3S3QA

Structure of cathepsin b1 from schistosoma mansoni in complex with k11017 inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
VEIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B-like peptidase (C01 family)
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase/hydrolase inhibitor
total genus 90
structure length 254
sequence length 254
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3s3qA00
2R9MA 4P6GA 3TNXA 2CIOA 3IUTA 2DC6A 4MZSA 3RVVA 4YV8A 3IEJA 2FUDA 4P6EA 3C9EA 2G8JA 3QT4A 1CQDA 1THEA 3U8EA 5JA7A 3CH3X 2E00A 2F7DA 1CV8A 1GCBA 1F2AA 1MDWA 4BS5A 2HXZA 4YYSA 2ATOA 1MEMA 2B1MA 2BDZA 1BQIA 4N4ZA 3K24A 2R6NA 3NHEA 1EF7A 1TLOA 2HD5A 1X9YA 2BDLA 2DJFB 1GMYA 2NQAA 4AXMA 1BP4A 3OISA 3O0UA 5EGWA 1CPJA 3E1ZB 4WA6A 1CJLA 4YVAA 2Y6EA 2B1NA 2G7YA 3V6CA 1U9QX 1TU6A 1VJVA 1CSBB 1K3BB 3S3RA 2DC7A 2HH5A 2P86A 1NB5A 1YT7A 1CS8A 2AU1A 4CDEB 4YYQA 3D6SA 2YJ9A 1F2CA 4N8WA 3HHIA 1PCIA 2DC9A 1Y08A 3IOQA 2XU4A 2IBIA 2XU1A 3B79A 2GFOA 5J94A 2F1GA 4AXLA 3K8UA 2PADA 3H7DA 4BSQA 3BPFA 2DZYA 1PADA 2R9OA 3BWKA 3BOWA 4I07A 1ME4A 2XU5A 2YJBA 3USVA 1S4VA 4OEMA 5EF4A 2DCDA 2GHUA 1YALA 1U5IA 2FQ9A 1KHPA 3LXSA 2YJ8A 2DCBA 1KXRA 2YJCA 1MEGA 1QOLA 1STFE 3MORA 1NL6A 2Y5BA 1QDQA 1ATKA 4FIPA 3LFYA 4QRXA 3N3GA 3MHSA 2JQFR 2WBFX 1M6DA 3OVZA 4K7CA 4W5CA 3PBHA 4W5BA 1DEUA 1NLJA 3OVXA 1CVZA 5CHTA 1AYUA 1KHQA 2AUXA 1CTEA 3I06A 4PADA 3H8CA 1ITOA 1AU0A 1QMYA 1Q6KA 3QSDA 5CHVA 2DCCA 3GCBA 4X6IA 1EWPA 2AYOA 1XKGA 1KFUL 1EWMA 3BCNA 3OF8A 4XR7A 2P7UA 1NPZA 2NQDB 3KFQA 1PPPA 3IV2A 1PPOA 1F29A 1ZIVA 1JQPA 1HUCB 3F75A 2DC8A 4I04A 1MIRA 1EWOA 7PCKA 2VHSA 2NQIA 3PDFA 2R9FA 4G54A 2IPPB 4OELA 4I05A 3IHPA 5PADA 5JH3A 2FRAA 1DF0A 3KWZA 2YJ2A 4QRGA 4RY2A 5K16A 2FRQA 2G6DA 2JQGR 3WXFA 2AVWA 2ARYA 2G8EA 1F2BA 1FH0A 2XU3A 1O0EA 4PI3A 3RVXA 1GECE 2OP3A 3KKUA 3O1GA 4Q8HA 3BPMA 4X6HA 4CZWA 2R9NA 1PE6A 3PNRA 2NQGA 2DJGB 4FJCA 1AU2A 2AIMA 3MHHA 1VSNA 3AI8A 4Q8GA 5CVOB 3H8BA 4MZOA 1EWLA 1U9XA 2E01A 4YYWA 3ERVA 1NQCA 3P5UA 5F02A 3DF0A 2C0YA 3OF9A 2FO5A 1MS6A 4YYRA 1A6RA 3N4CA 2VHFA 2FYEA 1QXPA 1AYVA 4ZUXU 1U9WA 3CBJA 2ACTA 1PPDA 2OZ2A 2AS8A 3F5VA 4BS6A 3P5VA 2R9CA 4CDCB 3ZUAA 2PREA 2P0RA 4YYUA 2OULA 4PP2E 4CDFB 1CB5A 6PADA 2CB5A 3HHAA 3K9MA 4PP1A 1AECA 2HHNA 3I3TA 1PBHA 1GLOA 9PAPA 1BGOA 1PIPA 3M99A 1KFXL 4N79A 1AIMA 5CVMA 4QRVA 3KX1A 4FK5A 8PCHA 1BY8A 1IWDA 3RVWA 2PNSA 1YK8A 1AU4A 3MTNA 1ICFA 3WXEA 2AUZA 3WXGA 1NB3A 4YYVA 1TL9A 5CVNB 1AYWA 3P5XA 1SP4B 2AYNA 3HWNA 3IMAA 1ME3A 1YVBA 2H7JA 2FT2A 1MHWA 3KW9A 4HWYA 3KSEA 3PW3A 2E02A 2FTDA 4KLBA 1YK7A 2DCAA 5A24A 5FPWA 3KWBX 3V6EA 1Y4HA 4CDDB 1PXVA 3HD3A 4BPVA 1PPNA 3H89A 3H6SA 1AU3A 4X6JA 1U9VA 2PBHA 3CH2X 3QJ3A 3CBKA 3N3KA 3P5WA 4QH6A 1ZCMA 2E03A 3S3QA 4MSXA 3BC3A 2DZZA 1POPA 4BQVA 4DMXA 4XUIA 4W4UA 4DMYA 2O6XA 4QBBA 1SNKA
chains in the Genus database with same CATH superfamily
2R9MA 4P6GA 3TNXA 2CIOA 3IUTA 3TRKA 2DC6A 4MZSA 3RVVA 4YV8A 3IEJA 5EZSA 2FUDA 4P6EA 3C9EA 2G8JA 3QT4A 1CQDA 1THEA 3C0RA 3U8EA 3CH3X 2E00A 5JA7A 2F7DA 1CV8A 1GCBA 1F2AA 1MDWA 4BS5A 2FE8A 2HXZA 4YYSA 2ATOA 4RKXA 3PRMA 1MEMA 2B1MA 2BDZA 1BQIA 4N4ZA 3K24A 2R6NA 3NHEA 1EF7A 1TLOA 2HD5A 1X9YA 2BDLA 2DJFB 3TMPA 1GMYA 2NQAA 4AXMA 1BP4A 3OISA 4XZXA 3O0UA 4RNAA 5EGWA 1CPJA 3E1ZB 4WA6A 1CJLA 4YVAA 2JTCA 2Y6EA 2B1NA 4IUMA 2G7YA 3V6CA 1U9QX 1TU6A 1VJVA 4OW0A 1CSBB 3BB7A 1K3BB 2DC7A 2HH5A 2UZJA 3S3RA 2P86A 1NB5A 1YT7A 1CS8A 4BOZA 2AU1A 3BY4A 4CDEB 4YYQA 3D6SA 2YJ9A 1F2CA 3W31A 4N8WA 3HHIA 1PCIA 2DC9A 1Y08A 3IOQA 3W30A 4IP3A 2XU4A 2Z84A 2IBIA 2XU1A 3B79A 2GFOA 5J94A 2F1GA 4AXLA 3K8UA 2PADA 3H7DA 4BSQA 3BPFA 2DZYA 1PADA 2R9OA 3BWKA 3E9SA 3BOWA 4I07A 1ME4A 2XU5A 2YJBA 3USVA 3IFUA 4GUAA 1S4VA 1PVJA 4OEMA 5EF4A 2DCDA 2GHUA 1YALA 1U5IA 2FQ9A 1KHPA 3LXSA 2YJ8A 2DCBA 1KXRA 2YJCA 1MEGA 1QOLA 1STFE 3MORA 1NL6A 2Y5BA 4MM3B 3MTVA 1QDQA 1ATKA 4FIPA 3LFYA 4A5UA 4QRXA 3N3GA 3MHSA 2JQFR 2WBFX 1M6DA 3PHXA 3OVZA 4K7CA 4W5CA 3PBHA 4BOPA 4W5BA 1DEUA 1NLJA 3OVXA 1CVZA 5CHTA 1AYUA 1KHQA 2AUXA 1CTEA 3I06A 4PADA 3H8CA 1ITOA 1AU0A 1QMYA 1Q6KA 3QSDA 1UKFA 5CHVA 2DCCA 3GCBA 4X6IA 1EWPA 2AYOA 1XKGA 3PRPA 1KFUL 1EWMA 3BCNA 3OF8A 4WURA 4XR7A 5E6JA 2P7UA 3ZNHA 1NPZA 2NQDB 3KFQA 1PPPA 3IV2A 2HWKA 4BOQA 1PPOA 4RF0A 1F29A 1ZIVA 2BTWB 1JQPA 1HUCB 3F75A 2DC8A 4I04A 1MIRA 1EWOA 7PCKA 2VHSA 2NQIA 3PDFA 4P16A 2R9FA 4G54A 2IPPB 4OVZB 4OELA 4I05A 3IHPA 3B21A 5PADA 5JH3A 3RNVA 2FRAA 1DF0A 3KWZA 2YJ2A 4D8BA 4QRGA 4RY2A 5K16A 2FRQA 2G6DA 2JQGR 2BTWA 3WXFA 2AVWA 2ARYA 2G8EA 1F2BA 1FH0A 4D8EA 2XU3A 1O0EA 4REZA 4PI3A 4R3DA 3RVXA 4D8IA 1GECE 2OP3A 3KKUA 3O1GA 4OVZA 2DOSA 4Q8HA 3BPMA 4X6HA 4CZWA 2R9NA 1PE6A 3PNRA 2NQGA 2DJGB 4FJCA 1AU2A 4HXDB 2AIMA 2J7QC 3MHHA 1VSNA 3AI8A 4Q8GA 5CVOB 3H8BA 4MZOA 1EWLA 1U9XA 2E01A 4YYWA 3ERVA 1NQCA 3P5UA 5F02A 3DF0A 2C0YA 3OF9A 2FO5A 1DKIA 1MS6A 4YYRA 1A6RA 3N4CA 2VHFA 2FYEA 1QXPA 1AYVA 4ZUXU 1U9WA 3CBJA 5KO3A 2ACTA 1PPDA 2OZ2A 1YZBA 2AGAA 2AS8A 3F5VA 4BS6A 3P5VA 2R9CA 4CDCB 3ZUAA 2PREA 2P0RA 4YYUA 2OULA 4PP2E 4CDFB 1CB5A 6PADA 2CB5A 3HHAA 4MI7A 3K9MA 4PP1A 1AECA 2HHNA 3I3TA 1PBHA 4PT5A 1GLOA 9PAPA 1BGOA 3O65A 1PIPA 5JZEA 3M99A 3OQCA 1KFXL 4N79A 2JRIA 1AIMA 5CVMA 4QRVA 3KX1A 4FK5A 8PCHA 3PSEA 1BY8A 1IWDA 3RVWA 3PHWA 2PNSA 1YK8A 1AU4A 3MTNA 1ICFA 3WXEA 2AUZA 3WXGA 1NB3A 4YYVA 1TL9A 3MP2A 5CVNB 1AYWA 3P5XA 1SP4B 2AYNA 3HWNA 3IMAA 1ME3A 1YVBA 4BOSA 2H7JA 2FT2A 1MHWA 3KW9A 4BOUA 4HWYA 3KSEA 3PW3A 2E02A 2FTDA 4KLBA 1YK7A 2DCAA 5A24A 5FPWA 3KWBX 3V6EA 3PT2A 1Y4HA 4CDDB 1PXVA 2J7QA 3PHUA 2BU3A 3HD3A 4BPVA 1PPNA 3H89A 3H6SA 1AU3A 4X6JA 1U9VA 2PBHA 3CH2X 3QJ3A 3BBAA 3CBKA 3MJ5A 3N3KA 3P5WA 4QH6A 1ZCMA 4RF1A 2E03A 3S3QA 4MSXA 3BC3A 2DZZA 1POPA 4ZTBA 4BQVA 4DMXA 4M0WA 4XUIA 4W4UA 4DMYA 2O6XA 4QBBA 5EZQA 1SNKA
chains in the Genus database with same CATH topology
4BGFA 2R9MA 4P6GA 3TNXA 2CIOA 3IUTA 2DC6A 4MZSA 3RVVA 4YV8A 3IEJA 2FUDA 4P6EA 3C9EA 2G8JA 3QT4A 1CQDA 1THEA 3U8EA 5JA7A 3CH3X 2E00A 2F7DA 1CV8A 1GCBA 1F2AA 1MDWA 4BS5A 2HXZA 4YYSA 2ATOA 4NV8A 1MEMA 2B1MA 2BDZA 1BQIA 4N4ZA 3K24A 2R6NA 3NHEA 1EF7A 1TLOA 2HD5A 1X9YA 2BDLA 2DJFB 1GMYA 2NQAA 2VFCA 4AXMA 1BP4A 3OISA 3O0UA 5EGWA 1CPJA 3E1ZB 4WA6A 1CJLA 4YVAA 3LTWA 2Y6EA 2B1NA 2G7YA 3V6CA 1U9QX 1TU6A 1VJVA 1CSBB 1K3BB 3S3RA 2DC7A 2HH5A 2P86A 1NB5A 1YT7A 1CS8A 2AU1A 4CDEB 4YYQA 3D6SA 2YJ9A 1F2CA 4N8WA 3HHIA 1PCIA 2DC9A 1Y08A 3IOQA 2XU4A 2IBIA 2XU1A 3B79A 2GFOA 4C5PA 5J94A 1W4TA 2F1GA 4AXLA 3K8UA 2PADA 3H7DA 4BSQA 3BPFA 2DZYA 1PADA 2R9OA 3BWKA 3BOWA 4I07A 1ME4A 2XU5A 2YJBA 3USVA 1S4VA 4OEMA 5EF4A 2DCDA 2GHUA 1YALA 1U5IA 2FQ9A 1KHPA 3LXSA 2YJ8A 2DCBA 1KXRA 2YJCA 1MEGA 1QOLA 1STFE 3MORA 1NL6A 2Y5BA 1QDQA 1ATKA 4FIPA 3LFYA 4QRXA 3N3GA 3MHSA 2JQFR 2WBFX 1M6DA 3OVZA 4K7CA 4W5CA 3PBHA 4W5BA 1DEUA 1NLJA 3OVXA 1CVZA 5CHTA 1AYUA 1KHQA 2AUXA 1CTEA 3I06A 4PADA 3H8CA 1ITOA 1AU0A 1QMYA 1Q6KA 1W5RA 3QSDA 5CHVA 2DCCA 3D9WA 3GCBA 4X6IA 4B55A 1EWPA 2AYOA 1XKGA 1KFUL 1EWMA 3BCNA 3OF8A 4XR7A 2P7UA 1NPZA 2NQDB 3KFQA 1PPPA 3IV2A 1PPOA 1F29A 1ZIVA 1JQPA 1HUCB 3F75A 2DC8A 4I04A 1MIRA 1EWOA 7PCKA 1W6FA 2VHSA 2NQIA 3PDFA 2R9FA 4G54A 2IPPB 4OELA 4I05A 3IHPA 5PADA 5JH3A 2FRAA 1DF0A 3KWZA 2YJ2A 4QRGA 4RY2A 5K16A 2FRQA 2G6DA 2JQGR 3WXFA 2AVWA 2ARYA 2G8EA 1F2BA 1FH0A 2XU3A 1O0EA 4PI3A 3RVXA 1GX3A 1GECE 2OP3A 3KKUA 3O1GA 4Q8HA 3BPMA 4X6HA 4CZWA 2R9NA 1PE6A 3PNRA 2BSZA 2NQGA 2DJGB 4FJCA 1AU2A 2AIMA 3MHHA 1VSNA 3AI8A 4Q8GA 5CVOB 3H8BA 4MZOA 1EWLA 1U9XA 2E01A 4YYWA 3ERVA 1NQCA 3P5UA 5F02A 3DF0A 2C0YA 3OF9A 2FO5A 1MS6A 4YYRA 1A6RA 3N4CA 2VHFA 2VFBA 2FYEA 1QXPA 1AYVA 4ZUXU 1U9WA 3CBJA 2ACTA 1PPDA 2OZ2A 2AS8A 3F5VA 4BS6A 3P5VA 2R9CA 4CDCB 3ZUAA 2PREA 2P0RA 4YYUA 2OULA 4PP2E 4CDFB 1CB5A 6PADA 2CB5A 3HHAA 3K9MA 4NV7A 4PP1A 1AECA 2HHNA 3I3TA 1PBHA 1GLOA 9PAPA 1BGOA 1PIPA 3M99A 1KFXL 4N79A 1AIMA 5CVMA 4QRVA 3KX1A 4FK5A 8PCHA 1BY8A 1IWDA 3RVWA 2PNSA 1YK8A 1AU4A 3MTNA 1ICFA 3WXEA 2AUZA 3WXGA 1NB3A 4YYVA 1TL9A 5CVNB 1AYWA 3P5XA 1SP4B 2AYNA 3HWNA 3IMAA 1ME3A 1YVBA 2H7JA 2FT2A 1MHWA 3KW9A 4HWYA 3KSEA 3PW3A 2E02A 2FTDA 4KLBA 1YK7A 2DCAA 5A24A 5FPWA 3KWBX 3V6EA 1Y4HA 4CDDB 1E2TA 1PXVA 3HD3A 4BPVA 1PPNA 3H89A 3H6SA 1AU3A 4X6JA 1U9VA 2PBHA 3CH2X 3QJ3A 3CBKA 3N3KA 3P5WA 4QH6A 1ZCMA 2E03A 3S3QA 4MSXA 3BC3A 2DZZA 1POPA 4GUZA 4BQVA 4DMXA 4XUIA 4W4UA 4DMYA 2O6XA 4QBBA 1SNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9M A;  4P6G A;  3TNX A;  2CIO A;  3IUT A;  2DC6 A;  4MZS A;  3RVV A;  4YV8 A;  3IEJ A;  2FUD A;  4P6E A;  3C9E A;  2G8J A;  3QT4 A;  1CQD A;  1THE A;  3U8E A;  5JA7 A;  3CH3 X;  2E00 A;  2F7D A;  1CV8 A;  1GCB A;  1F2A A;  1MDW A;  4BS5 A;  2HXZ A;  4YYS A;  2ATO A;  1MEM A;  2B1M A;  2BDZ A;  1BQI A;  4N4Z A;  3K24 A;  2R6N A;  3NHE A;  1EF7 A;  1TLO A;  2HD5 A;  1X9Y A;  2BDL A;  2DJF B;  1GMY A;  2NQA A;  4AXM A;  1BP4 A;  3OIS A;  3O0U A;  5EGW A;  1CPJ A;  3E1Z B;  4WA6 A;  1CJL A;  4YVA A;  2Y6E A;  2B1N A;  2G7Y A;  3V6C A;  1U9Q X;  1TU6 A;  1VJV A;  1CSB B;  1K3B B;  3S3R A;  2DC7 A;  2HH5 A;  2P86 A;  1NB5 A;  1YT7 A;  1CS8 A;  2AU1 A;  4CDE B;  4YYQ A;  3D6S A;  2YJ9 A;  1F2C A;  4N8W A;  3HHI A;  1PCI A;  2DC9 A;  1Y08 A;  3IOQ A;  2XU4 A;  2IBI A;  2XU1 A;  3B79 A;  2GFO A;  5J94 A;  2F1G A;  4AXL A;  3K8U A;  2PAD A;  3H7D A;  4BSQ A;  3BPF A;  2DZY A;  1PAD A;  2R9O A;  3BWK A;  3BOW A;  4I07 A;  1ME4 A;  2XU5 A;  2YJB A;  3USV A;  1S4V A;  4OEM A;  5EF4 A;  2DCD A;  2GHU A;  1YAL A;  1U5I A;  2FQ9 A;  1KHP A;  3LXS A;  2YJ8 A;  2DCB A;  1KXR A;  2YJC A;  1MEG A;  1QOL A;  1STF E;  3MOR A;  1NL6 A;  2Y5B A;  1QDQ A;  1ATK A;  4FIP A;  3LFY A;  4QRX A;  3N3G A;  3MHS A;  2JQF R;  2WBF X;  1M6D A;  3OVZ A;  4K7C A;  4W5C A;  3PBH A;  4W5B A;  1DEU A;  1NLJ A;  3OVX A;  1CVZ A;  5CHT A;  1AYU A;  1KHQ A;  2AUX A;  1CTE A;  3I06 A;  4PAD A;  3H8C A;  1ITO A;  1AU0 A;  1QMY A;  1Q6K A;  3QSD A;  5CHV A;  2DCC A;  3GCB A;  4X6I A;  1EWP A;  2AYO A;  1XKG A;  1KFU L;  1EWM A;  3BCN A;  3OF8 A;  4XR7 A;  2P7U A;  1NPZ A;  2NQD B;  3KFQ A;  1PPP A;  3IV2 A;  1PPO A;  1F29 A;  1ZIV A;  1JQP A;  1HUC B;  3F75 A;  2DC8 A;  4I04 A;  1MIR A;  1EWO A;  7PCK A;  2VHS A;  2NQI A;  3PDF A;  2R9F A;  4G54 A;  2IPP B;  4OEL A;  4I05 A;  3IHP A;  5PAD A;  5JH3 A;  2FRA A;  1DF0 A;  3KWZ A;  2YJ2 A;  4QRG A;  4RY2 A;  5K16 A;  2FRQ A;  2G6D A;  2JQG R;  3WXF A;  2AVW A;  2ARY A;  2G8E A;  1F2B A;  1FH0 A;  2XU3 A;  1O0E A;  4PI3 A;  3RVX A;  1GEC E;  2OP3 A;  3KKU A;  3O1G A;  4Q8H A;  3BPM A;  4X6H A;  4CZW A;  2R9N A;  1PE6 A;  3PNR A;  2NQG A;  2DJG B;  4FJC A;  1AU2 A;  2AIM A;  3MHH A;  1VSN A;  3AI8 A;  4Q8G A;  5CVO B;  3H8B A;  4MZO A;  1EWL A;  1U9X A;  2E01 A;  4YYW A;  3ERV A;  1NQC A;  3P5U A;  5F02 A;  3DF0 A;  2C0Y A;  3OF9 A;  2FO5 A;  1MS6 A;  4YYR A;  1A6R A;  3N4C A;  2VHF A;  2FYE A;  1QXP A;  1AYV A;  4ZUX U;  1U9W A;  3CBJ A;  2ACT A;  1PPD A;  2OZ2 A;  2AS8 A;  3F5V A;  4BS6 A;  3P5V A;  2R9C A;  4CDC B;  3ZUA A;  2PRE A;  2P0R A;  4YYU A;  2OUL A;  4PP2 E;  4CDF B;  1CB5 A;  6PAD A;  2CB5 A;  3HHA A;  3K9M A;  4PP1 A;  1AEC A;  2HHN A;  3I3T A;  1PBH A;  1GLO A;  9PAP A;  1BGO A;  1PIP A;  3M99 A;  1KFX L;  4N79 A;  1AIM A;  5CVM A;  4QRV A;  3KX1 A;  4FK5 A;  8PCH A;  1BY8 A;  1IWD A;  3RVW A;  2PNS A;  1YK8 A;  1AU4 A;  3MTN A;  1ICF A;  3WXE A;  2AUZ A;  3WXG A;  1NB3 A;  4YYV A;  1TL9 A;  5CVN B;  1AYW A;  3P5X A;  1SP4 B;  2AYN A;  3HWN A;  3IMA A;  1ME3 A;  1YVB A;  2H7J A;  2FT2 A;  1MHW A;  3KW9 A;  4HWY A;  3KSE A;  3PW3 A;  2E02 A;  2FTD A;  4KLB A;  1YK7 A;  2DCA A;  5A24 A;  5FPW A;  3KWB X;  3V6E A;  1Y4H A;  4CDD B;  1PXV A;  3HD3 A;  4BPV A;  1PPN A;  3H89 A;  3H6S A;  1AU3 A;  4X6J A;  1U9V A;  2PBH A;  3CH2 X;  3QJ3 A;  3CBK A;  3N3K A;  3P5W A;  4QH6 A;  1ZCM A;  2E03 A;  3S3Q A;  4MSX A;  3BC3 A;  2DZZ A;  1POP A;  4BQV A;  4DMX A;  4XUI A;  4W4U A;  4DMY A;  2O6X A;  4QBB A;  1SNK A; 
#chains in the Genus database with same CATH topology
 2R9M A;  4P6G A;  3TNX A;  2CIO A;  3IUT A;  3TRK A;  2DC6 A;  4MZS A;  3RVV A;  4YV8 A;  3IEJ A;  5EZS A;  2FUD A;  4P6E A;  3C9E A;  2G8J A;  3QT4 A;  1CQD A;  1THE A;  3C0R A;  3U8E A;  3CH3 X;  2E00 A;  5JA7 A;  2F7D A;  1CV8 A;  1GCB A;  1F2A A;  1MDW A;  4BS5 A;  2FE8 A;  2HXZ A;  4YYS A;  2ATO A;  4RKX A;  3PRM A;  1MEM A;  2B1M A;  2BDZ A;  1BQI A;  4N4Z A;  3K24 A;  2R6N A;  3NHE A;  1EF7 A;  1TLO A;  2HD5 A;  1X9Y A;  2BDL A;  2DJF B;  3TMP A;  1GMY A;  2NQA A;  4AXM A;  1BP4 A;  3OIS A;  4XZX A;  3O0U A;  4RNA A;  5EGW A;  1CPJ A;  3E1Z B;  4WA6 A;  1CJL A;  4YVA A;  2JTC A;  2Y6E A;  2B1N A;  4IUM A;  2G7Y A;  3V6C A;  1U9Q X;  1TU6 A;  1VJV A;  4OW0 A;  1CSB B;  3BB7 A;  1K3B B;  2DC7 A;  2HH5 A;  2UZJ A;  3S3R A;  2P86 A;  1NB5 A;  1YT7 A;  1CS8 A;  4BOZ A;  2AU1 A;  3BY4 A;  4CDE B;  4YYQ A;  3D6S A;  2YJ9 A;  1F2C A;  3W31 A;  4N8W A;  3HHI A;  1PCI A;  2DC9 A;  1Y08 A;  3IOQ A;  3W30 A;  4IP3 A;  2XU4 A;  2Z84 A;  2IBI A;  2XU1 A;  3B79 A;  2GFO A;  5J94 A;  2F1G A;  4AXL A;  3K8U A;  2PAD A;  3H7D A;  4BSQ A;  3BPF A;  2DZY A;  1PAD A;  2R9O A;  3BWK A;  3E9S A;  3BOW A;  4I07 A;  1ME4 A;  2XU5 A;  2YJB A;  3USV A;  3IFU A;  4GUA A;  1S4V A;  1PVJ A;  4OEM A;  5EF4 A;  2DCD A;  2GHU A;  1YAL A;  1U5I A;  2FQ9 A;  1KHP A;  3LXS A;  2YJ8 A;  2DCB A;  1KXR A;  2YJC A;  1MEG A;  1QOL A;  1STF E;  3MOR A;  1NL6 A;  2Y5B A;  4MM3 B;  3MTV A;  1QDQ A;  1ATK A;  4FIP A;  3LFY A;  4A5U A;  4QRX A;  3N3G A;  3MHS A;  2JQF R;  2WBF X;  1M6D A;  3PHX A;  3OVZ A;  4K7C A;  4W5C A;  3PBH A;  4BOP A;  4W5B A;  1DEU A;  1NLJ A;  3OVX A;  1CVZ A;  5CHT A;  1AYU A;  1KHQ A;  2AUX A;  1CTE A;  3I06 A;  4PAD A;  3H8C A;  1ITO A;  1AU0 A;  1QMY A;  1Q6K A;  3QSD A;  1UKF A;  5CHV A;  2DCC A;  3GCB A;  4X6I A;  1EWP A;  2AYO A;  1XKG A;  3PRP A;  1KFU L;  1EWM A;  3BCN A;  3OF8 A;  4WUR A;  4XR7 A;  5E6J A;  2P7U A;  3ZNH A;  1NPZ A;  2NQD B;  3KFQ A;  1PPP A;  3IV2 A;  2HWK A;  4BOQ A;  1PPO A;  4RF0 A;  1F29 A;  1ZIV A;  2BTW B;  1JQP A;  1HUC B;  3F75 A;  2DC8 A;  4I04 A;  1MIR A;  1EWO A;  7PCK A;  2VHS A;  2NQI A;  3PDF A;  4P16 A;  2R9F A;  4G54 A;  2IPP B;  4OVZ B;  4OEL A;  4I05 A;  3IHP A;  3B21 A;  5PAD A;  5JH3 A;  3RNV A;  2FRA A;  1DF0 A;  3KWZ A;  2YJ2 A;  4D8B A;  4QRG A;  4RY2 A;  5K16 A;  2FRQ A;  2G6D A;  2JQG R;  2BTW A;  3WXF A;  2AVW A;  2ARY A;  2G8E A;  1F2B A;  1FH0 A;  4D8E A;  2XU3 A;  1O0E A;  4REZ A;  4PI3 A;  4R3D A;  3RVX A;  4D8I A;  1GEC E;  2OP3 A;  3KKU A;  3O1G A;  4OVZ A;  2DOS A;  4Q8H A;  3BPM A;  4X6H A;  4CZW A;  2R9N A;  1PE6 A;  3PNR A;  2NQG A;  2DJG B;  4FJC A;  1AU2 A;  4HXD B;  2AIM A;  2J7Q C;  3MHH A;  1VSN A;  3AI8 A;  4Q8G A;  5CVO B;  3H8B A;  4MZO A;  1EWL A;  1U9X A;  2E01 A;  4YYW A;  3ERV A;  1NQC A;  3P5U A;  5F02 A;  3DF0 A;  2C0Y A;  3OF9 A;  2FO5 A;  1DKI A;  1MS6 A;  4YYR A;  1A6R A;  3N4C A;  2VHF A;  2FYE A;  1QXP A;  1AYV A;  4ZUX U;  1U9W A;  3CBJ A;  5KO3 A;  2ACT A;  1PPD A;  2OZ2 A;  1YZB A;  2AGA A;  2AS8 A;  3F5V A;  4BS6 A;  3P5V A;  2R9C A;  4CDC B;  3ZUA A;  2PRE A;  2P0R A;  4YYU A;  2OUL A;  4PP2 E;  4CDF B;  1CB5 A;  6PAD A;  2CB5 A;  3HHA A;  4MI7 A;  3K9M A;  4PP1 A;  1AEC A;  2HHN A;  3I3T A;  1PBH A;  4PT5 A;  1GLO A;  9PAP A;  1BGO A;  3O65 A;  1PIP A;  5JZE A;  3M99 A;  3OQC A;  1KFX L;  4N79 A;  2JRI A;  1AIM A;  5CVM A;  4QRV A;  3KX1 A;  4FK5 A;  8PCH A;  3PSE A;  1BY8 A;  1IWD A;  3RVW A;  3PHW A;  2PNS A;  1YK8 A;  1AU4 A;  3MTN A;  1ICF A;  3WXE A;  2AUZ A;  3WXG A;  1NB3 A;  4YYV A;  1TL9 A;  3MP2 A;  5CVN B;  1AYW A;  3P5X A;  1SP4 B;  2AYN A;  3HWN A;  3IMA A;  1ME3 A;  1YVB A;  4BOS A;  2H7J A;  2FT2 A;  1MHW A;  3KW9 A;  4BOU A;  4HWY A;  3KSE A;  3PW3 A;  2E02 A;  2FTD A;  4KLB A;  1YK7 A;  2DCA A;  5A24 A;  5FPW A;  3KWB X;  3V6E A;  3PT2 A;  1Y4H A;  4CDD B;  1PXV A;  2J7Q A;  3PHU A;  2BU3 A;  3HD3 A;  4BPV A;  1PPN A;  3H89 A;  3H6S A;  1AU3 A;  4X6J A;  1U9V A;  2PBH A;  3CH2 X;  3QJ3 A;  3BBA A;  3CBK A;  3MJ5 A;  3N3K A;  3P5W A;  4QH6 A;  1ZCM A;  4RF1 A;  2E03 A;  3S3Q A;  4MSX A;  3BC3 A;  2DZZ A;  1POP A;  4ZTB A;  4BQV A;  4DMX A;  4M0W A;  4XUI A;  4W4U A;  4DMY A;  2O6X A;  4QBB A;  5EZQ A;  1SNK A; 
#chains in the Genus database with same CATH homology
 4BGF A;  2R9M A;  4P6G A;  3TNX A;  2CIO A;  3IUT A;  2DC6 A;  4MZS A;  3RVV A;  4YV8 A;  3IEJ A;  2FUD A;  4P6E A;  3C9E A;  2G8J A;  3QT4 A;  1CQD A;  1THE A;  3U8E A;  5JA7 A;  3CH3 X;  2E00 A;  2F7D A;  1CV8 A;  1GCB A;  1F2A A;  1MDW A;  4BS5 A;  2HXZ A;  4YYS A;  2ATO A;  4NV8 A;  1MEM A;  2B1M A;  2BDZ A;  1BQI A;  4N4Z A;  3K24 A;  2R6N A;  3NHE A;  1EF7 A;  1TLO A;  2HD5 A;  1X9Y A;  2BDL A;  2DJF B;  1GMY A;  2NQA A;  2VFC A;  4AXM A;  1BP4 A;  3OIS A;  3O0U A;  5EGW A;  1CPJ A;  3E1Z B;  4WA6 A;  1CJL A;  4YVA A;  3LTW A;  2Y6E A;  2B1N A;  2G7Y A;  3V6C A;  1U9Q X;  1TU6 A;  1VJV A;  1CSB B;  1K3B B;  3S3R A;  2DC7 A;  2HH5 A;  2P86 A;  1NB5 A;  1YT7 A;  1CS8 A;  2AU1 A;  4CDE B;  4YYQ A;  3D6S A;  2YJ9 A;  1F2C A;  4N8W A;  3HHI A;  1PCI A;  2DC9 A;  1Y08 A;  3IOQ A;  2XU4 A;  2IBI A;  2XU1 A;  3B79 A;  2GFO A;  4C5P A;  5J94 A;  1W4T A;  2F1G A;  4AXL A;  3K8U A;  2PAD A;  3H7D A;  4BSQ A;  3BPF A;  2DZY A;  1PAD A;  2R9O A;  3BWK A;  3BOW A;  4I07 A;  1ME4 A;  2XU5 A;  2YJB A;  3USV A;  1S4V A;  4OEM A;  5EF4 A;  2DCD A;  2GHU A;  1YAL A;  1U5I A;  2FQ9 A;  1KHP A;  3LXS A;  2YJ8 A;  2DCB A;  1KXR A;  2YJC A;  1MEG A;  1QOL A;  1STF E;  3MOR A;  1NL6 A;  2Y5B A;  1QDQ A;  1ATK A;  4FIP A;  3LFY A;  4QRX A;  3N3G A;  3MHS A;  2JQF R;  2WBF X;  1M6D A;  3OVZ A;  4K7C A;  4W5C A;  3PBH A;  4W5B A;  1DEU A;  1NLJ A;  3OVX A;  1CVZ A;  5CHT A;  1AYU A;  1KHQ A;  2AUX A;  1CTE A;  3I06 A;  4PAD A;  3H8C A;  1ITO A;  1AU0 A;  1QMY A;  1Q6K A;  1W5R A;  3QSD A;  5CHV A;  2DCC A;  3D9W A;  3GCB A;  4X6I A;  4B55 A;  1EWP A;  2AYO A;  1XKG A;  1KFU L;  1EWM A;  3BCN A;  3OF8 A;  4XR7 A;  2P7U A;  1NPZ A;  2NQD B;  3KFQ A;  1PPP A;  3IV2 A;  1PPO A;  1F29 A;  1ZIV A;  1JQP A;  1HUC B;  3F75 A;  2DC8 A;  4I04 A;  1MIR A;  1EWO A;  7PCK A;  1W6F A;  2VHS A;  2NQI A;  3PDF A;  2R9F A;  4G54 A;  2IPP B;  4OEL A;  4I05 A;  3IHP A;  5PAD A;  5JH3 A;  2FRA A;  1DF0 A;  3KWZ A;  2YJ2 A;  4QRG A;  4RY2 A;  5K16 A;  2FRQ A;  2G6D A;  2JQG R;  3WXF A;  2AVW A;  2ARY A;  2G8E A;  1F2B A;  1FH0 A;  2XU3 A;  1O0E A;  4PI3 A;  3RVX A;  1GX3 A;  1GEC E;  2OP3 A;  3KKU A;  3O1G A;  4Q8H A;  3BPM A;  4X6H A;  4CZW A;  2R9N A;  1PE6 A;  3PNR A;  2BSZ A;  2NQG A;  2DJG B;  4FJC A;  1AU2 A;  2AIM A;  3MHH A;  1VSN A;  3AI8 A;  4Q8G A;  5CVO B;  3H8B A;  4MZO A;  1EWL A;  1U9X A;  2E01 A;  4YYW A;  3ERV A;  1NQC A;  3P5U A;  5F02 A;  3DF0 A;  2C0Y A;  3OF9 A;  2FO5 A;  1MS6 A;  4YYR A;  1A6R A;  3N4C A;  2VHF A;  2VFB A;  2FYE A;  1QXP A;  1AYV A;  4ZUX U;  1U9W A;  3CBJ A;  2ACT A;  1PPD A;  2OZ2 A;  2AS8 A;  3F5V A;  4BS6 A;  3P5V A;  2R9C A;  4CDC B;  3ZUA A;  2PRE A;  2P0R A;  4YYU A;  2OUL A;  4PP2 E;  4CDF B;  1CB5 A;  6PAD A;  2CB5 A;  3HHA A;  3K9M A;  4NV7 A;  4PP1 A;  1AEC A;  2HHN A;  3I3T A;  1PBH A;  1GLO A;  9PAP A;  1BGO A;  1PIP A;  3M99 A;  1KFX L;  4N79 A;  1AIM A;  5CVM A;  4QRV A;  3KX1 A;  4FK5 A;  8PCH A;  1BY8 A;  1IWD A;  3RVW A;  2PNS A;  1YK8 A;  1AU4 A;  3MTN A;  1ICF A;  3WXE A;  2AUZ A;  3WXG A;  1NB3 A;  4YYV A;  1TL9 A;  5CVN B;  1AYW A;  3P5X A;  1SP4 B;  2AYN A;  3HWN A;  3IMA A;  1ME3 A;  1YVB A;  2H7J A;  2FT2 A;  1MHW A;  3KW9 A;  4HWY A;  3KSE A;  3PW3 A;  2E02 A;  2FTD A;  4KLB A;  1YK7 A;  2DCA A;  5A24 A;  5FPW A;  3KWB X;  3V6E A;  1Y4H A;  4CDD B;  1E2T A;  1PXV A;  3HD3 A;  4BPV A;  1PPN A;  3H89 A;  3H6S A;  1AU3 A;  4X6J A;  1U9V A;  2PBH A;  3CH2 X;  3QJ3 A;  3CBK A;  3N3K A;  3P5W A;  4QH6 A;  1ZCM A;  2E03 A;  3S3Q A;  4MSX A;  3BC3 A;  2DZZ A;  1POP A;  4GUZ A;  4BQV A;  4DMX A;  4XUI A;  4W4U A;  4DMY A;  2O6X A;  4QBB A;  1SNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...