2 X;  1THE A;  3OF9 A;  3HWN A;  2BU3 A;  1PE6 A;  2FRQ A;  2FUD A;  3ZUA A;  3KWB X;  1SNK A;  2XU3 A;  1U9W A;  2FE8 A;  1QXP A;  1AYU A;  4N4Z A;  4CDC B;  3P5W A;  2IBI A;  2C0Y A;  4R3D A;  5E6J A;  4N79 A;  5KO3 A;  3AI8 A;  1STF E;  2DCD A;  2OP3 A;  5EF4 A;  2E02 A;  5PAD A;  5EZQ A;  3MHH A;  2AUX A;  2H7J A;  1PBH A;  4BPV A;  3PRM A;  2AS8 A;  1KFX L;  4AXM A;  3PNR A;  3F5V A;  2DC9 A;  2DC7 A;  2VHS A;  4YYR A;  2GFO A;  3K8U A;  9PAP A;  2NQI A;  3O65 A;  2PNS A;  3F75 A;  4FK5 A;  2E01 A; 
#chains in the Genus database with same CATH homology
 4MZO A;  3WXG A;  1MDW A;  1Q6K A;  4YVA A;  1QMY A;  3KSE A;  1GX3 A;  2FRA A;  3CBK A;  1EF7 A;  2F1G A;  3PDF A;  3IUT A;  4W5C A;  2OZ2 A;  1ME3 A;  1AU2 A;  2NQD B;  1TLO A;  2R9M A;  3BCN A;  4Q8G A;  3CBJ A;  1E2T A;  2HH5 A;  4I07 A;  5JH3 A;  3KW9 A;  1U9V A;  8PCH A;  2O6X A;  1NLJ A;  2OUL A;  2ARY A;  3QT4 A;  1BP4 A;  1DF0 A;  1NB3 A;  3LXS A;  4QRV A;  1Y4H A;  4DMY A;  1NB5 A;  3KWZ A;  5FPW A;  1YT7 A;  3OVX A;  1GMY A;  4ZUX U;  1U9X A;  3I06 A;  3LFY A;  4FIP A;  3HHA A;  2GHU A;  4QBB A;  1NL6 A;  5K16 A;  1CQD A;  2NQA A;  1O0E A;  4AXL A;  2G7Y A;  3PBH A;  2YJC A;  2VFB A;  2FT2 A;  1AYV A;  1MHW A;  2DCA A;  3IEJ A;  3CH3 X;  4X6H A;  2DJG B;  2FO5 A;  1KHQ A;  4YYW A;  3QJ3 A;  2F7D A;  2FYE A;  4YYQ A;  4DMX A;  1KXR A;  2Y6E A;  3QSD A;  3P5V A;  2CB5 A;  3K24 A;  4BS5 A;  2P0R A;  4BQV A;  4NV8 A;  1EWL A;  4OEM A;  4QRX A;  3H7D A;  3H8B A;  5CHV A;  3B79 A;  2G8J A;  3RVW A;  2DZY A;  3S3Q A;  2BDL A;  2AIM A;  4YYS A;  4N8W A;  5CVM A;  3WXE A;  3KKU A;  3LTW A;  1AU0 A;  1F2C A;  2DZZ A;  1VSN A;  4CZW A;  2R9N A;  1PPD A;  4BSQ A;  3BPM A;  1AEC A;  2ATO A;  1PIP A;  4FJC A;  2PAD A;  4X6I A;  4CDE B;  2VHF A;  1U5I A;  1TU6 A;  4GUZ A;  1CS8 A;  2CIO A;  4QH6 A;  1F29 A;  4I04 A;  3TNX A;  4KLB A;  2BSZ A;  4PP2 E;  4MZS A;  2PRE A;  1X9Y A;  1POP A;  1CVZ A;  3N3K A;  4NV7 A;  1MIR A;  1U9Q X;  2XU5 A;  2YJ8 A;  2YJ2 A;  2YJB A;  4HWY A;  2G6D A;  3BC3 A;  2AUZ A;  2HXZ A;  1W5R A;  2IPP B;  3ERV A;  1NQC A;  1QOL A;  4K7C A;  3N3G A;  2DCC A;  1PAD A;  5F02 A;  1W6F A;  1DEU A;  4X6J A;  2DC6 A;  5J94 A;  2R9C A;  2AYN A;  3BWK A;  4OEL A;  1XKG A;  1YK8 A;  2BDZ A;  4WA6 A;  3I3T A;  3N4C A;  3HD3 A;  5EGW A;  4QRG A;  1A6R A;  2G8E A;  5JA7 A;  4XR7 A;  1EWP A;  4Q8H A;  4YYV A;  2XU1 A;  3C9E A;  2HHN A;  1GCB A;  1Y08 A;  1EWM A;  4YV8 A;  3P5X A;  1ZCM A;  3IOQ A;  4YYU A;  3S3R A;  1CTE A;  2P86 A;  4RY2 A;  1KFU L;  1KHP A;  1F2A A;  1JQP A;  2B1M A;  3H89 A;  1EWO A;  3IHP A;  4MSX A;  4C5P A;  4B55 A;  3M99 A;  5CVN B;  4BS6 A;  3P5U A;  3USV A;  2B1N A;  2AYO A;  3OVZ A;  1S4V A;  3MHS A;  3MOR A;  2JQG R;  1FH0 A;  4PI3 A;  3O0U A;  1AU3 A;  1QDQ A;  3OIS A;  1NPZ A;  3V6C A;  3DF0 A;  1ICF A;  1PPO A;  2AVW A;  5A24 A;  3D6S A;  2NQG A;  2DC8 A;  1GEC E;  2AU1 A;  1BQI A;  3K9M A;  3MTN A;  3H6S A;  3KFQ A;  4PP1 A;  1PPN A;  2E00 A;  1YAL A;  2R9O A;  4PAD A;  2R9F A;  3RVV A;  1BY8 A;  1CV8 A;  1SP4 B;  3HHI A;  1HUC B;  2DJF B;  6PAD A;  2JQF R;  3RVX A;  3O1G A;  4P6G A;  2XU4 A;  2P7U A;  1BGO A;  1ZIV A;  4W4U A;  2FQ9 A;  1MS6 A;  4G54 A;  1AYW A;  2YJ9 A;  1CPJ A;  1K3B B;  1IWD A;  3IMA A;  4CDF B;  1M6D A;  7PCK A;  3U8E A;  1F2B A;  1ME4 A;  4I05 A;  2WBF X;  1VJV A;  2Y5B A;  3NHE A;  4BGF A;  1TL9 A;  4W5B A;  1PXV A;  2DCB A;  2R6N A;  3H8C A;  1W4T A;  1YVB A;  3WXF A;  3BPF A;  3KX1 A;  1ITO A;  3BOW A;  1CJL A;  2ACT A;  3V6E A;  3PW3 A;  2E03 A;  2FTD A;  3E1Z B;  4CDD B;  3GCB A;  4XUI A;  1YK7 A;  4P6E A;  1AIM A;  1PPP A;  5CHT A;  1PCI A;  1CB5 A;  1ATK A;  1MEM A;  1GLO A;  1MEG A;  2HD5 A;  5CVO B;  1CSB B;  2PBH A;  1AU4 A;  3IV2 A;  3OF8 A;  3D9W A;  3CH2 X;  1THE A;  3OF9 A;  3HWN A;  1PE6 A;  2FRQ A;  2FUD A;  3ZUA A;  3KWB X;  1SNK A;  2XU3 A;  1U9W A;  1QXP A;  1AYU A;  4N4Z A;  4CDC B;  3P5W A;  2IBI A;  2C0Y A;  4N79 A;  3AI8 A;  1STF E;  2DCD A;  2OP3 A;  5EF4 A;  2E02 A;  5PAD A;  3MHH A;  2AUX A;  2H7J A;  1PBH A;  4BPV A;  2AS8 A;  1KFX L;  4AXM A;  3PNR A;  3F5V A;  2DC9 A;  2DC7 A;  2VHS A;  4YYR A;  2GFO A;  3K8U A;  9PAP A;  2VFC A;  2NQI A;  2PNS A;  3F75 A;  4FK5 A;  2E01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...