3S3QA

Structure of cathepsin b1 from schistosoma mansoni in complex with k11017 inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
VEIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B-like peptidase (C01 family)
total genus 90
structure length 254
sequence length 254
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3s3qA00
1BGOA 2FRAA 3TNXA 1NL6A 2P86A 4MZOA 4YYRA 4YYQA 1YALA 4QRGA 1PXVA 3RVVA 3HHAA 3E1ZB 3HD3A 1AECA 1BP4A 3M99A 1EWOA 1PADA 1GECE 4YV8A 3F75A 2G8EA 1KHPA 2JQGR 2VHFA 5EGWA 1EWPA 1ME3A 3WXGA 1BY8A 2YJ8A 1NB5A 2DC8A 3PNRA 2R9FA 1PCIA 2DZZA 4I07A 2WBFX 1AYWA 1U9WA 1MS6A 2Y5BA 2IPPB 1AU2A 1CTEA 1EWLA 4QRXA 1NB3A 1S4VA 3WXFA 3K24A 3H6SA 1F2AA 4OEMA 3H8BA 1F2CA 2CB5A 2AIMA 4MSXA 1MEMA 4CDFB 5JA7A 2OP3A 5J94A 2FQ9A 1MDWA 2BDZA 2FO5A 1NLJA 5CVNB 9PAPA 2R9OA 5CVMA 1AIMA 1PPNA 2DCBA 1ICFA 4G54A 1AU4A 1A6RA 1U5IA 3PW3A 1MHWA 3V6CA 1U9VA 3D6SA 2XU1A 1GLOA 2NQDB 3KWZA 3ZUAA 4YYWA 4BQVA 3LFYA 7PCKA 2FTDA 2E01A 2P0RA 4Q8HA 2GFOA 3S3RA 3IV2A 1PPPA 1KXRA 2ARYA 2G8JA 1CPJA 3H8CA 4KLBA 1QXPA 1PIPA 1CB5A 2DC7A 3PBHA 3CH2X 3ERVA 5FPWA 5CVOB 3CBJA 2B1NA 2AYOA 1SNKA 3BWKA 2YJCA 4PADA 4QRVA 1KHQA 4CDCB 3IUTA 3H89A 4N8WA 2R6NA 3CBKA 3V6EA 2JQFR 2PREA 1GCBA 2CIOA 1NPZA 3N3GA 2DZYA 1ATKA 3KSEA 3USVA 3WXEA 1JQPA 4FIPA 3MHSA 4K7CA 2IBIA 1HUCB 3K8UA 1THEA 3U8EA 1BQIA 4CDEB 3N3KA 1CQDA 5F02A 5EF4A 4I05A 4PP1A 1TL9A 4DMYA 4QH6A 4DMXA 2AS8A 3OISA 4YVAA 1IWDA 4OELA 2DC6A 2HD5A 3PDFA 1PPOA 3KFQA 4FK5A 4WA6A 2ATOA 2HXZA 3P5XA 1AU0A 1X9YA 1ZIVA 1EF7A 2NQAA 3IOQA 3CH3X 4YYSA 3OF8A 3K9MA 1EWMA 1ITOA 2FYEA 3IEJA 1VSNA 4YYUA 4CZWA 1AYUA 1KFUL 1U9XA 2DC9A 2PBHA 4XUIA 3BPFA 3OVZA 4AXMA 3I3TA 3I06A 1FH0A 3KW9A 3MTNA 1YVBA 3IHPA 1PE6A 3H7DA 1QOLA 4ZUXU 2G7YA 1TLOA 2OULA 3GCBA 1AYVA 4PI3A 3IMAA 4BSQA 2ACTA 4BPVA 1M6DA 6PADA 1QDQA 3P5UA 3HHIA 5PADA 3NHEA 2HHNA 2YJ9A 1POPA 1YK7A 1KFXL 4X6JA 2XU3A 1Y08A 2B1MA 3MHHA 4BS6A 2DJGB 5JH3A 4N4ZA 2VHSA 2R9MA 2XU4A 1QMYA 5CHTA 3KKUA 2F7DA 4CDDB 4W5CA 3BPMA 3B79A 2OZ2A 2R9CA 2GHUA 2AYNA 3RVWA 2P7UA 1ZCMA 3F5VA 1Q6KA 3AI8A 4W4UA 4X6IA 2PADA 1Y4HA 2YJBA 4FJCA 1CSBB 4PP2E 2AU1A 3LXSA 4MZSA 1YK8A 4N79A 1DF0A 5A24A 1DEUA 2FRQA 1NQCA 2E00A 1K3BB 3KX1A 4RY2A 4YYVA 1ME4A 2FT2A 1YT7A 1SP4B 2E03A 1PBHA 3S3QA 4X6HA 2AUXA 2F1GA 5K16A 1CVZA 4P6EA 3BCNA 3P5WA 3QT4A 1MEGA 2R9NA 3C9EA 1AU3A 3BC3A 2DCAA 4QBBA 8PCHA 2AVWA 2HH5A 3HWNA 3P5VA 3O0UA 3DF0A 2PNSA 4P6GA 4XR7A 1O0EA 2YJ2A 1PPDA 3OVXA 1VJVA 1GMYA 2C0YA 2DCCA 2O6XA 4HWYA 1XKGA 3KWBX 1TU6A 2BDLA 2NQGA 2FUDA 2XU5A 2NQIA 3OF9A 1F2BA 3O1GA 4Q8GA 1F29A 4BS5A 2E02A 3N4CA 3QSDA 2AUZA 4W5BA 1U9QX 1CS8A 2DCDA 3MORA 1CJLA 5CHVA 1STFE 1CV8A 4I04A 1MIRA 3QJ3A 2H7JA 2DJFB 2G6DA 3RVXA 3BOWA 2Y6EA 4AXLA
chains in the Genus database with same CATH superfamily
1BGOA 2FRAA 3TNXA 1NL6A 2P86A 4MZOA 4YYRA 4YYQA 1YALA 3B21A 4RNAA 4QRGA 3W31A 1PXVA 3RVVA 3HHAA 3E1ZB 3HD3A 1AECA 1BP4A 3M99A 1EWOA 1PADA 3PRMA 1GECE 4OVZA 4YV8A 2FE8A 3F75A 2G8EA 1KHPA 2JQGR 2VHFA 5EGWA 1EWPA 1ME3A 3WXGA 4D8EA 1BY8A 2YJ8A 1NB5A 2DC8A 3PNRA 5JZEA 2R9FA 1PCIA 2DZZA 4I07A 2WBFX 5KO3A 1AYWA 1U9WA 4GUAA 1MS6A 2Y5BA 4BOQA 2IPPB 1AU2A 1CTEA 1EWLA 4QRXA 1NB3A 1S4VA 3WXFA 3K24A 3H6SA 1F2AA 3BB7A 4OEMA 3H8BA 1F2CA 3W30A 2CB5A 2AIMA 4MSXA 5E6JA 2JRIA 1MEMA 4CDFB 5JA7A 2OP3A 4OW0A 5J94A 2FQ9A 3O65A 1MDWA 2BDZA 2FO5A 1NLJA 5CVNB 9PAPA 2R9OA 5CVMA 1AIMA 1PPNA 2DCBA 1ICFA 4RF0A 4G54A 1AU4A 1A6RA 1U5IA 3PW3A 1MHWA 3V6CA 1U9VA 3D6SA 2XU1A 1GLOA 2NQDB 3KWZA 3ZUAA 4YYWA 4BQVA 3MP2A 3LFYA 7PCKA 2FTDA 2E01A 2P0RA 4Q8HA 2GFOA 3S3RA 3IV2A 4MI7A 1PPPA 1KXRA 2ARYA 4P16A 2G8JA 1CPJA 3H8CA 4KLBA 1QXPA 1PIPA 1CB5A 2DC7A 3PBHA 3CH2X 3ERVA 5FPWA 4BOSA 5CVOB 3CBJA 2B1NA 2AYOA 1SNKA 3BWKA 2YJCA 3BY4A 4PADA 3PHXA 4QRVA 1KHQA 3BBAA 4XZXA 4CDCB 3IUTA 3H89A 4N8WA 4IUMA 2R6NA 3CBKA 3V6EA 2JQFR 2PREA 1GCBA 3MJ5A 2CIOA 1NPZA 3N3GA 2DZYA 1ATKA 3KSEA 4BOUA 4D8BA 3USVA 3WXEA 1JQPA 4FIPA 3MHSA 2J7QA 4R3DA 4K7CA 2IBIA 1HUCB 3K8UA 2Z84A 1THEA 3U8EA 1BQIA 4CDEB 3N3KA 1CQDA 5F02A 5EF4A 4I05A 4PP1A 1TL9A 4DMYA 4QH6A 4DMXA 2AS8A 3OISA 4YVAA 1IWDA 4OELA 2DC6A 2HD5A 3PDFA 1PPOA 3KFQA 4FK5A 4WA6A 2ATOA 2HXZA 3P5XA 1AU0A 3E9SA 1X9YA 1ZIVA 1EF7A 2NQAA 4A5UA 3IOQA 3CH3X 4YYSA 3OF8A 4REZA 3K9MA 1EWMA 1ITOA 2FYEA 3IEJA 1VSNA 4YYUA 3IFUA 5EZQA 4CZWA 1AYUA 1KFUL 1U9XA 4OVZB 2DC9A 4ZTBA 2PBHA 4XUIA 2BTWA 2JTCA 3BPFA 3OVZA 4AXMA 3I3TA 3I06A 1FH0A 3KW9A 3MTNA 1YVBA 3IHPA 1PE6A 3H7DA 1QOLA 4ZUXU 2G7YA 4D8IA 1TLOA 2OULA 3GCBA 1AYVA 4PI3A 3IMAA 4BSQA 2ACTA 4BPVA 1M6DA 6PADA 1QDQA 3P5UA 3HHIA 3ZNHA 1DKIA 5PADA 3NHEA 2HHNA 2YJ9A 1POPA 1YK7A 3PHUA 1KFXL 4X6JA 3TMPA 2XU3A 1Y08A 2B1MA 3MHHA 4BS6A 2DJGB 5JH3A 4N4ZA 2VHSA 4BOZA 2R9MA 2XU4A 1QMYA 5CHTA 3KKUA 2F7DA 2BU3A 4CDDB 4MM3B 4BOPA 4W5CA 3BPMA 3B79A 2OZ2A 3TRKA 2R9CA 2GHUA 4IP3A 1UKFA 2AYNA 3RVWA 2P7UA 1ZCMA 3F5VA 1YZBA 1Q6KA 3AI8A 4W4UA 2PADA 4X6IA 2BTWB 1Y4HA 2YJBA 4FJCA 1CSBB 4PT5A 4HXDB 4PP2E 2AU1A 2DOSA 2J7QC 3LXSA 4MZSA 1YK8A 2UZJA 4N79A 1DF0A 5A24A 1DEUA 2FRQA 1NQCA 2E00A 1K3BB 3KX1A 4RY2A 4YYVA 2HWKA 1ME4A 2FT2A 1YT7A 1SP4B 5EZSA 2E03A 1PBHA 3S3QA 4X6HA 2AUXA 2F1GA 5K16A 3C0RA 1CVZA 4P6EA 2AGAA 3BCNA 3P5WA 3QT4A 1MEGA 2R9NA 3C9EA 3PT2A 1AU3A 3BC3A 2DCAA 3PRPA 4QBBA 8PCHA 2AVWA 2HH5A 3HWNA 3P5VA 3O0UA 3DF0A 2PNSA 4WURA 4P6GA 4XR7A 1O0EA 2YJ2A 1PPDA 3OVXA 1VJVA 1GMYA 2C0YA 2DCCA 2O6XA 4HWYA 1XKGA 3KWBX 1TU6A 2BDLA 2NQGA 2FUDA 3PHWA 2XU5A 2NQIA 3OF9A 3OQCA 1F2BA 3O1GA 4Q8GA 1F29A 4BS5A 2E02A 3N4CA 4M0WA 3QSDA 2AUZA 4W5BA 4RF1A 1U9QX 1CS8A 2DCDA 1PVJA 3MORA 3RNVA 1CJLA 3PSEA 5CHVA 1STFE 3MTVA 1CV8A 4I04A 1MIRA 3QJ3A 2H7JA 2DJFB 2G6DA 3RVXA 3BOWA 2Y6EA 4RKXA 4AXLA
chains in the Genus database with same CATH topology
1BGOA 2FRAA 3TNXA 1NL6A 2P86A 4MZOA 4YYRA 4YYQA 1YALA 4QRGA 1PXVA 1E2TA 3RVVA 3HHAA 3E1ZB 3HD3A 1AECA 1BP4A 3M99A 1EWOA 1PADA 1GECE 4YV8A 3F75A 2G8EA 1KHPA 2JQGR 2VHFA 4B55A 5EGWA 1EWPA 2BSZA 1ME3A 3WXGA 1BY8A 2YJ8A 1NB5A 2DC8A 3PNRA 2R9FA 1PCIA 2DZZA 4I07A 2WBFX 1AYWA 1U9WA 1MS6A 2Y5BA 2IPPB 1AU2A 1CTEA 1EWLA 4QRXA 1NB3A 1S4VA 3WXFA 3K24A 3H6SA 1F2AA 4OEMA 3H8BA 1F2CA 2CB5A 2AIMA 4MSXA 1MEMA 4CDFB 5JA7A 2OP3A 5J94A 2FQ9A 1MDWA 2BDZA 2FO5A 1NLJA 5CVNB 9PAPA 2R9OA 5CVMA 1AIMA 1PPNA 4NV8A 2DCBA 1ICFA 4G54A 1AU4A 1A6RA 3LTWA 1U5IA 3PW3A 1MHWA 3V6CA 1U9VA 3D6SA 2XU1A 1GLOA 2NQDB 3KWZA 3ZUAA 4YYWA 4BQVA 3LFYA 7PCKA 2FTDA 2E01A 2P0RA 4Q8HA 2GFOA 3S3RA 3IV2A 1PPPA 1KXRA 2ARYA 2G8JA 1CPJA 3H8CA 4KLBA 1QXPA 1PIPA 1CB5A 2DC7A 3PBHA 3CH2X 3ERVA 5FPWA 5CVOB 3CBJA 2B1NA 1GX3A 2AYOA 1SNKA 3BWKA 2YJCA 4PADA 4QRVA 1KHQA 4CDCB 3IUTA 3H89A 4N8WA 2R6NA 3CBKA 3V6EA 2JQFR 2PREA 1GCBA 2CIOA 1NPZA 3N3GA 2DZYA 1ATKA 3KSEA 1W5RA 3USVA 3WXEA 1JQPA 4FIPA 3MHSA 4K7CA 2IBIA 1HUCB 3K8UA 1THEA 3U8EA 1BQIA 4CDEB 3N3KA 1CQDA 5F02A 5EF4A 4I05A 4PP1A 1TL9A 4DMYA 4QH6A 4DMXA 2AS8A 3OISA 4YVAA 1IWDA 4OELA 2DC6A 2HD5A 3PDFA 1PPOA 3KFQA 4FK5A 4WA6A 2ATOA 2HXZA 3P5XA 1AU0A 1X9YA 1ZIVA 1EF7A 2NQAA 3IOQA 3CH3X 4YYSA 1W4TA 3OF8A 3K9MA 1EWMA 1ITOA 2FYEA 3IEJA 1VSNA 4YYUA 4CZWA 1AYUA 1KFUL 1U9XA 2DC9A 2PBHA 4XUIA 3BPFA 3OVZA 4AXMA 3I3TA 3I06A 1FH0A 3KW9A 3MTNA 1YVBA 3IHPA 1PE6A 3H7DA 1QOLA 4ZUXU 2G7YA 1TLOA 1W6FA 2OULA 3GCBA 1AYVA 4C5PA 4PI3A 3IMAA 4BSQA 2ACTA 4BPVA 1M6DA 6PADA 1QDQA 3P5UA 3HHIA 5PADA 3NHEA 2HHNA 2YJ9A 1POPA 1YK7A 1KFXL 4X6JA 2XU3A 1Y08A 2B1MA 3MHHA 4BS6A 2DJGB 5JH3A 4N4ZA 2VHSA 2R9MA 2XU4A 1QMYA 5CHTA 3KKUA 4BGFA 2F7DA 4CDDB 4NV7A 4W5CA 3BPMA 3B79A 2OZ2A 2R9CA 2GHUA 2AYNA 3RVWA 2P7UA 1ZCMA 3F5VA 3D9WA 1Q6KA 3AI8A 4W4UA 4X6IA 2PADA 1Y4HA 2YJBA 4FJCA 1CSBB 4PP2E 2AU1A 3LXSA 4MZSA 1YK8A 4N79A 1DF0A 5A24A 1DEUA 2FRQA 1NQCA 2E00A 1K3BB 3KX1A 4RY2A 4YYVA 1ME4A 2FT2A 1YT7A 1SP4B 2E03A 1PBHA 3S3QA 4X6HA 2AUXA 2F1GA 5K16A 1CVZA 4P6EA 3BCNA 3P5WA 3QT4A 1MEGA 2R9NA 3C9EA 1AU3A 3BC3A 2DCAA 4QBBA 8PCHA 2AVWA 2HH5A 3HWNA 3P5VA 3O0UA 3DF0A 2PNSA 2VFBA 4P6GA 4XR7A 1O0EA 2YJ2A 1PPDA 3OVXA 1VJVA 4GUZA 1GMYA 2C0YA 2DCCA 2O6XA 4HWYA 1XKGA 3KWBX 1TU6A 2BDLA 2NQGA 2FUDA 2XU5A 2NQIA 3OF9A 1F2BA 3O1GA 4Q8GA 1F29A 4BS5A 2E02A 3N4CA 3QSDA 2AUZA 4W5BA 1U9QX 1CS8A 2DCDA 3MORA 1CJLA 5CHVA 1STFE 1CV8A 2VFCA 4I04A 1MIRA 3QJ3A 2H7JA 2DJFB 2G6DA 3RVXA 3BOWA 2Y6EA 4AXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGO A;  2FRA A;  3TNX A;  1NL6 A;  2P86 A;  4MZO A;  4YYR A;  4YYQ A;  1YAL A;  4QRG A;  1PXV A;  3RVV A;  3HHA A;  3E1Z B;  3HD3 A;  1AEC A;  1BP4 A;  3M99 A;  1EWO A;  1PAD A;  1GEC E;  4YV8 A;  3F75 A;  2G8E A;  1KHP A;  2JQG R;  2VHF A;  5EGW A;  1EWP A;  1ME3 A;  3WXG A;  1BY8 A;  2YJ8 A;  1NB5 A;  2DC8 A;  3PNR A;  2R9F A;  1PCI A;  2DZZ A;  4I07 A;  2WBF X;  1AYW A;  1U9W A;  1MS6 A;  2Y5B A;  2IPP B;  1AU2 A;  1CTE A;  1EWL A;  4QRX A;  1NB3 A;  1S4V A;  3WXF A;  3K24 A;  3H6S A;  1F2A A;  4OEM A;  3H8B A;  1F2C A;  2CB5 A;  2AIM A;  4MSX A;  1MEM A;  4CDF B;  5JA7 A;  2OP3 A;  5J94 A;  2FQ9 A;  1MDW A;  2BDZ A;  2FO5 A;  1NLJ A;  5CVN B;  9PAP A;  2R9O A;  5CVM A;  1AIM A;  1PPN A;  2DCB A;  1ICF A;  4G54 A;  1AU4 A;  1A6R A;  1U5I A;  3PW3 A;  1MHW A;  3V6C A;  1U9V A;  3D6S A;  2XU1 A;  1GLO A;  2NQD B;  3KWZ A;  3ZUA A;  4YYW A;  4BQV A;  3LFY A;  7PCK A;  2FTD A;  2E01 A;  2P0R A;  4Q8H A;  2GFO A;  3S3R A;  3IV2 A;  1PPP A;  1KXR A;  2ARY A;  2G8J A;  1CPJ A;  3H8C A;  4KLB A;  1QXP A;  1PIP A;  1CB5 A;  2DC7 A;  3PBH A;  3CH2 X;  3ERV A;  5FPW A;  5CVO B;  3CBJ A;  2B1N A;  2AYO A;  1SNK A;  3BWK A;  2YJC A;  4PAD A;  4QRV A;  1KHQ A;  4CDC B;  3IUT A;  3H89 A;  4N8W A;  2R6N A;  3CBK A;  3V6E A;  2JQF R;  2PRE A;  1GCB A;  2CIO A;  1NPZ A;  3N3G A;  2DZY A;  1ATK A;  3KSE A;  3USV A;  3WXE A;  1JQP A;  4FIP A;  3MHS A;  4K7C A;  2IBI A;  1HUC B;  3K8U A;  1THE A;  3U8E A;  1BQI A;  4CDE B;  3N3K A;  1CQD A;  5F02 A;  5EF4 A;  4I05 A;  4PP1 A;  1TL9 A;  4DMY A;  4QH6 A;  4DMX A;  2AS8 A;  3OIS A;  4YVA A;  1IWD A;  4OEL A;  2DC6 A;  2HD5 A;  3PDF A;  1PPO A;  3KFQ A;  4FK5 A;  4WA6 A;  2ATO A;  2HXZ A;  3P5X A;  1AU0 A;  1X9Y A;  1ZIV A;  1EF7 A;  2NQA A;  3IOQ A;  3CH3 X;  4YYS A;  3OF8 A;  3K9M A;  1EWM A;  1ITO A;  2FYE A;  3IEJ A;  1VSN A;  4YYU A;  4CZW A;  1AYU A;  1KFU L;  1U9X A;  2DC9 A;  2PBH A;  4XUI A;  3BPF A;  3OVZ A;  4AXM A;  3I3T A;  3I06 A;  1FH0 A;  3KW9 A;  3MTN A;  1YVB A;  3IHP A;  1PE6 A;  3H7D A;  1QOL A;  4ZUX U;  2G7Y A;  1TLO A;  2OUL A;  3GCB A;  1AYV A;  4PI3 A;  3IMA A;  4BSQ A;  2ACT A;  4BPV A;  1M6D A;  6PAD A;  1QDQ A;  3P5U A;  3HHI A;  5PAD A;  3NHE A;  2HHN A;  2YJ9 A;  1POP A;  1YK7 A;  1KFX L;  4X6J A;  2XU3 A;  1Y08 A;  2B1M A;  3MHH A;  4BS6 A;  2DJG B;  5JH3 A;  4N4Z A;  2VHS A;  2R9M A;  2XU4 A;  1QMY A;  5CHT A;  3KKU A;  2F7D A;  4CDD B;  4W5C A;  3BPM A;  3B79 A;  2OZ2 A;  2R9C A;  2GHU A;  2AYN A;  3RVW A;  2P7U A;  1ZCM A;  3F5V A;  1Q6K A;  3AI8 A;  4W4U A;  4X6I A;  2PAD A;  1Y4H A;  2YJB A;  4FJC A;  1CSB B;  4PP2 E;  2AU1 A;  3LXS A;  4MZS A;  1YK8 A;  4N79 A;  1DF0 A;  5A24 A;  1DEU A;  2FRQ A;  1NQC A;  2E00 A;  1K3B B;  3KX1 A;  4RY2 A;  4YYV A;  1ME4 A;  2FT2 A;  1YT7 A;  1SP4 B;  2E03 A;  1PBH A;  3S3Q A;  4X6H A;  2AUX A;  2F1G A;  5K16 A;  1CVZ A;  4P6E A;  3BCN A;  3P5W A;  3QT4 A;  1MEG A;  2R9N A;  3C9E A;  1AU3 A;  3BC3 A;  2DCA A;  4QBB A;  8PCH A;  2AVW A;  2HH5 A;  3HWN A;  3P5V A;  3O0U A;  3DF0 A;  2PNS A;  4P6G A;  4XR7 A;  1O0E A;  2YJ2 A;  1PPD A;  3OVX A;  1VJV A;  1GMY A;  2C0Y A;  2DCC A;  2O6X A;  4HWY A;  1XKG A;  3KWB X;  1TU6 A;  2BDL A;  2NQG A;  2FUD A;  2XU5 A;  2NQI A;  3OF9 A;  1F2B A;  3O1G A;  4Q8G A;  1F29 A;  4BS5 A;  2E02 A;  3N4C A;  3QSD A;  2AUZ A;  4W5B A;  1U9Q X;  1CS8 A;  2DCD A;  3MOR A;  1CJL A;  5CHV A;  1STF E;  1CV8 A;  4I04 A;  1MIR A;  3QJ3 A;  2H7J A;  2DJF B;  2G6D A;  3RVX A;  3BOW A;  2Y6E A;  4AXL A; 
#chains in the Genus database with same CATH topology
 1BGO A;  2FRA A;  3TNX A;  1NL6 A;  2P86 A;  4MZO A;  4YYR A;  4YYQ A;  1YAL A;  3B21 A;  4RNA A;  4QRG A;  3W31 A;  1PXV A;  3RVV A;  3HHA A;  3E1Z B;  3HD3 A;  1AEC A;  1BP4 A;  3M99 A;  1EWO A;  1PAD A;  3PRM A;  1GEC E;  4OVZ A;  4YV8 A;  2FE8 A;  3F75 A;  2G8E A;  1KHP A;  2JQG R;  2VHF A;  5EGW A;  1EWP A;  1ME3 A;  3WXG A;  4D8E A;  1BY8 A;  2YJ8 A;  1NB5 A;  2DC8 A;  3PNR A;  5JZE A;  2R9F A;  1PCI A;  2DZZ A;  4I07 A;  2WBF X;  5KO3 A;  1AYW A;  1U9W A;  4GUA A;  1MS6 A;  2Y5B A;  4BOQ A;  2IPP B;  1AU2 A;  1CTE A;  1EWL A;  4QRX A;  1NB3 A;  1S4V A;  3WXF A;  3K24 A;  3H6S A;  1F2A A;  3BB7 A;  4OEM A;  3H8B A;  1F2C A;  3W30 A;  2CB5 A;  2AIM A;  4MSX A;  5E6J A;  2JRI A;  1MEM A;  4CDF B;  5JA7 A;  2OP3 A;  4OW0 A;  5J94 A;  2FQ9 A;  3O65 A;  1MDW A;  2BDZ A;  2FO5 A;  1NLJ A;  5CVN B;  9PAP A;  2R9O A;  5CVM A;  1AIM A;  1PPN A;  2DCB A;  1ICF A;  4RF0 A;  4G54 A;  1AU4 A;  1A6R A;  1U5I A;  3PW3 A;  1MHW A;  3V6C A;  1U9V A;  3D6S A;  2XU1 A;  1GLO A;  2NQD B;  3KWZ A;  3ZUA A;  4YYW A;  4BQV A;  3MP2 A;  3LFY A;  7PCK A;  2FTD A;  2E01 A;  2P0R A;  4Q8H A;  2GFO A;  3S3R A;  3IV2 A;  4MI7 A;  1PPP A;  1KXR A;  2ARY A;  4P16 A;  2G8J A;  1CPJ A;  3H8C A;  4KLB A;  1QXP A;  1PIP A;  1CB5 A;  2DC7 A;  3PBH A;  3CH2 X;  3ERV A;  5FPW A;  4BOS A;  5CVO B;  3CBJ A;  2B1N A;  2AYO A;  1SNK A;  3BWK A;  2YJC A;  3BY4 A;  4PAD A;  3PHX A;  4QRV A;  1KHQ A;  3BBA A;  4XZX A;  4CDC B;  3IUT A;  3H89 A;  4N8W A;  4IUM A;  2R6N A;  3CBK A;  3V6E A;  2JQF R;  2PRE A;  1GCB A;  3MJ5 A;  2CIO A;  1NPZ A;  3N3G A;  2DZY A;  1ATK A;  3KSE A;  4BOU A;  4D8B A;  3USV A;  3WXE A;  1JQP A;  4FIP A;  3MHS A;  2J7Q A;  4R3D A;  4K7C A;  2IBI A;  1HUC B;  3K8U A;  2Z84 A;  1THE A;  3U8E A;  1BQI A;  4CDE B;  3N3K A;  1CQD A;  5F02 A;  5EF4 A;  4I05 A;  4PP1 A;  1TL9 A;  4DMY A;  4QH6 A;  4DMX A;  2AS8 A;  3OIS A;  4YVA A;  1IWD A;  4OEL A;  2DC6 A;  2HD5 A;  3PDF A;  1PPO A;  3KFQ A;  4FK5 A;  4WA6 A;  2ATO A;  2HXZ A;  3P5X A;  1AU0 A;  3E9S A;  1X9Y A;  1ZIV A;  1EF7 A;  2NQA A;  4A5U A;  3IOQ A;  3CH3 X;  4YYS A;  3OF8 A;  4REZ A;  3K9M A;  1EWM A;  1ITO A;  2FYE A;  3IEJ A;  1VSN A;  4YYU A;  3IFU A;  5EZQ A;  4CZW A;  1AYU A;  1KFU L;  1U9X A;  4OVZ B;  2DC9 A;  4ZTB A;  2PBH A;  4XUI A;  2BTW A;  2JTC A;  3BPF A;  3OVZ A;  4AXM A;  3I3T A;  3I06 A;  1FH0 A;  3KW9 A;  3MTN A;  1YVB A;  3IHP A;  1PE6 A;  3H7D A;  1QOL A;  4ZUX U;  2G7Y A;  4D8I A;  1TLO A;  2OUL A;  3GCB A;  1AYV A;  4PI3 A;  3IMA A;  4BSQ A;  2ACT A;  4BPV A;  1M6D A;  6PAD A;  1QDQ A;  3P5U A;  3HHI A;  3ZNH A;  1DKI A;  5PAD A;  3NHE A;  2HHN A;  2YJ9 A;  1POP A;  1YK7 A;  3PHU A;  1KFX L;  4X6J A;  3TMP A;  2XU3 A;  1Y08 A;  2B1M A;  3MHH A;  4BS6 A;  2DJG B;  5JH3 A;  4N4Z A;  2VHS A;  4BOZ A;  2R9M A;  2XU4 A;  1QMY A;  5CHT A;  3KKU A;  2F7D A;  2BU3 A;  4CDD B;  4MM3 B;  4BOP A;  4W5C A;  3BPM A;  3B79 A;  2OZ2 A;  3TRK A;  2R9C A;  2GHU A;  4IP3 A;  1UKF A;  2AYN A;  3RVW A;  2P7U A;  1ZCM A;  3F5V A;  1YZB A;  1Q6K A;  3AI8 A;  4W4U A;  2PAD A;  4X6I A;  2BTW B;  1Y4H A;  2YJB A;  4FJC A;  1CSB B;  4PT5 A;  4HXD B;  4PP2 E;  2AU1 A;  2DOS A;  2J7Q C;  3LXS A;  4MZS A;  1YK8 A;  2UZJ A;  4N79 A;  1DF0 A;  5A24 A;  1DEU A;  2FRQ A;  1NQC A;  2E00 A;  1K3B B;  3KX1 A;  4RY2 A;  4YYV A;  2HWK A;  1ME4 A;  2FT2 A;  1YT7 A;  1SP4 B;  5EZS A;  2E03 A;  1PBH A;  3S3Q A;  4X6H A;  2AUX A;  2F1G A;  5K16 A;  3C0R A;  1CVZ A;  4P6E A;  2AGA A;  3BCN A;  3P5W A;  3QT4 A;  1MEG A;  2R9N A;  3C9E A;  3PT2 A;  1AU3 A;  3BC3 A;  2DCA A;  3PRP A;  4QBB A;  8PCH A;  2AVW A;  2HH5 A;  3HWN A;  3P5V A;  3O0U A;  3DF0 A;  2PNS A;  4WUR A;  4P6G A;  4XR7 A;  1O0E A;  2YJ2 A;  1PPD A;  3OVX A;  1VJV A;  1GMY A;  2C0Y A;  2DCC A;  2O6X A;  4HWY A;  1XKG A;  3KWB X;  1TU6 A;  2BDL A;  2NQG A;  2FUD A;  3PHW A;  2XU5 A;  2NQI A;  3OF9 A;  3OQC A;  1F2B A;  3O1G A;  4Q8G A;  1F29 A;  4BS5 A;  2E02 A;  3N4C A;  4M0W A;  3QSD A;  2AUZ A;  4W5B A;  4RF1 A;  1U9Q X;  1CS8 A;  2DCD A;  1PVJ A;  3MOR A;  3RNV A;  1CJL A;  3PSE A;  5CHV A;  1STF E;  3MTV A;  1CV8 A;  4I04 A;  1MIR A;  3QJ3 A;  2H7J A;  2DJF B;  2G6D A;  3RVX A;  3BOW A;  2Y6E A;  4RKX A;  4AXL A; 
#chains in the Genus database with same CATH homology
 1BGO A;  2FRA A;  3TNX A;  1NL6 A;  2P86 A;  4MZO A;  4YYR A;  4YYQ A;  1YAL A;  4QRG A;  1PXV A;  1E2T A;  3RVV A;  3HHA A;  3E1Z B;  3HD3 A;  1AEC A;  1BP4 A;  3M99 A;  1EWO A;  1PAD A;  1GEC E;  4YV8 A;  3F75 A;  2G8E A;  1KHP A;  2JQG R;  2VHF A;  4B55 A;  5EGW A;  1EWP A;  2BSZ A;  1ME3 A;  3WXG A;  1BY8 A;  2YJ8 A;  1NB5 A;  2DC8 A;  3PNR A;  2R9F A;  1PCI A;  2DZZ A;  4I07 A;  2WBF X;  1AYW A;  1U9W A;  1MS6 A;  2Y5B A;  2IPP B;  1AU2 A;  1CTE A;  1EWL A;  4QRX A;  1NB3 A;  1S4V A;  3WXF A;  3K24 A;  3H6S A;  1F2A A;  4OEM A;  3H8B A;  1F2C A;  2CB5 A;  2AIM A;  4MSX A;  1MEM A;  4CDF B;  5JA7 A;  2OP3 A;  5J94 A;  2FQ9 A;  1MDW A;  2BDZ A;  2FO5 A;  1NLJ A;  5CVN B;  9PAP A;  2R9O A;  5CVM A;  1AIM A;  1PPN A;  4NV8 A;  2DCB A;  1ICF A;  4G54 A;  1AU4 A;  1A6R A;  3LTW A;  1U5I A;  3PW3 A;  1MHW A;  3V6C A;  1U9V A;  3D6S A;  2XU1 A;  1GLO A;  2NQD B;  3KWZ A;  3ZUA A;  4YYW A;  4BQV A;  3LFY A;  7PCK A;  2FTD A;  2E01 A;  2P0R A;  4Q8H A;  2GFO A;  3S3R A;  3IV2 A;  1PPP A;  1KXR A;  2ARY A;  2G8J A;  1CPJ A;  3H8C A;  4KLB A;  1QXP A;  1PIP A;  1CB5 A;  2DC7 A;  3PBH A;  3CH2 X;  3ERV A;  5FPW A;  5CVO B;  3CBJ A;  2B1N A;  1GX3 A;  2AYO A;  1SNK A;  3BWK A;  2YJC A;  4PAD A;  4QRV A;  1KHQ A;  4CDC B;  3IUT A;  3H89 A;  4N8W A;  2R6N A;  3CBK A;  3V6E A;  2JQF R;  2PRE A;  1GCB A;  2CIO A;  1NPZ A;  3N3G A;  2DZY A;  1ATK A;  3KSE A;  1W5R A;  3USV A;  3WXE A;  1JQP A;  4FIP A;  3MHS A;  4K7C A;  2IBI A;  1HUC B;  3K8U A;  1THE A;  3U8E A;  1BQI A;  4CDE B;  3N3K A;  1CQD A;  5F02 A;  5EF4 A;  4I05 A;  4PP1 A;  1TL9 A;  4DMY A;  4QH6 A;  4DMX A;  2AS8 A;  3OIS A;  4YVA A;  1IWD A;  4OEL A;  2DC6 A;  2HD5 A;  3PDF A;  1PPO A;  3KFQ A;  4FK5 A;  4WA6 A;  2ATO A;  2HXZ A;  3P5X A;  1AU0 A;  1X9Y A;  1ZIV A;  1EF7 A;  2NQA A;  3IOQ A;  3CH3 X;  4YYS A;  1W4T A;  3OF8 A;  3K9M A;  1EWM A;  1ITO A;  2FYE A;  3IEJ A;  1VSN A;  4YYU A;  4CZW A;  1AYU A;  1KFU L;  1U9X A;  2DC9 A;  2PBH A;  4XUI A;  3BPF A;  3OVZ A;  4AXM A;  3I3T A;  3I06 A;  1FH0 A;  3KW9 A;  3MTN A;  1YVB A;  3IHP A;  1PE6 A;  3H7D A;  1QOL A;  4ZUX U;  2G7Y A;  1TLO A;  1W6F A;  2OUL A;  3GCB A;  1AYV A;  4C5P A;  4PI3 A;  3IMA A;  4BSQ A;  2ACT A;  4BPV A;  1M6D A;  6PAD A;  1QDQ A;  3P5U A;  3HHI A;  5PAD A;  3NHE A;  2HHN A;  2YJ9 A;  1POP A;  1YK7 A;  1KFX L;  4X6J A;  2XU3 A;  1Y08 A;  2B1M A;  3MHH A;  4BS6 A;  2DJG B;  5JH3 A;  4N4Z A;  2VHS A;  2R9M A;  2XU4 A;  1QMY A;  5CHT A;  3KKU A;  4BGF A;  2F7D A;  4CDD B;  4NV7 A;  4W5C A;  3BPM A;  3B79 A;  2OZ2 A;  2R9C A;  2GHU A;  2AYN A;  3RVW A;  2P7U A;  1ZCM A;  3F5V A;  3D9W A;  1Q6K A;  3AI8 A;  4W4U A;  4X6I A;  2PAD A;  1Y4H A;  2YJB A;  4FJC A;  1CSB B;  4PP2 E;  2AU1 A;  3LXS A;  4MZS A;  1YK8 A;  4N79 A;  1DF0 A;  5A24 A;  1DEU A;  2FRQ A;  1NQC A;  2E00 A;  1K3B B;  3KX1 A;  4RY2 A;  4YYV A;  1ME4 A;  2FT2 A;  1YT7 A;  1SP4 B;  2E03 A;  1PBH A;  3S3Q A;  4X6H A;  2AUX A;  2F1G A;  5K16 A;  1CVZ A;  4P6E A;  3BCN A;  3P5W A;  3QT4 A;  1MEG A;  2R9N A;  3C9E A;  1AU3 A;  3BC3 A;  2DCA A;  4QBB A;  8PCH A;  2AVW A;  2HH5 A;  3HWN A;  3P5V A;  3O0U A;  3DF0 A;  2PNS A;  2VFB A;  4P6G A;  4XR7 A;  1O0E A;  2YJ2 A;  1PPD A;  3OVX A;  1VJV A;  4GUZ A;  1GMY A;  2C0Y A;  2DCC A;  2O6X A;  4HWY A;  1XKG A;  3KWB X;  1TU6 A;  2BDL A;  2NQG A;  2FUD A;  2XU5 A;  2NQI A;  3OF9 A;  1F2B A;  3O1G A;  4Q8G A;  1F29 A;  4BS5 A;  2E02 A;  3N4C A;  3QSD A;  2AUZ A;  4W5B A;  1U9Q X;  1CS8 A;  2DCD A;  3MOR A;  1CJL A;  5CHV A;  1STF E;  1CV8 A;  2VFC A;  4I04 A;  1MIR A;  3QJ3 A;  2H7J A;  2DJF B;  2G6D A;  3RVX A;  3BOW A;  2Y6E A;  4AXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...