1Y4HA

Wild type staphopain-staphostatin complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
b'QVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cysteine protease
publication title A comparison of staphostatin B with standard mechanism serine protease inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1y4hA00
5FPWA 2G7YA 3BWKA 4FIPA 2DCCA 2WBFX 2F7DA 3V6EA 4XUIA 4CDCB 2R9MA 2JQGR 1MEGA 1GMYA 1KXRA 4QRGA 2R9FA 3OF8A 4DMXA 2E01A 3QSDA 1PPOA 2E02A 4I07A 1CB5A 2DC7A 2FRAA 3M99A 4QRVA 4FK5A 1QDQA 3P5UA 1ATKA 3CH2X 1F2BA 3BPFA 2O6XA 1VJVA 2B1NA 2HHNA 2ATOA 1ME4A 3S3RA 2XU4A 1AECA 1THEA 3H7DA 2HXZA 1PCIA 4YYQA 2DCAA 3OVZA 3IEJA 3B79A 3NHEA 3CBKA 1DF0A 1XKGA 2AS8A 2AVWA 4OELA 3IHPA 2ARYA 2R9OA 2YJ8A 3PNRA 2FO5A 3H89A 5EF4A 2AUZA 4XR7A 4PP1A 2BDLA 3MHSA 1CS8A 4W4UA 2NQGA 3KW9A 1S4VA 1KFUL 2AIMA 2G8EA 1PPNA 1DEUA 3IOQA 2IBIA 4BSQA 3N3GA 5EGWA 1U9XA 3PBHA 1EWMA 4W5CA 2P0RA 3QJ3A 2FUDA 1NQCA 4X6JA 2H7JA 4CDFB 1A6RA 4X6IA 4P6GA 2GHUA 3O0UA 5CVNB 4WA6A 5CHVA 2HH5A 2YJCA 3MTNA 1F2CA 2DJGB 4N79A 1EF7A 3H6SA 4YYUA 4DMYA 3H8BA 3KX1A 1NB3A 1QOLA 2BDZA 4Q8HA 1X9YA 1YK7A 2R9NA 3DF0A 3IV2A 3KWBX 1TU6A 3V6CA 4PI3A 4YYWA 3BCNA 1KHPA 3KWZA 2G8JA 3BPMA 2B1MA 1QMYA 5PADA 3F5VA 4W5BA 1PADA 3IUTA 2FYEA 2XU3A 1QXPA 2DC9A 2AYNA 3P5WA 1SP4B 2OULA 3K8UA 3WXEA 3MHHA 8PCHA 1PE6A 1AU3A 1BP4A 1M6DA 4AXMA 1Q6KA 3BC3A 3HHAA 3D6SA 3AI8A 1U9WA 1CJLA 1TL9A 2E03A 1MIRA 2XU1A 2YJ2A 3LFYA 1YVBA 2OZ2A 5CVMA 2PBHA 1CSBB 1VSNA 3CH3X 1U9QX 2NQAA 1ME3A 2E00A 3PDFA 1PIPA 4G54A 2C0YA 1AIMA 3O1GA 2F1GA 4X6HA 1NLJA 3KFQA 4CZWA 1POPA 3P5VA 3USVA 6PADA 3OF9A 3KSEA 1U5IA 1ITOA 1AYVA 3RVVA 4MSXA 5K16A 3HWNA 4YV8A 3WXGA 1MS6A 5JA7A 2FQ9A 1ZIVA 2XU5A 3OISA 1ZCMA 1TLOA 2DZZA 4HWYA 9PAPA 1CPJA 2VHSA 2PREA 2AYOA 2CB5A 2DJFB 3K9MA 1GLOA 1F2AA 2HD5A 3S3QA 2NQDB 2YJ9A 3H8CA 4I05A 2DC6A 2GFOA 1PXVA 3PW3A 4YYVA 3E1ZB 4RY2A 4PP2E 1AU4A 3P5XA 1BGOA 2AUXA 4QRXA 2R6NA 1EWLA 3ZUAA 4K7CA 3QT4A 2JQFR 1CQDA 2G6DA 5CHTA 3GCBA 3HD3A 3IMAA 1AU2A 1F29A 3K24A 3CBJA 1NB5A 2VHFA 1ICFA 3I3TA 4BS6A 4YYSA 1GECE 2NQIA 2P86A 1GCBA 4BS5A 2IPPB 1CTEA 1MEMA 4ZUXU 4KLBA 4I04A 2OP3A 1HUCB 4Q8GA 1BY8A 1AU0A 1AYWA 1STFE 2Y5BA 4MZOA 4YVAA 3N4CA 2AU1A 4N8WA 1MHWA 1Y08A 1PPPA 2DCDA 4FJCA 1U9VA 3N3KA 4MZSA 3ERVA 4PADA 2FRQA 1YK8A 4CDEB 1JQPA 2CIOA 3LXSA 2DZYA 1K3BB 7PCKA 2DC8A 4OEMA 3U8EA 3RVWA 1AYUA 3KKUA 5F02A 3F75A 5JH3A 4QH6A 4BQVA 1IWDA 2R9CA 4QBBA 3I06A 1BQIA 1SNKA 2DCBA 2YJBA 3WXFA 1O0EA 2FTDA 1YT7A 4P6EA 4N4ZA 4AXLA 2PADA 2FT2A 3MORA 1KFXL 3OVXA 3TNXA 1CVZA 1EWOA 1MDWA 1CV8A 1KHQA 1FH0A 1EWPA 3C9EA 3HHIA 1PBHA 2P7UA 1NPZA 5J94A 1NL6A 1YALA 3BOWA 2ACTA 5CVOB 1Y4HA 4BPVA 4CDDB 5A24A 2PNSA 4YYRA 2Y6EA 3RVXA 1PPDA
chains in the Genus database with same CATH superfamily
5FPWA 2G7YA 3BWKA 4FIPA 2DCCA 2WBFX 2F7DA 3V6EA 4XUIA 4CDCB 2R9MA 2JQGR 1MEGA 1GMYA 1KXRA 4QRGA 2R9FA 3OF8A 4DMXA 3W30A 2E01A 3QSDA 1PPOA 2E02A 1DKIA 4I07A 1CB5A 3PRMA 2DC7A 2FRAA 3M99A 4QRVA 3ZNHA 4FK5A 1QDQA 3P5UA 1ATKA 3PT2A 3CH2X 1PVJA 1F2BA 2FE8A 3BPFA 2O6XA 1VJVA 2B1NA 2HHNA 2ATOA 1ME4A 3S3RA 2XU4A 1AECA 1THEA 3H7DA 2HXZA 1PCIA 4YYQA 2DCAA 3OVZA 3IEJA 3B79A 3NHEA 3CBKA 1DF0A 4R3DA 1XKGA 2AS8A 2AVWA 4OELA 3IHPA 2ARYA 2R9OA 2YJ8A 3PNRA 2FO5A 3H89A 4MI7A 5EF4A 1YZBA 2AUZA 4RF0A 4XR7A 4PP1A 2BDLA 3BBAA 3MHSA 4ZTBA 1CS8A 4W4UA 4OW0A 2HWKA 2NQGA 4BOPA 4A5UA 5EZSA 3KW9A 2UZJA 1S4VA 1KFUL 4BOSA 2AIMA 2J7QA 2G8EA 1PPNA 1DEUA 3IOQA 2IBIA 4BSQA 3OQCA 3N3GA 5EGWA 3PRPA 1U9XA 3PBHA 1EWMA 4RF1A 4W5CA 2P0RA 4REZA 3RNVA 3TRKA 3QJ3A 2FUDA 1NQCA 4X6JA 2H7JA 4CDFB 1A6RA 3B21A 4X6IA 4P6GA 4WURA 2GHUA 3O0UA 5CVNB 4WA6A 4HXDB 3BY4A 5CHVA 2HH5A 2YJCA 3MTNA 1F2CA 2DJGB 4N79A 1EF7A 3H6SA 4YYUA 4DMYA 3H8BA 3KX1A 1NB3A 1UKFA 1QOLA 2BDZA 4RNAA 4Q8HA 1X9YA 1YK7A 2R9NA 4OVZB 3DF0A 3IV2A 3KWBX 1TU6A 3V6CA 4PI3A 3TMPA 4YYWA 3BCNA 1KHPA 3KWZA 2G8JA 3BPMA 2B1MA 1QMYA 4MM3B 5PADA 3F5VA 4W5BA 1PADA 3MTVA 3IUTA 2FYEA 2XU3A 1QXPA 2DC9A 2AYNA 3P5WA 1SP4B 2OULA 3K8UA 3WXEA 3MHHA 4D8IA 8PCHA 1PE6A 1AU3A 1BP4A 1M6DA 4AXMA 1Q6KA 3BC3A 2JRIA 3HHAA 3D6SA 3AI8A 1U9WA 1CJLA 1TL9A 2AGAA 2E03A 2BTWB 1MIRA 2XU1A 2YJ2A 3IFUA 1YVBA 2OZ2A 3LFYA 5CVMA 2PBHA 1CSBB 1VSNA 3CH3X 1U9QX 2NQAA 5E6JA 5JZEA 1ME3A 2E00A 3PDFA 1PIPA 3O1GA 2C0YA 1AIMA 3MP2A 4G54A 2F1GA 4X6HA 4BOZA 1NLJA 3KFQA 4CZWA 1POPA 3P5VA 3USVA 6PADA 3OF9A 2Z84A 1U5IA 3KSEA 1ITOA 1AYVA 3RVVA 4MSXA 5K16A 3HWNA 4YV8A 3WXGA 1MS6A 5JA7A 2FQ9A 1ZIVA 2XU5A 3OISA 1ZCMA 3W31A 4RKXA 3PHXA 3BB7A 1TLOA 2DZZA 4HWYA 9PAPA 1CPJA 2VHSA 2PREA 3PHUA 4D8BA 2AYOA 3PSEA 2CB5A 2DJFB 3K9MA 1GLOA 2DOSA 1F2AA 2HD5A 3S3QA 2NQDB 2YJ9A 3H8CA 4I05A 2DC6A 2GFOA 4GUAA 1PXVA 3MJ5A 3PW3A 4YYVA 3E1ZB 4RY2A 4PP2E 1AU4A 3P5XA 1BGOA 4PT5A 4IUMA 2AUXA 4QRXA 4BOQA 2R6NA 4OVZA 1EWLA 3O65A 3ZUAA 4K7CA 3QT4A 2JQFR 1CQDA 2G6DA 5CHTA 3GCBA 3HD3A 3IMAA 1AU2A 1F29A 3K24A 3CBJA 1NB5A 2J7QC 2VHFA 1ICFA 3I3TA 4BS6A 3PHWA 4YYSA 1GECE 2NQIA 2P86A 1GCBA 4BS5A 2IPPB 1CTEA 1MEMA 4ZUXU 4KLBA 4D8EA 4XZXA 4I04A 2OP3A 3C0RA 1HUCB 4Q8GA 1BY8A 1AU0A 4IP3A 1AYWA 1STFE 2Y5BA 4M0WA 4MZOA 4YVAA 3N4CA 2BTWA 2AU1A 4N8WA 5KO3A 1MHWA 1Y08A 1PPPA 2DCDA 4FJCA 2BU3A 1U9VA 3N3KA 4MZSA 4P16A 3ERVA 4PADA 2FRQA 1YK8A 4CDEB 1JQPA 2CIOA 3LXSA 2JTCA 2DZYA 1K3BB 7PCKA 2DC8A 4OEMA 3U8EA 3RVWA 1AYUA 3KKUA 5F02A 3F75A 5JH3A 3E9SA 4QH6A 4BQVA 1IWDA 2R9CA 4QBBA 3I06A 1BQIA 1SNKA 2DCBA 2YJBA 3WXFA 1O0EA 2FTDA 1YT7A 4P6EA 4N4ZA 4AXLA 2PADA 2FT2A 3MORA 1KFXL 3OVXA 3TNXA 1CVZA 1EWOA 1MDWA 1CV8A 1KHQA 1FH0A 1EWPA 3C9EA 3HHIA 1PBHA 2P7UA 1NPZA 5J94A 1NL6A 1YALA 5EZQA 3BOWA 2ACTA 5CVOB 1Y4HA 4BPVA 4CDDB 5A24A 2PNSA 4YYRA 2Y6EA 3RVXA 4BOUA 1PPDA
chains in the Genus database with same CATH topology
5FPWA 2G7YA 3BWKA 4FIPA 2DCCA 2WBFX 2F7DA 3V6EA 4XUIA 4CDCB 2R9MA 2JQGR 1MEGA 1GMYA 1KXRA 4QRGA 2R9FA 3OF8A 4DMXA 2E01A 3QSDA 1PPOA 2E02A 2VFCA 4I07A 1CB5A 2DC7A 2FRAA 3M99A 4QRVA 4FK5A 1QDQA 3P5UA 1ATKA 3CH2X 1F2BA 3BPFA 2O6XA 1VJVA 2B1NA 2HHNA 2ATOA 1ME4A 3S3RA 2XU4A 1AECA 1THEA 3H7DA 2HXZA 2VFBA 1PCIA 4YYQA 2DCAA 3OVZA 3IEJA 3B79A 3NHEA 3CBKA 1DF0A 1XKGA 2AS8A 2AVWA 4OELA 3IHPA 2ARYA 2R9OA 2YJ8A 3PNRA 2FO5A 3H89A 5EF4A 2AUZA 4XR7A 4PP1A 2BDLA 3MHSA 1CS8A 4W4UA 2NQGA 3KW9A 1S4VA 1KFUL 2AIMA 2G8EA 1PPNA 1DEUA 3IOQA 2IBIA 4BSQA 3N3GA 5EGWA 1U9XA 3PBHA 1EWMA 4W5CA 2P0RA 3QJ3A 2FUDA 1NQCA 4X6JA 2H7JA 4CDFB 1A6RA 4X6IA 4P6GA 2GHUA 3O0UA 5CVNB 4WA6A 5CHVA 2HH5A 2YJCA 3MTNA 1F2CA 2DJGB 4N79A 1EF7A 3H6SA 4B55A 4YYUA 4DMYA 3H8BA 3KX1A 1NB3A 1QOLA 2BDZA 4Q8HA 1X9YA 1YK7A 4C5PA 2R9NA 3DF0A 3IV2A 3KWBX 1TU6A 3V6CA 4PI3A 4YYWA 3BCNA 1KHPA 3KWZA 2G8JA 3BPMA 2B1MA 1QMYA 5PADA 3F5VA 4W5BA 1PADA 3IUTA 4GUZA 2FYEA 2XU3A 1QXPA 2DC9A 2AYNA 3P5WA 1SP4B 1E2TA 2OULA 3K8UA 3WXEA 3MHHA 8PCHA 1PE6A 1AU3A 1BP4A 1M6DA 4AXMA 1Q6KA 3BC3A 3HHAA 3D6SA 3AI8A 1U9WA 1CJLA 1TL9A 2E03A 1MIRA 2XU1A 2YJ2A 3LFYA 1YVBA 2OZ2A 5CVMA 2PBHA 1CSBB 1VSNA 1W5RA 3CH3X 1U9QX 2NQAA 1ME3A 2E00A 3PDFA 1PIPA 4G54A 2C0YA 1AIMA 3O1GA 2F1GA 4X6HA 1NLJA 3KFQA 4CZWA 1POPA 3P5VA 3USVA 6PADA 3OF9A 3KSEA 1U5IA 1ITOA 1AYVA 3RVVA 4MSXA 5K16A 3HWNA 4YV8A 3WXGA 1MS6A 5JA7A 2FQ9A 1ZIVA 2XU5A 3OISA 1ZCMA 1GX3A 1TLOA 2DZZA 4HWYA 9PAPA 1CPJA 2VHSA 2PREA 4BGFA 2AYOA 2CB5A 3LTWA 2DJFB 3K9MA 1GLOA 1F2AA 2HD5A 3S3QA 2NQDB 2YJ9A 3H8CA 4I05A 1W4TA 2DC6A 2GFOA 1PXVA 3PW3A 4YYVA 3E1ZB 4RY2A 4PP2E 4NV7A 1AU4A 3P5XA 1BGOA 2AUXA 4QRXA 2R6NA 1EWLA 3ZUAA 4K7CA 3QT4A 2JQFR 1CQDA 2G6DA 5CHTA 3GCBA 3HD3A 3IMAA 1W6FA 1AU2A 1F29A 3K24A 3CBJA 1NB5A 2VHFA 1ICFA 3I3TA 4BS6A 4YYSA 1GECE 2NQIA 2P86A 3D9WA 1GCBA 4BS5A 2IPPB 1CTEA 1MEMA 4ZUXU 4KLBA 2BSZA 4I04A 2OP3A 1HUCB 4Q8GA 1BY8A 1AU0A 1AYWA 1STFE 2Y5BA 4MZOA 4YVAA 3N4CA 2AU1A 4N8WA 1MHWA 1Y08A 1PPPA 2DCDA 4FJCA 1U9VA 3N3KA 4MZSA 3ERVA 4PADA 2FRQA 1YK8A 4CDEB 1JQPA 2CIOA 3LXSA 4NV8A 2DZYA 1K3BB 7PCKA 2DC8A 4OEMA 3U8EA 3RVWA 1AYUA 3KKUA 5F02A 3F75A 5JH3A 4QH6A 4BQVA 1IWDA 2R9CA 4QBBA 3I06A 1BQIA 1SNKA 2DCBA 2YJBA 3WXFA 1O0EA 2FTDA 1YT7A 4P6EA 4N4ZA 4AXLA 2PADA 2FT2A 3MORA 1KFXL 3OVXA 3TNXA 1CVZA 1EWOA 1MDWA 1CV8A 1KHQA 1FH0A 1EWPA 3C9EA 3HHIA 1PBHA 2P7UA 1NPZA 5J94A 1NL6A 1YALA 3BOWA 2ACTA 5CVOB 1Y4HA 4BPVA 4CDDB 5A24A 2PNSA 4YYRA 2Y6EA 3RVXA 1PPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPW A;  2G7Y A;  3BWK A;  4FIP A;  2DCC A;  2WBF X;  2F7D A;  3V6E A;  4XUI A;  4CDC B;  2R9M A;  2JQG R;  1MEG A;  1GMY A;  1KXR A;  4QRG A;  2R9F A;  3OF8 A;  4DMX A;  2E01 A;  3QSD A;  1PPO A;  2E02 A;  4I07 A;  1CB5 A;  2DC7 A;  2FRA A;  3M99 A;  4QRV A;  4FK5 A;  1QDQ A;  3P5U A;  1ATK A;  3CH2 X;  1F2B A;  3BPF A;  2O6X A;  1VJV A;  2B1N A;  2HHN A;  2ATO A;  1ME4 A;  3S3R A;  2XU4 A;  1AEC A;  1THE A;  3H7D A;  2HXZ A;  1PCI A;  4YYQ A;  2DCA A;  3OVZ A;  3IEJ A;  3B79 A;  3NHE A;  3CBK A;  1DF0 A;  1XKG A;  2AS8 A;  2AVW A;  4OEL A;  3IHP A;  2ARY A;  2R9O A;  2YJ8 A;  3PNR A;  2FO5 A;  3H89 A;  5EF4 A;  2AUZ A;  4XR7 A;  4PP1 A;  2BDL A;  3MHS A;  1CS8 A;  4W4U A;  2NQG A;  3KW9 A;  1S4V A;  1KFU L;  2AIM A;  2G8E A;  1PPN A;  1DEU A;  3IOQ A;  2IBI A;  4BSQ A;  3N3G A;  5EGW A;  1U9X A;  3PBH A;  1EWM A;  4W5C A;  2P0R A;  3QJ3 A;  2FUD A;  1NQC A;  4X6J A;  2H7J A;  4CDF B;  1A6R A;  4X6I A;  4P6G A;  2GHU A;  3O0U A;  5CVN B;  4WA6 A;  5CHV A;  2HH5 A;  2YJC A;  3MTN A;  1F2C A;  2DJG B;  4N79 A;  1EF7 A;  3H6S A;  4YYU A;  4DMY A;  3H8B A;  3KX1 A;  1NB3 A;  1QOL A;  2BDZ A;  4Q8H A;  1X9Y A;  1YK7 A;  2R9N A;  3DF0 A;  3IV2 A;  3KWB X;  1TU6 A;  3V6C A;  4PI3 A;  4YYW A;  3BCN A;  1KHP A;  3KWZ A;  2G8J A;  3BPM A;  2B1M A;  1QMY A;  5PAD A;  3F5V A;  4W5B A;  1PAD A;  3IUT A;  2FYE A;  2XU3 A;  1QXP A;  2DC9 A;  2AYN A;  3P5W A;  1SP4 B;  2OUL A;  3K8U A;  3WXE A;  3MHH A;  8PCH A;  1PE6 A;  1AU3 A;  1BP4 A;  1M6D A;  4AXM A;  1Q6K A;  3BC3 A;  3HHA A;  3D6S A;  3AI8 A;  1U9W A;  1CJL A;  1TL9 A;  2E03 A;  1MIR A;  2XU1 A;  2YJ2 A;  3LFY A;  1YVB A;  2OZ2 A;  5CVM A;  2PBH A;  1CSB B;  1VSN A;  3CH3 X;  1U9Q X;  2NQA A;  1ME3 A;  2E00 A;  3PDF A;  1PIP A;  4G54 A;  2C0Y A;  1AIM A;  3O1G A;  2F1G A;  4X6H A;  1NLJ A;  3KFQ A;  4CZW A;  1POP A;  3P5V A;  3USV A;  6PAD A;  3OF9 A;  3KSE A;  1U5I A;  1ITO A;  1AYV A;  3RVV A;  4MSX A;  5K16 A;  3HWN A;  4YV8 A;  3WXG A;  1MS6 A;  5JA7 A;  2FQ9 A;  1ZIV A;  2XU5 A;  3OIS A;  1ZCM A;  1TLO A;  2DZZ A;  4HWY A;  9PAP A;  1CPJ A;  2VHS A;  2PRE A;  2AYO A;  2CB5 A;  2DJF B;  3K9M A;  1GLO A;  1F2A A;  2HD5 A;  3S3Q A;  2NQD B;  2YJ9 A;  3H8C A;  4I05 A;  2DC6 A;  2GFO A;  1PXV A;  3PW3 A;  4YYV A;  3E1Z B;  4RY2 A;  4PP2 E;  1AU4 A;  3P5X A;  1BGO A;  2AUX A;  4QRX A;  2R6N A;  1EWL A;  3ZUA A;  4K7C A;  3QT4 A;  2JQF R;  1CQD A;  2G6D A;  5CHT A;  3GCB A;  3HD3 A;  3IMA A;  1AU2 A;  1F29 A;  3K24 A;  3CBJ A;  1NB5 A;  2VHF A;  1ICF A;  3I3T A;  4BS6 A;  4YYS A;  1GEC E;  2NQI A;  2P86 A;  1GCB A;  4BS5 A;  2IPP B;  1CTE A;  1MEM A;  4ZUX U;  4KLB A;  4I04 A;  2OP3 A;  1HUC B;  4Q8G A;  1BY8 A;  1AU0 A;  1AYW A;  1STF E;  2Y5B A;  4MZO A;  4YVA A;  3N4C A;  2AU1 A;  4N8W A;  1MHW A;  1Y08 A;  1PPP A;  2DCD A;  4FJC A;  1U9V A;  3N3K A;  4MZS A;  3ERV A;  4PAD A;  2FRQ A;  1YK8 A;  4CDE B;  1JQP A;  2CIO A;  3LXS A;  2DZY A;  1K3B B;  7PCK A;  2DC8 A;  4OEM A;  3U8E A;  3RVW A;  1AYU A;  3KKU A;  5F02 A;  3F75 A;  5JH3 A;  4QH6 A;  4BQV A;  1IWD A;  2R9C A;  4QBB A;  3I06 A;  1BQI A;  1SNK A;  2DCB A;  2YJB A;  3WXF A;  1O0E A;  2FTD A;  1YT7 A;  4P6E A;  4N4Z A;  4AXL A;  2PAD A;  2FT2 A;  3MOR A;  1KFX L;  3OVX A;  3TNX A;  1CVZ A;  1EWO A;  1MDW A;  1CV8 A;  1KHQ A;  1FH0 A;  1EWP A;  3C9E A;  3HHI A;  1PBH A;  2P7U A;  1NPZ A;  5J94 A;  1NL6 A;  1YAL A;  3BOW A;  2ACT A;  5CVO B;  1Y4H A;  4BPV A;  4CDD B;  5A24 A;  2PNS A;  4YYR A;  2Y6E A;  3RVX A;  1PPD A; 
#chains in the Genus database with same CATH topology
 5FPW A;  2G7Y A;  3BWK A;  4FIP A;  2DCC A;  2WBF X;  2F7D A;  3V6E A;  4XUI A;  4CDC B;  2R9M A;  2JQG R;  1MEG A;  1GMY A;  1KXR A;  4QRG A;  2R9F A;  3OF8 A;  4DMX A;  3W30 A;  2E01 A;  3QSD A;  1PPO A;  2E02 A;  1DKI A;  4I07 A;  1CB5 A;  3PRM A;  2DC7 A;  2FRA A;  3M99 A;  4QRV A;  3ZNH A;  4FK5 A;  1QDQ A;  3P5U A;  1ATK A;  3PT2 A;  3CH2 X;  1PVJ A;  1F2B A;  2FE8 A;  3BPF A;  2O6X A;  1VJV A;  2B1N A;  2HHN A;  2ATO A;  1ME4 A;  3S3R A;  2XU4 A;  1AEC A;  1THE A;  3H7D A;  2HXZ A;  1PCI A;  4YYQ A;  2DCA A;  3OVZ A;  3IEJ A;  3B79 A;  3NHE A;  3CBK A;  1DF0 A;  4R3D A;  1XKG A;  2AS8 A;  2AVW A;  4OEL A;  3IHP A;  2ARY A;  2R9O A;  2YJ8 A;  3PNR A;  2FO5 A;  3H89 A;  4MI7 A;  5EF4 A;  1YZB A;  2AUZ A;  4RF0 A;  4XR7 A;  4PP1 A;  2BDL A;  3BBA A;  3MHS A;  4ZTB A;  1CS8 A;  4W4U A;  4OW0 A;  2HWK A;  2NQG A;  4BOP A;  4A5U A;  5EZS A;  3KW9 A;  2UZJ A;  1S4V A;  1KFU L;  4BOS A;  2AIM A;  2J7Q A;  2G8E A;  1PPN A;  1DEU A;  3IOQ A;  2IBI A;  4BSQ A;  3OQC A;  3N3G A;  5EGW A;  3PRP A;  1U9X A;  3PBH A;  1EWM A;  4RF1 A;  4W5C A;  2P0R A;  4REZ A;  3RNV A;  3TRK A;  3QJ3 A;  2FUD A;  1NQC A;  4X6J A;  2H7J A;  4CDF B;  1A6R A;  3B21 A;  4X6I A;  4P6G A;  4WUR A;  2GHU A;  3O0U A;  5CVN B;  4WA6 A;  4HXD B;  3BY4 A;  5CHV A;  2HH5 A;  2YJC A;  3MTN A;  1F2C A;  2DJG B;  4N79 A;  1EF7 A;  3H6S A;  4YYU A;  4DMY A;  3H8B A;  3KX1 A;  1NB3 A;  1UKF A;  1QOL A;  2BDZ A;  4RNA A;  4Q8H A;  1X9Y A;  1YK7 A;  2R9N A;  4OVZ B;  3DF0 A;  3IV2 A;  3KWB X;  1TU6 A;  3V6C A;  4PI3 A;  3TMP A;  4YYW A;  3BCN A;  1KHP A;  3KWZ A;  2G8J A;  3BPM A;  2B1M A;  1QMY A;  4MM3 B;  5PAD A;  3F5V A;  4W5B A;  1PAD A;  3MTV A;  3IUT A;  2FYE A;  2XU3 A;  1QXP A;  2DC9 A;  2AYN A;  3P5W A;  1SP4 B;  2OUL A;  3K8U A;  3WXE A;  3MHH A;  4D8I A;  8PCH A;  1PE6 A;  1AU3 A;  1BP4 A;  1M6D A;  4AXM A;  1Q6K A;  3BC3 A;  2JRI A;  3HHA A;  3D6S A;  3AI8 A;  1U9W A;  1CJL A;  1TL9 A;  2AGA A;  2E03 A;  2BTW B;  1MIR A;  2XU1 A;  2YJ2 A;  3IFU A;  1YVB A;  2OZ2 A;  3LFY A;  5CVM A;  2PBH A;  1CSB B;  1VSN A;  3CH3 X;  1U9Q X;  2NQA A;  5E6J A;  5JZE A;  1ME3 A;  2E00 A;  3PDF A;  1PIP A;  3O1G A;  2C0Y A;  1AIM A;  3MP2 A;  4G54 A;  2F1G A;  4X6H A;  4BOZ A;  1NLJ A;  3KFQ A;  4CZW A;  1POP A;  3P5V A;  3USV A;  6PAD A;  3OF9 A;  2Z84 A;  1U5I A;  3KSE A;  1ITO A;  1AYV A;  3RVV A;  4MSX A;  5K16 A;  3HWN A;  4YV8 A;  3WXG A;  1MS6 A;  5JA7 A;  2FQ9 A;  1ZIV A;  2XU5 A;  3OIS A;  1ZCM A;  3W31 A;  4RKX A;  3PHX A;  3BB7 A;  1TLO A;  2DZZ A;  4HWY A;  9PAP A;  1CPJ A;  2VHS A;  2PRE A;  3PHU A;  4D8B A;  2AYO A;  3PSE A;  2CB5 A;  2DJF B;  3K9M A;  1GLO A;  2DOS A;  1F2A A;  2HD5 A;  3S3Q A;  2NQD B;  2YJ9 A;  3H8C A;  4I05 A;  2DC6 A;  2GFO A;  4GUA A;  1PXV A;  3MJ5 A;  3PW3 A;  4YYV A;  3E1Z B;  4RY2 A;  4PP2 E;  1AU4 A;  3P5X A;  1BGO A;  4PT5 A;  4IUM A;  2AUX A;  4QRX A;  4BOQ A;  2R6N A;  4OVZ A;  1EWL A;  3O65 A;  3ZUA A;  4K7C A;  3QT4 A;  2JQF R;  1CQD A;  2G6D A;  5CHT A;  3GCB A;  3HD3 A;  3IMA A;  1AU2 A;  1F29 A;  3K24 A;  3CBJ A;  1NB5 A;  2J7Q C;  2VHF A;  1ICF A;  3I3T A;  4BS6 A;  3PHW A;  4YYS A;  1GEC E;  2NQI A;  2P86 A;  1GCB A;  4BS5 A;  2IPP B;  1CTE A;  1MEM A;  4ZUX U;  4KLB A;  4D8E A;  4XZX A;  4I04 A;  2OP3 A;  3C0R A;  1HUC B;  4Q8G A;  1BY8 A;  1AU0 A;  4IP3 A;  1AYW A;  1STF E;  2Y5B A;  4M0W A;  4MZO A;  4YVA A;  3N4C A;  2BTW A;  2AU1 A;  4N8W A;  5KO3 A;  1MHW A;  1Y08 A;  1PPP A;  2DCD A;  4FJC A;  2BU3 A;  1U9V A;  3N3K A;  4MZS A;  4P16 A;  3ERV A;  4PAD A;  2FRQ A;  1YK8 A;  4CDE B;  1JQP A;  2CIO A;  3LXS A;  2JTC A;  2DZY A;  1K3B B;  7PCK A;  2DC8 A;  4OEM A;  3U8E A;  3RVW A;  1AYU A;  3KKU A;  5F02 A;  3F75 A;  5JH3 A;  3E9S A;  4QH6 A;  4BQV A;  1IWD A;  2R9C A;  4QBB A;  3I06 A;  1BQI A;  1SNK A;  2DCB A;  2YJB A;  3WXF A;  1O0E A;  2FTD A;  1YT7 A;  4P6E A;  4N4Z A;  4AXL A;  2PAD A;  2FT2 A;  3MOR A;  1KFX L;  3OVX A;  3TNX A;  1CVZ A;  1EWO A;  1MDW A;  1CV8 A;  1KHQ A;  1FH0 A;  1EWP A;  3C9E A;  3HHI A;  1PBH A;  2P7U A;  1NPZ A;  5J94 A;  1NL6 A;  1YAL A;  5EZQ A;  3BOW A;  2ACT A;  5CVO B;  1Y4H A;  4BPV A;  4CDD B;  5A24 A;  2PNS A;  4YYR A;  2Y6E A;  3RVX A;  4BOU A;  1PPD A; 
#chains in the Genus database with same CATH homology
 5FPW A;  2G7Y A;  3BWK A;  4FIP A;  2DCC A;  2WBF X;  2F7D A;  3V6E A;  4XUI A;  4CDC B;  2R9M A;  2JQG R;  1MEG A;  1GMY A;  1KXR A;  4QRG A;  2R9F A;  3OF8 A;  4DMX A;  2E01 A;  3QSD A;  1PPO A;  2E02 A;  2VFC A;  4I07 A;  1CB5 A;  2DC7 A;  2FRA A;  3M99 A;  4QRV A;  4FK5 A;  1QDQ A;  3P5U A;  1ATK A;  3CH2 X;  1F2B A;  3BPF A;  2O6X A;  1VJV A;  2B1N A;  2HHN A;  2ATO A;  1ME4 A;  3S3R A;  2XU4 A;  1AEC A;  1THE A;  3H7D A;  2HXZ A;  2VFB A;  1PCI A;  4YYQ A;  2DCA A;  3OVZ A;  3IEJ A;  3B79 A;  3NHE A;  3CBK A;  1DF0 A;  1XKG A;  2AS8 A;  2AVW A;  4OEL A;  3IHP A;  2ARY A;  2R9O A;  2YJ8 A;  3PNR A;  2FO5 A;  3H89 A;  5EF4 A;  2AUZ A;  4XR7 A;  4PP1 A;  2BDL A;  3MHS A;  1CS8 A;  4W4U A;  2NQG A;  3KW9 A;  1S4V A;  1KFU L;  2AIM A;  2G8E A;  1PPN A;  1DEU A;  3IOQ A;  2IBI A;  4BSQ A;  3N3G A;  5EGW A;  1U9X A;  3PBH A;  1EWM A;  4W5C A;  2P0R A;  3QJ3 A;  2FUD A;  1NQC A;  4X6J A;  2H7J A;  4CDF B;  1A6R A;  4X6I A;  4P6G A;  2GHU A;  3O0U A;  5CVN B;  4WA6 A;  5CHV A;  2HH5 A;  2YJC A;  3MTN A;  1F2C A;  2DJG B;  4N79 A;  1EF7 A;  3H6S A;  4B55 A;  4YYU A;  4DMY A;  3H8B A;  3KX1 A;  1NB3 A;  1QOL A;  2BDZ A;  4Q8H A;  1X9Y A;  1YK7 A;  4C5P A;  2R9N A;  3DF0 A;  3IV2 A;  3KWB X;  1TU6 A;  3V6C A;  4PI3 A;  4YYW A;  3BCN A;  1KHP A;  3KWZ A;  2G8J A;  3BPM A;  2B1M A;  1QMY A;  5PAD A;  3F5V A;  4W5B A;  1PAD A;  3IUT A;  4GUZ A;  2FYE A;  2XU3 A;  1QXP A;  2DC9 A;  2AYN A;  3P5W A;  1SP4 B;  1E2T A;  2OUL A;  3K8U A;  3WXE A;  3MHH A;  8PCH A;  1PE6 A;  1AU3 A;  1BP4 A;  1M6D A;  4AXM A;  1Q6K A;  3BC3 A;  3HHA A;  3D6S A;  3AI8 A;  1U9W A;  1CJL A;  1TL9 A;  2E03 A;  1MIR A;  2XU1 A;  2YJ2 A;  3LFY A;  1YVB A;  2OZ2 A;  5CVM A;  2PBH A;  1CSB B;  1VSN A;  1W5R A;  3CH3 X;  1U9Q X;  2NQA A;  1ME3 A;  2E00 A;  3PDF A;  1PIP A;  4G54 A;  2C0Y A;  1AIM A;  3O1G A;  2F1G A;  4X6H A;  1NLJ A;  3KFQ A;  4CZW A;  1POP A;  3P5V A;  3USV A;  6PAD A;  3OF9 A;  3KSE A;  1U5I A;  1ITO A;  1AYV A;  3RVV A;  4MSX A;  5K16 A;  3HWN A;  4YV8 A;  3WXG A;  1MS6 A;  5JA7 A;  2FQ9 A;  1ZIV A;  2XU5 A;  3OIS A;  1ZCM A;  1GX3 A;  1TLO A;  2DZZ A;  4HWY A;  9PAP A;  1CPJ A;  2VHS A;  2PRE A;  4BGF A;  2AYO A;  2CB5 A;  3LTW A;  2DJF B;  3K9M A;  1GLO A;  1F2A A;  2HD5 A;  3S3Q A;  2NQD B;  2YJ9 A;  3H8C A;  4I05 A;  1W4T A;  2DC6 A;  2GFO A;  1PXV A;  3PW3 A;  4YYV A;  3E1Z B;  4RY2 A;  4PP2 E;  4NV7 A;  1AU4 A;  3P5X A;  1BGO A;  2AUX A;  4QRX A;  2R6N A;  1EWL A;  3ZUA A;  4K7C A;  3QT4 A;  2JQF R;  1CQD A;  2G6D A;  5CHT A;  3GCB A;  3HD3 A;  3IMA A;  1W6F A;  1AU2 A;  1F29 A;  3K24 A;  3CBJ A;  1NB5 A;  2VHF A;  1ICF A;  3I3T A;  4BS6 A;  4YYS A;  1GEC E;  2NQI A;  2P86 A;  3D9W A;  1GCB A;  4BS5 A;  2IPP B;  1CTE A;  1MEM A;  4ZUX U;  4KLB A;  2BSZ A;  4I04 A;  2OP3 A;  1HUC B;  4Q8G A;  1BY8 A;  1AU0 A;  1AYW A;  1STF E;  2Y5B A;  4MZO A;  4YVA A;  3N4C A;  2AU1 A;  4N8W A;  1MHW A;  1Y08 A;  1PPP A;  2DCD A;  4FJC A;  1U9V A;  3N3K A;  4MZS A;  3ERV A;  4PAD A;  2FRQ A;  1YK8 A;  4CDE B;  1JQP A;  2CIO A;  3LXS A;  4NV8 A;  2DZY A;  1K3B B;  7PCK A;  2DC8 A;  4OEM A;  3U8E A;  3RVW A;  1AYU A;  3KKU A;  5F02 A;  3F75 A;  5JH3 A;  4QH6 A;  4BQV A;  1IWD A;  2R9C A;  4QBB A;  3I06 A;  1BQI A;  1SNK A;  2DCB A;  2YJB A;  3WXF A;  1O0E A;  2FTD A;  1YT7 A;  4P6E A;  4N4Z A;  4AXL A;  2PAD A;  2FT2 A;  3MOR A;  1KFX L;  3OVX A;  3TNX A;  1CVZ A;  1EWO A;  1MDW A;  1CV8 A;  1KHQ A;  1FH0 A;  1EWP A;  3C9E A;  3HHI A;  1PBH A;  2P7U A;  1NPZ A;  5J94 A;  1NL6 A;  1YAL A;  3BOW A;  2ACT A;  5CVO B;  1Y4H A;  4BPV A;  4CDD B;  5A24 A;  2PNS A;  4YYR A;  2Y6E A;  3RVX A;  1PPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...