3S3QA

Structure of cathepsin b1 from schistosoma mansoni in complex with k11017 inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
b'VEIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B-like peptidase (C01 family)
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase/hydrolase inhibitor
total genus 90
structure length 254
sequence length 254
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3s3qA00
3PW3A 2ATOA 3F75A 2G8JA 4W5BA 1EF7A 3N3KA 3BPMA 1AIMA 1PIPA 1MDWA 3S3RA 3GCBA 4FK5A 4CDEB 2R9OA 3H89A 3CBJA 2DC6A 4YYQA 3LFYA 1PE6A 1YK7A 3QJ3A 1EWLA 3K24A 4X6HA 1TLOA 1YVBA 3IV2A 2NQIA 1SNKA 2DJGB 1BQIA 2OP3A 3P5WA 4QRGA 5J94A 1CSBB 2DCCA 5K16A 4XUIA 1EWOA 3HHIA 2PBHA 1HUCB 3CH2X 1AU2A 1YT7A 3TNXA 3M99A 5EGWA 1MEMA 2JQFR 2P0RA 4I04A 4YVAA 3OF9A 5CHTA 4DMYA 1JQPA 3P5XA 2DC7A 5CHVA 2AUZA 2DCAA 4X6JA 4MZOA 2DJFB 4Q8GA 4KLBA 3BCNA 1PADA 1MEGA 5CVMA 4YYUA 3BC3A 1CTEA 1SP4B 3IOQA 2DC8A 2G8EA 2VHFA 2YJ8A 4I05A 3HWNA 4P6EA 3USVA 1BGOA 3QSDA 4HWYA 5JH3A 3C9EA 1VSNA 3PBHA 2HD5A 2DZZA 1TU6A 4W4UA 2DCDA 4FIPA 2IBIA 4N4ZA 1O0EA 1NPZA 3IUTA 2Y5BA 3KKUA 2NQGA 1ZIVA 2R9FA 1MHWA 2HH5A 2FRQA 4FJCA 1FH0A 2E01A 3IEJA 1U9WA 3WXEA 2BDZA 1YK8A 3MHSA 2E00A 2FUDA 2E03A 2XU1A 1CV8A 3B79A 3BOWA 3RVXA 2FTDA 1BP4A 1K3BB 2C0YA 4QH6A 3OVZA 2E02A 1ME3A 4OEMA 3I3TA 3U8EA 2FT2A 1POPA 1GMYA 2YJBA 5CVOB 4ZUXU 3V6CA 2DCBA 3E1ZB 2VHSA 1GECE 2AIMA 1ITOA 1CPJA 1PPOA 3CH3X 4PI3A 3PDFA 8PCHA 1GLOA 1Q6KA 4MSXA 4QRVA 4CZWA 1F2AA 3OF8A 1DEUA 3H8CA 1F2CA 1PPPA 1CB5A 5CVNB 1Y08A 4Q8HA 2AS8A 3OVXA 4CDCB 4AXMA 1NL6A 2OULA 2DZYA 1U9QX 2CIOA 1Y4HA 3LXSA 2B1MA 2YJCA 1AECA 1A6RA 1EWMA 3HHAA 2AU1A 4QRXA 1AYWA 1MIRA 3O0UA 3D6SA 1STFE 3MHHA 4DMXA 3KW9A 1QDQA 2YJ2A 1TL9A 1BY8A 4G54A 2G7YA 3RVWA 1EWPA 2PREA 4BQVA 1NB5A 1QOLA 5PADA 3KFQA 2GFOA 3WXFA 4N8WA 4PP1A 1NB3A 3P5VA 2CB5A 1QXPA 2OZ2A 2JQGR 2NQDB 4PADA 4X6IA 7PCKA 1PPNA 2WBFX 4K7CA 4W5CA 3F5VA 2XU4A 1KFXL 3QT4A 2XU3A 5A24A 1U5IA 1CJLA 3S3QA 3MTNA 4WA6A 4AXLA 4N79A 3KWBX 2P7UA 3K8UA 1IWDA 1CVZA 2PADA 2B1NA 5JA7A 1AU4A 2HHNA 3H6SA 2AYOA 3V6EA 4MZSA 2P86A 3MORA 2O6XA 4QBBA 1PBHA 1KFUL 3N3GA 4I07A 1NQCA 1PCIA 2AUXA 1ATKA 3AI8A 3H7DA 2H7JA 1QMYA 1NLJA 1ICFA 5F02A 1U9VA 3K9MA 5EF4A 4OELA 2YJ9A 1F2BA 2FO5A 2NQAA 1ZCMA 2R9CA 1S4VA 4CDFB 1XKGA 3ERVA 2R6NA 1M6DA 1AU3A 4CDDB 6PADA 1CQDA 4BSQA 1PPDA 2Y6EA 2FYEA 4YYWA 1KXRA 2AVWA 3NHEA 1F29A 4BS5A 1KHPA 1DF0A 1AU0A 3P5UA 1U9XA 2AYNA 4XR7A 2G6DA 2BDLA 4RY2A 1PXVA 2XU5A 2F1GA 1CS8A 3PNRA 4YV8A 1VJVA 2ACTA 3BWKA 3RVVA 4BS6A 3CBKA 3ZUAA 4YYRA 3DF0A 1AYUA 3O1GA 4YYSA 1THEA 4P6GA 1AYVA 2R9NA 3H8BA 3OISA 2ARYA 4YYVA 3KSEA 5FPWA 2IPPB 1X9YA 3KWZA 3IMAA 3WXGA 2FQ9A 2FRAA 4PP2E 1ME4A 3N4CA 1KHQA 2DC9A 2GHUA 3IHPA 3HD3A 4BPVA 1GCBA 3KX1A 1MS6A 2HXZA 3BPFA 3I06A 1YALA 2PNSA 9PAPA 2F7DA 2R9MA
chains in the Genus database with same CATH superfamily
3PW3A 2ATOA 3F75A 2G8JA 4W5BA 1EF7A 3N3KA 3BPMA 1AIMA 1PIPA 4MI7A 1MDWA 3S3RA 4PT5A 3GCBA 2FE8A 4FK5A 4CDEB 2R9OA 3H89A 3CBJA 2DC6A 4YYQA 3E9SA 3LFYA 1PE6A 1YK7A 3QJ3A 1EWLA 3K24A 3C0RA 4X6HA 1TLOA 4MM3B 1YVBA 3IV2A 2NQIA 1SNKA 2DJGB 3MTVA 1BQIA 3TMPA 2OP3A 3P5WA 4QRGA 3PHUA 5J94A 1CSBB 2DCCA 5K16A 2JRIA 4XUIA 1EWOA 3HHIA 2PBHA 1HUCB 3CH2X 4D8EA 1AU2A 1YT7A 3TNXA 3M99A 5EGWA 1YZBA 1MEMA 2JQFR 2P0RA 4RF1A 2BTWB 4I04A 4YVAA 3OF9A 5CHTA 5EZQA 3PSEA 4DMYA 1JQPA 3P5XA 2DC7A 5CHVA 2AUZA 2DCAA 4X6JA 4MZOA 2DJFB 3TRKA 4Q8GA 1DKIA 4KLBA 3BCNA 1PADA 1MEGA 5CVMA 4YYUA 3BC3A 1CTEA 1SP4B 3IOQA 2DC8A 4HXDB 2G8EA 2VHFA 2YJ8A 4I05A 3HWNA 4P6EA 3USVA 5JZEA 1BGOA 3QSDA 4HWYA 5JH3A 3C9EA 1VSNA 3PBHA 2HD5A 1PVJA 2DZZA 1TU6A 3IFUA 4W4UA 2DCDA 4FIPA 2IBIA 4N4ZA 1O0EA 1NPZA 3IUTA 2Y5BA 3KKUA 2Z84A 2NQGA 1ZIVA 2R9FA 1MHWA 2HH5A 2FRQA 5E6JA 4BOQA 3B21A 4FJCA 1FH0A 2E01A 3IEJA 1U9WA 3WXEA 2BDZA 2JTCA 1YK8A 3MHSA 2E00A 4WURA 2FUDA 2E03A 2J7QC 2XU1A 5KO3A 1CV8A 3B79A 3BOWA 3RVXA 2FTDA 4BOPA 1BP4A 3W30A 1K3BB 2C0YA 4QH6A 3OVZA 2E02A 1ME3A 4OEMA 3I3TA 3U8EA 2FT2A 1POPA 1GMYA 2YJBA 1UKFA 4GUAA 5CVOB 4ZUXU 4A5UA 3V6CA 2DCBA 3E1ZB 2VHSA 1GECE 2AIMA 1ITOA 1CPJA 1PPOA 3CH3X 4PI3A 3PDFA 8PCHA 1GLOA 1Q6KA 4MSXA 4QRVA 4CZWA 1F2AA 3OF8A 1DEUA 3H8CA 1F2CA 1PPPA 4XZXA 1CB5A 3PHWA 5CVNB 2HWKA 1Y08A 4OVZA 2AS8A 4Q8HA 3BB7A 3OVXA 4CDCB 4AXMA 1NL6A 3MP2A 2OULA 2DZYA 4ZTBA 1U9QX 2CIOA 1Y4HA 3LXSA 2B1MA 2YJCA 1AECA 1A6RA 1EWMA 3HHAA 2AU1A 4QRXA 1AYWA 1MIRA 3O0UA 3PRPA 3D6SA 4OW0A 1STFE 3MHHA 4DMXA 4M0WA 3KW9A 1QDQA 4IUMA 2YJ2A 1TL9A 1BY8A 4G54A 3MJ5A 2G7YA 3RVWA 1EWPA 2PREA 4D8BA 4BQVA 1NB5A 1QOLA 5PADA 3KFQA 2GFOA 3WXFA 4N8WA 4PP1A 1NB3A 3P5VA 2CB5A 1QXPA 4BOUA 2OZ2A 2JQGR 2NQDB 4PADA 4X6IA 7PCKA 1PPNA 2WBFX 4K7CA 4W5CA 3F5VA 2XU4A 1KFXL 3QT4A 2XU3A 5A24A 1U5IA 4REZA 1CJLA 3S3QA 3MTNA 4WA6A 3W31A 4N79A 4AXLA 4IP3A 3KWBX 2P7UA 2UZJA 3K8UA 1IWDA 1CVZA 2PADA 2B1NA 5JA7A 1AU4A 4BOSA 2HHNA 3H6SA 3O65A 2AYOA 3V6EA 4MZSA 2P86A 3MORA 2O6XA 4QBBA 1PBHA 4R3DA 4P16A 1KFUL 3N3GA 4I07A 4RF0A 1NQCA 1PCIA 2AUXA 1ATKA 3AI8A 3H7DA 2DOSA 4RNAA 4OVZB 2H7JA 1QMYA 1NLJA 1ICFA 5F02A 1U9VA 3K9MA 5EF4A 4OELA 3BY4A 2YJ9A 1F2BA 2FO5A 4D8IA 2NQAA 1ZCMA 2R9CA 1S4VA 4CDFB 1XKGA 3ERVA 2R6NA 1M6DA 1AU3A 4CDDB 6PADA 1CQDA 4RKXA 4BSQA 1PPDA 2BU3A 2Y6EA 2FYEA 4YYWA 1KXRA 2AVWA 3NHEA 1F29A 4BS5A 1KHPA 1DF0A 1AU0A 3P5UA 5EZSA 1U9XA 2AYNA 3OQCA 4XR7A 3BBAA 2G6DA 2BDLA 4RY2A 1PXVA 2XU5A 2F1GA 3PRMA 1CS8A 3PNRA 2BTWA 4YV8A 1VJVA 2ACTA 3PT2A 3BWKA 3RVVA 4BS6A 3CBKA 3PHXA 3ZUAA 4YYRA 3DF0A 1AYUA 3O1GA 4YYSA 1THEA 4P6GA 2J7QA 3ZNHA 1AYVA 2R9NA 2AGAA 3H8BA 3OISA 2ARYA 4YYVA 3KSEA 5FPWA 2IPPB 1X9YA 3KWZA 3IMAA 3WXGA 2FQ9A 2FRAA 4PP2E 1ME4A 3N4CA 1KHQA 2DC9A 2GHUA 3RNVA 3IHPA 3HD3A 4BPVA 1GCBA 3KX1A 1MS6A 2HXZA 3BPFA 3I06A 4BOZA 1YALA 2PNSA 9PAPA 2F7DA 2R9MA
chains in the Genus database with same CATH topology
3PW3A 2ATOA 3F75A 2G8JA 4W5BA 1EF7A 3N3KA 3BPMA 1GX3A 1AIMA 1PIPA 1MDWA 3LTWA 3S3RA 3GCBA 1W4TA 4FK5A 4CDEB 2R9OA 3H89A 3CBJA 2DC6A 4YYQA 3LFYA 1PE6A 1YK7A 3QJ3A 1EWLA 3K24A 4X6HA 1TLOA 1YVBA 3IV2A 2NQIA 1SNKA 2DJGB 1BQIA 2OP3A 3P5WA 4QRGA 5J94A 1CSBB 2DCCA 5K16A 4XUIA 1EWOA 3HHIA 2PBHA 1HUCB 3CH2X 1AU2A 1YT7A 4GUZA 3TNXA 3M99A 5EGWA 1MEMA 2JQFR 2P0RA 4I04A 4YVAA 3OF9A 5CHTA 4DMYA 1JQPA 3P5XA 2DC7A 5CHVA 2AUZA 2DCAA 4X6JA 4MZOA 2DJFB 4Q8GA 4KLBA 3BCNA 1PADA 1MEGA 5CVMA 4YYUA 3BC3A 1CTEA 1SP4B 3IOQA 2DC8A 2G8EA 2VHFA 2YJ8A 4I05A 3HWNA 4P6EA 3USVA 1BGOA 3QSDA 4HWYA 5JH3A 4BGFA 3C9EA 1VSNA 3PBHA 2HD5A 2DZZA 1TU6A 4W4UA 2DCDA 4FIPA 2IBIA 4N4ZA 1O0EA 1NPZA 3IUTA 2Y5BA 3KKUA 2NQGA 1ZIVA 2R9FA 1MHWA 2HH5A 2FRQA 4FJCA 1FH0A 2E01A 3IEJA 1U9WA 3WXEA 2BDZA 1YK8A 2BSZA 2VFCA 3MHSA 2E00A 2FUDA 2E03A 2XU1A 1CV8A 3B79A 3BOWA 3RVXA 2FTDA 1BP4A 1K3BB 2C0YA 4B55A 4QH6A 3OVZA 2E02A 1ME3A 4OEMA 3I3TA 3U8EA 2FT2A 1POPA 1GMYA 2YJBA 1W5RA 5CVOB 4ZUXU 3V6CA 2DCBA 3E1ZB 2VHSA 1GECE 2AIMA 1ITOA 1CPJA 1PPOA 3CH3X 4PI3A 3PDFA 8PCHA 1GLOA 1Q6KA 4MSXA 4QRVA 4CZWA 1F2AA 3OF8A 1DEUA 3H8CA 1F2CA 1PPPA 1CB5A 5CVNB 1Y08A 4Q8HA 2AS8A 3OVXA 4CDCB 4AXMA 1NL6A 2OULA 2DZYA 1U9QX 2CIOA 1Y4HA 3LXSA 2B1MA 2YJCA 1AECA 1A6RA 1EWMA 3HHAA 2AU1A 4QRXA 1AYWA 1MIRA 3O0UA 3D6SA 1STFE 3MHHA 4DMXA 3KW9A 1QDQA 2YJ2A 1TL9A 1BY8A 4G54A 2G7YA 3RVWA 1EWPA 2PREA 4BQVA 1NB5A 1QOLA 5PADA 3KFQA 2GFOA 3WXFA 4N8WA 4PP1A 1NB3A 3P5VA 2CB5A 1QXPA 2OZ2A 2JQGR 2NQDB 4PADA 4X6IA 7PCKA 1PPNA 2WBFX 4K7CA 4W5CA 3F5VA 2XU4A 1KFXL 3QT4A 2XU3A 5A24A 3D9WA 1U5IA 1CJLA 3S3QA 3MTNA 4WA6A 4AXLA 4N79A 3KWBX 2P7UA 3K8UA 1IWDA 1CVZA 2PADA 2B1NA 5JA7A 1AU4A 2HHNA 3H6SA 2AYOA 3V6EA 4MZSA 2P86A 3MORA 2O6XA 4QBBA 1W6FA 1PBHA 1KFUL 3N3GA 4I07A 1NQCA 1PCIA 2AUXA 1ATKA 3AI8A 3H7DA 2H7JA 4C5PA 1QMYA 1NLJA 1ICFA 5F02A 1U9VA 3K9MA 5EF4A 4OELA 2YJ9A 1F2BA 2FO5A 2NQAA 1ZCMA 2R9CA 1S4VA 4CDFB 1XKGA 3ERVA 2R6NA 1M6DA 1AU3A 4CDDB 6PADA 1CQDA 4NV8A 4BSQA 1PPDA 2Y6EA 2FYEA 4YYWA 1KXRA 2AVWA 3NHEA 1F29A 4BS5A 1KHPA 1DF0A 1AU0A 3P5UA 1U9XA 2AYNA 4XR7A 4NV7A 2G6DA 2BDLA 4RY2A 1PXVA 2XU5A 2F1GA 1CS8A 3PNRA 4YV8A 1VJVA 2ACTA 3BWKA 3RVVA 4BS6A 3CBKA 3ZUAA 4YYRA 3DF0A 1AYUA 3O1GA 4YYSA 1THEA 4P6GA 1AYVA 2R9NA 3H8BA 3OISA 2ARYA 4YYVA 3KSEA 5FPWA 2IPPB 1X9YA 3KWZA 3IMAA 3WXGA 2FQ9A 2FRAA 4PP2E 1ME4A 3N4CA 1KHQA 2DC9A 2GHUA 3IHPA 2VFBA 1E2TA 3HD3A 4BPVA 1GCBA 3KX1A 1MS6A 2HXZA 3BPFA 3I06A 1YALA 2PNSA 9PAPA 2F7DA 2R9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PW3 A;  2ATO A;  3F75 A;  2G8J A;  4W5B A;  1EF7 A;  3N3K A;  3BPM A;  1AIM A;  1PIP A;  1MDW A;  3S3R A;  3GCB A;  4FK5 A;  4CDE B;  2R9O A;  3H89 A;  3CBJ A;  2DC6 A;  4YYQ A;  3LFY A;  1PE6 A;  1YK7 A;  3QJ3 A;  1EWL A;  3K24 A;  4X6H A;  1TLO A;  1YVB A;  3IV2 A;  2NQI A;  1SNK A;  2DJG B;  1BQI A;  2OP3 A;  3P5W A;  4QRG A;  5J94 A;  1CSB B;  2DCC A;  5K16 A;  4XUI A;  1EWO A;  3HHI A;  2PBH A;  1HUC B;  3CH2 X;  1AU2 A;  1YT7 A;  3TNX A;  3M99 A;  5EGW A;  1MEM A;  2JQF R;  2P0R A;  4I04 A;  4YVA A;  3OF9 A;  5CHT A;  4DMY A;  1JQP A;  3P5X A;  2DC7 A;  5CHV A;  2AUZ A;  2DCA A;  4X6J A;  4MZO A;  2DJF B;  4Q8G A;  4KLB A;  3BCN A;  1PAD A;  1MEG A;  5CVM A;  4YYU A;  3BC3 A;  1CTE A;  1SP4 B;  3IOQ A;  2DC8 A;  2G8E A;  2VHF A;  2YJ8 A;  4I05 A;  3HWN A;  4P6E A;  3USV A;  1BGO A;  3QSD A;  4HWY A;  5JH3 A;  3C9E A;  1VSN A;  3PBH A;  2HD5 A;  2DZZ A;  1TU6 A;  4W4U A;  2DCD A;  4FIP A;  2IBI A;  4N4Z A;  1O0E A;  1NPZ A;  3IUT A;  2Y5B A;  3KKU A;  2NQG A;  1ZIV A;  2R9F A;  1MHW A;  2HH5 A;  2FRQ A;  4FJC A;  1FH0 A;  2E01 A;  3IEJ A;  1U9W A;  3WXE A;  2BDZ A;  1YK8 A;  3MHS A;  2E00 A;  2FUD A;  2E03 A;  2XU1 A;  1CV8 A;  3B79 A;  3BOW A;  3RVX A;  2FTD A;  1BP4 A;  1K3B B;  2C0Y A;  4QH6 A;  3OVZ A;  2E02 A;  1ME3 A;  4OEM A;  3I3T A;  3U8E A;  2FT2 A;  1POP A;  1GMY A;  2YJB A;  5CVO B;  4ZUX U;  3V6C A;  2DCB A;  3E1Z B;  2VHS A;  1GEC E;  2AIM A;  1ITO A;  1CPJ A;  1PPO A;  3CH3 X;  4PI3 A;  3PDF A;  8PCH A;  1GLO A;  1Q6K A;  4MSX A;  4QRV A;  4CZW A;  1F2A A;  3OF8 A;  1DEU A;  3H8C A;  1F2C A;  1PPP A;  1CB5 A;  5CVN B;  1Y08 A;  4Q8H A;  2AS8 A;  3OVX A;  4CDC B;  4AXM A;  1NL6 A;  2OUL A;  2DZY A;  1U9Q X;  2CIO A;  1Y4H A;  3LXS A;  2B1M A;  2YJC A;  1AEC A;  1A6R A;  1EWM A;  3HHA A;  2AU1 A;  4QRX A;  1AYW A;  1MIR A;  3O0U A;  3D6S A;  1STF E;  3MHH A;  4DMX A;  3KW9 A;  1QDQ A;  2YJ2 A;  1TL9 A;  1BY8 A;  4G54 A;  2G7Y A;  3RVW A;  1EWP A;  2PRE A;  4BQV A;  1NB5 A;  1QOL A;  5PAD A;  3KFQ A;  2GFO A;  3WXF A;  4N8W A;  4PP1 A;  1NB3 A;  3P5V A;  2CB5 A;  1QXP A;  2OZ2 A;  2JQG R;  2NQD B;  4PAD A;  4X6I A;  7PCK A;  1PPN A;  2WBF X;  4K7C A;  4W5C A;  3F5V A;  2XU4 A;  1KFX L;  3QT4 A;  2XU3 A;  5A24 A;  1U5I A;  1CJL A;  3S3Q A;  3MTN A;  4WA6 A;  4AXL A;  4N79 A;  3KWB X;  2P7U A;  3K8U A;  1IWD A;  1CVZ A;  2PAD A;  2B1N A;  5JA7 A;  1AU4 A;  2HHN A;  3H6S A;  2AYO A;  3V6E A;  4MZS A;  2P86 A;  3MOR A;  2O6X A;  4QBB A;  1PBH A;  1KFU L;  3N3G A;  4I07 A;  1NQC A;  1PCI A;  2AUX A;  1ATK A;  3AI8 A;  3H7D A;  2H7J A;  1QMY A;  1NLJ A;  1ICF A;  5F02 A;  1U9V A;  3K9M A;  5EF4 A;  4OEL A;  2YJ9 A;  1F2B A;  2FO5 A;  2NQA A;  1ZCM A;  2R9C A;  1S4V A;  4CDF B;  1XKG A;  3ERV A;  2R6N A;  1M6D A;  1AU3 A;  4CDD B;  6PAD A;  1CQD A;  4BSQ A;  1PPD A;  2Y6E A;  2FYE A;  4YYW A;  1KXR A;  2AVW A;  3NHE A;  1F29 A;  4BS5 A;  1KHP A;  1DF0 A;  1AU0 A;  3P5U A;  1U9X A;  2AYN A;  4XR7 A;  2G6D A;  2BDL A;  4RY2 A;  1PXV A;  2XU5 A;  2F1G A;  1CS8 A;  3PNR A;  4YV8 A;  1VJV A;  2ACT A;  3BWK A;  3RVV A;  4BS6 A;  3CBK A;  3ZUA A;  4YYR A;  3DF0 A;  1AYU A;  3O1G A;  4YYS A;  1THE A;  4P6G A;  1AYV A;  2R9N A;  3H8B A;  3OIS A;  2ARY A;  4YYV A;  3KSE A;  5FPW A;  2IPP B;  1X9Y A;  3KWZ A;  3IMA A;  3WXG A;  2FQ9 A;  2FRA A;  4PP2 E;  1ME4 A;  3N4C A;  1KHQ A;  2DC9 A;  2GHU A;  3IHP A;  3HD3 A;  4BPV A;  1GCB A;  3KX1 A;  1MS6 A;  2HXZ A;  3BPF A;  3I06 A;  1YAL A;  2PNS A;  9PAP A;  2F7D A;  2R9M A; 
#chains in the Genus database with same CATH topology
 3PW3 A;  2ATO A;  3F75 A;  2G8J A;  4W5B A;  1EF7 A;  3N3K A;  3BPM A;  1AIM A;  1PIP A;  4MI7 A;  1MDW A;  3S3R A;  4PT5 A;  3GCB A;  2FE8 A;  4FK5 A;  4CDE B;  2R9O A;  3H89 A;  3CBJ A;  2DC6 A;  4YYQ A;  3E9S A;  3LFY A;  1PE6 A;  1YK7 A;  3QJ3 A;  1EWL A;  3K24 A;  3C0R A;  4X6H A;  1TLO A;  4MM3 B;  1YVB A;  3IV2 A;  2NQI A;  1SNK A;  2DJG B;  3MTV A;  1BQI A;  3TMP A;  2OP3 A;  3P5W A;  4QRG A;  3PHU A;  5J94 A;  1CSB B;  2DCC A;  5K16 A;  2JRI A;  4XUI A;  1EWO A;  3HHI A;  2PBH A;  1HUC B;  3CH2 X;  4D8E A;  1AU2 A;  1YT7 A;  3TNX A;  3M99 A;  5EGW A;  1YZB A;  1MEM A;  2JQF R;  2P0R A;  4RF1 A;  2BTW B;  4I04 A;  4YVA A;  3OF9 A;  5CHT A;  5EZQ A;  3PSE A;  4DMY A;  1JQP A;  3P5X A;  2DC7 A;  5CHV A;  2AUZ A;  2DCA A;  4X6J A;  4MZO A;  2DJF B;  3TRK A;  4Q8G A;  1DKI A;  4KLB A;  3BCN A;  1PAD A;  1MEG A;  5CVM A;  4YYU A;  3BC3 A;  1CTE A;  1SP4 B;  3IOQ A;  2DC8 A;  4HXD B;  2G8E A;  2VHF A;  2YJ8 A;  4I05 A;  3HWN A;  4P6E A;  3USV A;  5JZE A;  1BGO A;  3QSD A;  4HWY A;  5JH3 A;  3C9E A;  1VSN A;  3PBH A;  2HD5 A;  1PVJ A;  2DZZ A;  1TU6 A;  3IFU A;  4W4U A;  2DCD A;  4FIP A;  2IBI A;  4N4Z A;  1O0E A;  1NPZ A;  3IUT A;  2Y5B A;  3KKU A;  2Z84 A;  2NQG A;  1ZIV A;  2R9F A;  1MHW A;  2HH5 A;  2FRQ A;  5E6J A;  4BOQ A;  3B21 A;  4FJC A;  1FH0 A;  2E01 A;  3IEJ A;  1U9W A;  3WXE A;  2BDZ A;  2JTC A;  1YK8 A;  3MHS A;  2E00 A;  4WUR A;  2FUD A;  2E03 A;  2J7Q C;  2XU1 A;  5KO3 A;  1CV8 A;  3B79 A;  3BOW A;  3RVX A;  2FTD A;  4BOP A;  1BP4 A;  3W30 A;  1K3B B;  2C0Y A;  4QH6 A;  3OVZ A;  2E02 A;  1ME3 A;  4OEM A;  3I3T A;  3U8E A;  2FT2 A;  1POP A;  1GMY A;  2YJB A;  1UKF A;  4GUA A;  5CVO B;  4ZUX U;  4A5U A;  3V6C A;  2DCB A;  3E1Z B;  2VHS A;  1GEC E;  2AIM A;  1ITO A;  1CPJ A;  1PPO A;  3CH3 X;  4PI3 A;  3PDF A;  8PCH A;  1GLO A;  1Q6K A;  4MSX A;  4QRV A;  4CZW A;  1F2A A;  3OF8 A;  1DEU A;  3H8C A;  1F2C A;  1PPP A;  4XZX A;  1CB5 A;  3PHW A;  5CVN B;  2HWK A;  1Y08 A;  4OVZ A;  2AS8 A;  4Q8H A;  3BB7 A;  3OVX A;  4CDC B;  4AXM A;  1NL6 A;  3MP2 A;  2OUL A;  2DZY A;  4ZTB A;  1U9Q X;  2CIO A;  1Y4H A;  3LXS A;  2B1M A;  2YJC A;  1AEC A;  1A6R A;  1EWM A;  3HHA A;  2AU1 A;  4QRX A;  1AYW A;  1MIR A;  3O0U A;  3PRP A;  3D6S A;  4OW0 A;  1STF E;  3MHH A;  4DMX A;  4M0W A;  3KW9 A;  1QDQ A;  4IUM A;  2YJ2 A;  1TL9 A;  1BY8 A;  4G54 A;  3MJ5 A;  2G7Y A;  3RVW A;  1EWP A;  2PRE A;  4D8B A;  4BQV A;  1NB5 A;  1QOL A;  5PAD A;  3KFQ A;  2GFO A;  3WXF A;  4N8W A;  4PP1 A;  1NB3 A;  3P5V A;  2CB5 A;  1QXP A;  4BOU A;  2OZ2 A;  2JQG R;  2NQD B;  4PAD A;  4X6I A;  7PCK A;  1PPN A;  2WBF X;  4K7C A;  4W5C A;  3F5V A;  2XU4 A;  1KFX L;  3QT4 A;  2XU3 A;  5A24 A;  1U5I A;  4REZ A;  1CJL A;  3S3Q A;  3MTN A;  4WA6 A;  3W31 A;  4N79 A;  4AXL A;  4IP3 A;  3KWB X;  2P7U A;  2UZJ A;  3K8U A;  1IWD A;  1CVZ A;  2PAD A;  2B1N A;  5JA7 A;  1AU4 A;  4BOS A;  2HHN A;  3H6S A;  3O65 A;  2AYO A;  3V6E A;  4MZS A;  2P86 A;  3MOR A;  2O6X A;  4QBB A;  1PBH A;  4R3D A;  4P16 A;  1KFU L;  3N3G A;  4I07 A;  4RF0 A;  1NQC A;  1PCI A;  2AUX A;  1ATK A;  3AI8 A;  3H7D A;  2DOS A;  4RNA A;  4OVZ B;  2H7J A;  1QMY A;  1NLJ A;  1ICF A;  5F02 A;  1U9V A;  3K9M A;  5EF4 A;  4OEL A;  3BY4 A;  2YJ9 A;  1F2B A;  2FO5 A;  4D8I A;  2NQA A;  1ZCM A;  2R9C A;  1S4V A;  4CDF B;  1XKG A;  3ERV A;  2R6N A;  1M6D A;  1AU3 A;  4CDD B;  6PAD A;  1CQD A;  4RKX A;  4BSQ A;  1PPD A;  2BU3 A;  2Y6E A;  2FYE A;  4YYW A;  1KXR A;  2AVW A;  3NHE A;  1F29 A;  4BS5 A;  1KHP A;  1DF0 A;  1AU0 A;  3P5U A;  5EZS A;  1U9X A;  2AYN A;  3OQC A;  4XR7 A;  3BBA A;  2G6D A;  2BDL A;  4RY2 A;  1PXV A;  2XU5 A;  2F1G A;  3PRM A;  1CS8 A;  3PNR A;  2BTW A;  4YV8 A;  1VJV A;  2ACT A;  3PT2 A;  3BWK A;  3RVV A;  4BS6 A;  3CBK A;  3PHX A;  3ZUA A;  4YYR A;  3DF0 A;  1AYU A;  3O1G A;  4YYS A;  1THE A;  4P6G A;  2J7Q A;  3ZNH A;  1AYV A;  2R9N A;  2AGA A;  3H8B A;  3OIS A;  2ARY A;  4YYV A;  3KSE A;  5FPW A;  2IPP B;  1X9Y A;  3KWZ A;  3IMA A;  3WXG A;  2FQ9 A;  2FRA A;  4PP2 E;  1ME4 A;  3N4C A;  1KHQ A;  2DC9 A;  2GHU A;  3RNV A;  3IHP A;  3HD3 A;  4BPV A;  1GCB A;  3KX1 A;  1MS6 A;  2HXZ A;  3BPF A;  3I06 A;  4BOZ A;  1YAL A;  2PNS A;  9PAP A;  2F7D A;  2R9M A; 
#chains in the Genus database with same CATH homology
 3PW3 A;  2ATO A;  3F75 A;  2G8J A;  4W5B A;  1EF7 A;  3N3K A;  3BPM A;  1GX3 A;  1AIM A;  1PIP A;  1MDW A;  3LTW A;  3S3R A;  3GCB A;  1W4T A;  4FK5 A;  4CDE B;  2R9O A;  3H89 A;  3CBJ A;  2DC6 A;  4YYQ A;  3LFY A;  1PE6 A;  1YK7 A;  3QJ3 A;  1EWL A;  3K24 A;  4X6H A;  1TLO A;  1YVB A;  3IV2 A;  2NQI A;  1SNK A;  2DJG B;  1BQI A;  2OP3 A;  3P5W A;  4QRG A;  5J94 A;  1CSB B;  2DCC A;  5K16 A;  4XUI A;  1EWO A;  3HHI A;  2PBH A;  1HUC B;  3CH2 X;  1AU2 A;  1YT7 A;  4GUZ A;  3TNX A;  3M99 A;  5EGW A;  1MEM A;  2JQF R;  2P0R A;  4I04 A;  4YVA A;  3OF9 A;  5CHT A;  4DMY A;  1JQP A;  3P5X A;  2DC7 A;  5CHV A;  2AUZ A;  2DCA A;  4X6J A;  4MZO A;  2DJF B;  4Q8G A;  4KLB A;  3BCN A;  1PAD A;  1MEG A;  5CVM A;  4YYU A;  3BC3 A;  1CTE A;  1SP4 B;  3IOQ A;  2DC8 A;  2G8E A;  2VHF A;  2YJ8 A;  4I05 A;  3HWN A;  4P6E A;  3USV A;  1BGO A;  3QSD A;  4HWY A;  5JH3 A;  4BGF A;  3C9E A;  1VSN A;  3PBH A;  2HD5 A;  2DZZ A;  1TU6 A;  4W4U A;  2DCD A;  4FIP A;  2IBI A;  4N4Z A;  1O0E A;  1NPZ A;  3IUT A;  2Y5B A;  3KKU A;  2NQG A;  1ZIV A;  2R9F A;  1MHW A;  2HH5 A;  2FRQ A;  4FJC A;  1FH0 A;  2E01 A;  3IEJ A;  1U9W A;  3WXE A;  2BDZ A;  1YK8 A;  2BSZ A;  2VFC A;  3MHS A;  2E00 A;  2FUD A;  2E03 A;  2XU1 A;  1CV8 A;  3B79 A;  3BOW A;  3RVX A;  2FTD A;  1BP4 A;  1K3B B;  2C0Y A;  4B55 A;  4QH6 A;  3OVZ A;  2E02 A;  1ME3 A;  4OEM A;  3I3T A;  3U8E A;  2FT2 A;  1POP A;  1GMY A;  2YJB A;  1W5R A;  5CVO B;  4ZUX U;  3V6C A;  2DCB A;  3E1Z B;  2VHS A;  1GEC E;  2AIM A;  1ITO A;  1CPJ A;  1PPO A;  3CH3 X;  4PI3 A;  3PDF A;  8PCH A;  1GLO A;  1Q6K A;  4MSX A;  4QRV A;  4CZW A;  1F2A A;  3OF8 A;  1DEU A;  3H8C A;  1F2C A;  1PPP A;  1CB5 A;  5CVN B;  1Y08 A;  4Q8H A;  2AS8 A;  3OVX A;  4CDC B;  4AXM A;  1NL6 A;  2OUL A;  2DZY A;  1U9Q X;  2CIO A;  1Y4H A;  3LXS A;  2B1M A;  2YJC A;  1AEC A;  1A6R A;  1EWM A;  3HHA A;  2AU1 A;  4QRX A;  1AYW A;  1MIR A;  3O0U A;  3D6S A;  1STF E;  3MHH A;  4DMX A;  3KW9 A;  1QDQ A;  2YJ2 A;  1TL9 A;  1BY8 A;  4G54 A;  2G7Y A;  3RVW A;  1EWP A;  2PRE A;  4BQV A;  1NB5 A;  1QOL A;  5PAD A;  3KFQ A;  2GFO A;  3WXF A;  4N8W A;  4PP1 A;  1NB3 A;  3P5V A;  2CB5 A;  1QXP A;  2OZ2 A;  2JQG R;  2NQD B;  4PAD A;  4X6I A;  7PCK A;  1PPN A;  2WBF X;  4K7C A;  4W5C A;  3F5V A;  2XU4 A;  1KFX L;  3QT4 A;  2XU3 A;  5A24 A;  3D9W A;  1U5I A;  1CJL A;  3S3Q A;  3MTN A;  4WA6 A;  4AXL A;  4N79 A;  3KWB X;  2P7U A;  3K8U A;  1IWD A;  1CVZ A;  2PAD A;  2B1N A;  5JA7 A;  1AU4 A;  2HHN A;  3H6S A;  2AYO A;  3V6E A;  4MZS A;  2P86 A;  3MOR A;  2O6X A;  4QBB A;  1W6F A;  1PBH A;  1KFU L;  3N3G A;  4I07 A;  1NQC A;  1PCI A;  2AUX A;  1ATK A;  3AI8 A;  3H7D A;  2H7J A;  4C5P A;  1QMY A;  1NLJ A;  1ICF A;  5F02 A;  1U9V A;  3K9M A;  5EF4 A;  4OEL A;  2YJ9 A;  1F2B A;  2FO5 A;  2NQA A;  1ZCM A;  2R9C A;  1S4V A;  4CDF B;  1XKG A;  3ERV A;  2R6N A;  1M6D A;  1AU3 A;  4CDD B;  6PAD A;  1CQD A;  4NV8 A;  4BSQ A;  1PPD A;  2Y6E A;  2FYE A;  4YYW A;  1KXR A;  2AVW A;  3NHE A;  1F29 A;  4BS5 A;  1KHP A;  1DF0 A;  1AU0 A;  3P5U A;  1U9X A;  2AYN A;  4XR7 A;  4NV7 A;  2G6D A;  2BDL A;  4RY2 A;  1PXV A;  2XU5 A;  2F1G A;  1CS8 A;  3PNR A;  4YV8 A;  1VJV A;  2ACT A;  3BWK A;  3RVV A;  4BS6 A;  3CBK A;  3ZUA A;  4YYR A;  3DF0 A;  1AYU A;  3O1G A;  4YYS A;  1THE A;  4P6G A;  1AYV A;  2R9N A;  3H8B A;  3OIS A;  2ARY A;  4YYV A;  3KSE A;  5FPW A;  2IPP B;  1X9Y A;  3KWZ A;  3IMA A;  3WXG A;  2FQ9 A;  2FRA A;  4PP2 E;  1ME4 A;  3N4C A;  1KHQ A;  2DC9 A;  2GHU A;  3IHP A;  2VFB A;  1E2T A;  3HD3 A;  4BPV A;  1GCB A;  3KX1 A;  1MS6 A;  2HXZ A;  3BPF A;  3I06 A;  1YAL A;  2PNS A;  9PAP A;  2F7D A;  2R9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...