3S3QA

Structure of cathepsin b1 from schistosoma mansoni in complex with k11017 inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
VEIPSSFDSRKKWPRCKSIATIRDQSRCGSCWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCEHHTKGKYPPCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Inhibition of Cathepsin B Drug Target from the Human Blood Fluke, Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B-like peptidase (C01 family)
total genus 90
structure length 254
sequence length 254
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3s3qA00
1JQPA 2R9NA 3BCNA 4W5BA 2AUZA 5J94A 4N8WA 3RVVA 9PAPA 2DJFB 1MS6A 4X6JA 2HH5A 2C0YA 1ZIVA 2NQGA 3BPMA 4K7CA 2CIOA 3WXFA 3OF9A 3K9MA 1EWLA 2YJBA 1NL6A 1FH0A 1U9WA 4FK5A 1PADA 2FTDA 1TL9A 1U5IA 1AYVA 2G6DA 3S3QA 3V6EA 5F02A 3NHEA 1A6RA 4XR7A 5CHVA 3PBHA 3U8EA 1AYWA 1GECE 2ARYA 1PXVA 2FUDA 2DCCA 2FO5A 3CH2X 3LFYA 3V6CA 1Y08A 3TNXA 1NQCA 2BDLA 1CV8A 1AU3A 4QBBA 1EWOA 2FRQA 3ERVA 2P86A 4CZWA 5CVMA 2PADA 4MZOA 1ZCMA 4QRXA 1GCBA 4YYWA 1IWDA 1KFXL 4I07A 4P6GA 4QRGA 3HD3A 2DC7A 1AIMA 3MHSA 4G54A 4KLBA 1TU6A 2OULA 2YJ8A 3ZUAA 2AIMA 1YK8A 3HHIA 2AVWA 3IOQA 4CDCB 3DF0A 1CS8A 3B79A 3BWKA 3CBJA 4CDDB 4ZUXU 2AUXA 2DZYA 2OZ2A 1QOLA 1CTEA 1BGOA 1QMYA 1PBHA 1F2BA 2BDZA 3RVXA 4FJCA 4BS6A 2G8JA 2P7UA 3BC3A 4OEMA 1YT7A 3P5VA 4PADA 2FQ9A 2IBIA 3CBKA 2XU4A 3PDFA 4MSXA 3OVZA 3PW3A 3HHAA 2PNSA 4BQVA 3S3RA 1AU4A 2XU5A 3GCBA 2YJ2A 3MHHA 5K16A 7PCKA 3IUTA 2R9CA 1BY8A 4X6IA 4P6EA 1SP4B 1ICFA 5CHTA 3KKUA 4BSQA 3M99A 4HWYA 3H8CA 1NPZA 5JH3A 3LXSA 5FPWA 4YV8A 1MHWA 3HWNA 2O6XA 4X6HA 2NQAA 4W4UA 2P0RA 3KWBX 3KX1A 1S4VA 1EF7A 2CB5A 3WXEA 2G8EA 3RVWA 3KWZA 2G7YA 2FYEA 1AU2A 2AYOA 3P5XA 1CQDA 4DMXA 2XU3A 2AS8A 3MTNA 1AU0A 3USVA 5EGWA 2NQDB 3C9EA 1QDQA 2R9FA 2HHNA 1PPDA 1O0EA 4Q8HA 1DF0A 1F2AA 4CDEB 3OVXA 3O1GA 1CVZA 1MEMA 1U9VA 1ME3A 1YVBA 1CB5A 4MZSA 2ATOA 3IHPA 4DMYA 2HD5A 3F75A 3MORA 3O0UA 1K3BB 2H7JA 4PP2E 4YYQA 1Q6KA 2FRAA 4N79A 3BOWA 3P5WA 3N4CA 2YJCA 3E1ZB 1F29A 1PE6A 2DCAA 2DCBA 3H8BA 2DCDA 1KHQA 2E02A 3D6SA 1NLJA 1U9QX 2XU1A 1PIPA 2DC6A 1PPOA 1ITOA 3F5VA 3QJ3A 2PREA 3I3TA 2GHUA 4OELA 4I05A 1MIRA 1Y4HA 1BP4A 2JQGR 4YYRA 1GMYA 4QRVA 3IEJA 1PPPA 8PCHA 4QH6A 1VSNA 2Y6EA 3P5UA 4YYSA 1QXPA 4AXMA 1YALA 6PADA 1NB5A 2Y5BA 3KW9A 2AU1A 2VHFA 2E00A 1CPJA 4BPVA 3OF8A 2VHSA 1XKGA 4YYVA 2DJGB 3BPFA 2E03A 1ATKA 1ME4A 3N3KA 1MEGA 5CVOB 1MDWA 1EWPA 5JA7A 3I06A 1TLOA 2E01A 3H89A 5EF4A 4AXLA 2NQIA 3H7DA 4PP1A 3CH3X 1PPNA 4YVAA 4PI3A 1THEA 4FIPA 1KFUL 1CJLA 3K8UA 1KXRA 3WXGA 1PCIA 2F1GA 1POPA 2JQFR 2IPPB 3K24A 1F2CA 2FT2A 2GFOA 2PBHA 1BQIA 3H6SA 3IMAA 3PNRA 1AYUA 3OISA 1VJVA 4CDFB 1CSBB 4BS5A 2AYNA 2YJ9A 4WA6A 3AI8A 1NB3A 1YK7A 3N3GA 4XUIA 5CVNB 1HUCB 2DC8A 1KHPA 2ACTA 2HXZA 2B1NA 4I04A 1SNKA 3KSEA 5PADA 1GLOA 1STFE 2DZZA 1X9YA 1AECA 1EWMA 2R9MA 3KFQA 2DC9A 2R6NA 3QSDA 4YYUA 3IV2A 2OP3A 4Q8GA 4W5CA 1U9XA 1DEUA 3QT4A 5A24A 4RY2A 2B1MA 2R9OA 1M6DA 4N4ZA 2WBFX 2F7DA
chains in the Genus database with same CATH superfamily
3MTVA 1JQPA 2R9NA 3BCNA 4W5BA 2AUZA 5J94A 1PVJA 4N8WA 3RVVA 9PAPA 2DJFB 1MS6A 4X6JA 4OVZB 2HH5A 2C0YA 1ZIVA 2NQGA 3BPMA 2Z84A 4K7CA 4BOPA 4D8IA 2CIOA 3WXFA 3OF9A 3K9MA 1EWLA 1YZBA 2YJBA 1NL6A 1FH0A 1U9WA 4FK5A 1PADA 2FTDA 1TL9A 1U5IA 4P16A 1AYVA 2G6DA 3S3QA 3V6EA 3BY4A 5F02A 3NHEA 1A6RA 4XR7A 5CHVA 3ZNHA 3PBHA 3U8EA 1AYWA 1GECE 2ARYA 4OVZA 2BU3A 1PXVA 3MJ5A 2FUDA 2DCCA 2FO5A 3CH2X 3LFYA 3V6CA 1Y08A 3TNXA 1NQCA 2BDLA 1CV8A 1AU3A 2JRIA 4QBBA 1EWOA 2FRQA 3ERVA 4OW0A 2P86A 4CZWA 3IFUA 5CVMA 2PADA 4RKXA 4MZOA 3TMPA 1ZCMA 4QRXA 1GCBA 2DOSA 4YYWA 1IWDA 1KFXL 4I07A 2FE8A 4P6GA 4QRGA 3HD3A 2DC7A 1AIMA 4PT5A 3MHSA 4G54A 4KLBA 1TU6A 2OULA 2YJ8A 3ZUAA 2AIMA 1YK8A 4D8EA 4D8BA 3HHIA 2AVWA 3IOQA 4CDCB 3DF0A 1CS8A 3B79A 3BWKA 3CBJA 4CDDB 4ZUXU 2AUXA 2DZYA 2OZ2A 4BOSA 1QOLA 1CTEA 1BGOA 1QMYA 1PBHA 4XZXA 1F2BA 2BDZA 3RVXA 4FJCA 3PRMA 4ZTBA 4BS6A 2G8JA 2P7UA 3BC3A 4OEMA 4R3DA 1YT7A 3P5VA 1UKFA 4PADA 2FQ9A 2IBIA 3CBKA 2XU4A 3PDFA 3OQCA 3PHUA 3OVZA 4MSXA 3PW3A 3HHAA 3MP2A 2PNSA 4BQVA 3S3RA 2J7QC 2J7QA 4BOUA 1AU4A 2XU5A 3GCBA 2YJ2A 3MHHA 5K16A 7PCKA 3E9SA 3IUTA 2R9CA 1BY8A 4X6IA 4P6EA 1SP4B 1ICFA 5CHTA 4IP3A 3KKUA 4BSQA 3M99A 4HWYA 3H8CA 1NPZA 5JH3A 3LXSA 5FPWA 4YV8A 1MHWA 2JTCA 3HWNA 2O6XA 4X6HA 2NQAA 4W4UA 2P0RA 3KWBX 3KX1A 1S4VA 1EF7A 2CB5A 3WXEA 2G8EA 4IUMA 3RVWA 3KWZA 2G7YA 2FYEA 4M0WA 1AU2A 2AYOA 3P5XA 1CQDA 4DMXA 2XU3A 2AS8A 3MTNA 1AU0A 3USVA 5EGWA 2NQDB 5EZSA 3C9EA 1QDQA 2R9FA 2HHNA 3O65A 1PPDA 1O0EA 4Q8HA 1DF0A 1F2AA 4CDEB 3OVXA 3O1GA 1CVZA 1MEMA 1U9VA 1ME3A 2AGAA 4HXDB 1YVBA 1CB5A 4MZSA 2ATOA 3BB7A 3IHPA 4DMYA 2HD5A 3F75A 3MORA 3O0UA 2HWKA 1K3BB 2H7JA 3PRPA 2BTWA 4PP2E 3W30A 4YYQA 5KO3A 1Q6KA 2FRAA 4N79A 3BOWA 3P5WA 3N4CA 2YJCA 3E1ZB 3PHXA 1F29A 1PE6A 2DCAA 2DCBA 3H8BA 2DCDA 1KHQA 2E02A 3D6SA 1NLJA 1U9QX 2XU1A 1PIPA 4BOQA 5EZQA 2DC6A 1PPOA 1ITOA 3F5VA 3QJ3A 2PREA 4WURA 3B21A 3I3TA 2GHUA 4OELA 4I05A 1MIRA 1Y4HA 4REZA 1BP4A 2JQGR 4YYRA 1GMYA 4QRVA 3IEJA 4MM3B 1DKIA 1PPPA 8PCHA 4QH6A 1VSNA 2Y6EA 3P5UA 4YYSA 1QXPA 4AXMA 1YALA 6PADA 1NB5A 2Y5BA 3KW9A 2AU1A 2VHFA 4MI7A 2E00A 1CPJA 4BOZA 4BPVA 3OF8A 2VHSA 1XKGA 4YYVA 2DJGB 3BPFA 5E6JA 2E03A 3TRKA 4GUAA 1ATKA 1ME4A 2UZJA 3W31A 3N3KA 1MEGA 5CVOB 1MDWA 1EWPA 5JA7A 3I06A 1TLOA 2E01A 3H89A 5EF4A 4AXLA 2NQIA 3H7DA 4PP1A 3CH3X 1PPNA 4YVAA 4PI3A 1THEA 4FIPA 1KFUL 1CJLA 3K8UA 1KXRA 3WXGA 1PCIA 2BTWB 2F1GA 1POPA 2JQFR 2IPPB 3K24A 1F2CA 2FT2A 3PHWA 2GFOA 2PBHA 1BQIA 3H6SA 3IMAA 3PNRA 1AYUA 3OISA 1VJVA 4CDFB 1CSBB 5JZEA 3PSEA 4BS5A 2AYNA 3PT2A 2YJ9A 4WA6A 3AI8A 1NB3A 1YK7A 3N3GA 4RNAA 4XUIA 5CVNB 1HUCB 2DC8A 1KHPA 2ACTA 2HXZA 2B1NA 4I04A 4RF0A 1SNKA 3KSEA 5PADA 1GLOA 1STFE 2DZZA 3C0RA 1X9YA 1AECA 1EWMA 2R9MA 3KFQA 2DC9A 2R6NA 4A5UA 3QSDA 4YYUA 3IV2A 2OP3A 4Q8GA 4W5CA 1U9XA 1DEUA 3QT4A 5A24A 4RY2A 2B1MA 4RF1A 2R9OA 3BBAA 1M6DA 3RNVA 4N4ZA 2WBFX 2F7DA
chains in the Genus database with same CATH topology
2VFBA 1JQPA 2R9NA 3BCNA 4W5BA 2AUZA 5J94A 4N8WA 3RVVA 9PAPA 2DJFB 1MS6A 4X6JA 2HH5A 2C0YA 1ZIVA 2NQGA 3BPMA 4K7CA 2CIOA 3WXFA 3OF9A 3K9MA 1EWLA 2YJBA 1NL6A 1FH0A 1U9WA 4FK5A 1PADA 2FTDA 1TL9A 1U5IA 1AYVA 2G6DA 3S3QA 3V6EA 5F02A 3NHEA 1A6RA 4XR7A 5CHVA 3PBHA 3U8EA 1AYWA 1GECE 2ARYA 1PXVA 2FUDA 2DCCA 2FO5A 3CH2X 3LFYA 3V6CA 1Y08A 3TNXA 1NQCA 1W4TA 2BDLA 1CV8A 1AU3A 4QBBA 1EWOA 2FRQA 3ERVA 2P86A 4CZWA 3D9WA 5CVMA 2PADA 4MZOA 1ZCMA 4QRXA 1GCBA 4YYWA 1IWDA 1KFXL 4I07A 4P6GA 4QRGA 3HD3A 2DC7A 1AIMA 3MHSA 4G54A 4KLBA 1TU6A 2OULA 2YJ8A 4BGFA 3ZUAA 2AIMA 1YK8A 4NV8A 3HHIA 2AVWA 3IOQA 4CDCB 3DF0A 1CS8A 3B79A 3BWKA 3CBJA 4CDDB 4ZUXU 2AUXA 2DZYA 2OZ2A 1QOLA 1CTEA 1BGOA 1QMYA 1PBHA 1F2BA 2BDZA 3RVXA 4FJCA 4BS6A 2G8JA 2P7UA 3BC3A 4OEMA 1YT7A 3P5VA 4PADA 2FQ9A 2IBIA 3CBKA 2XU4A 3PDFA 4MSXA 3OVZA 3PW3A 3HHAA 2PNSA 4BQVA 3S3RA 1AU4A 2XU5A 3GCBA 2YJ2A 3MHHA 5K16A 7PCKA 3IUTA 2R9CA 1BY8A 4X6IA 4P6EA 1SP4B 1ICFA 5CHTA 3KKUA 4BSQA 3M99A 4HWYA 3H8CA 1NPZA 5JH3A 3LXSA 4NV7A 5FPWA 4YV8A 1MHWA 3HWNA 2O6XA 4X6HA 2NQAA 4W4UA 2P0RA 3KWBX 3KX1A 1S4VA 1EF7A 2CB5A 3WXEA 2G8EA 3RVWA 3KWZA 2G7YA 2FYEA 1AU2A 2AYOA 3P5XA 1CQDA 4DMXA 2XU3A 2AS8A 3MTNA 1AU0A 3USVA 5EGWA 4C5PA 2NQDB 3C9EA 1QDQA 2R9FA 2HHNA 1PPDA 1O0EA 4Q8HA 1DF0A 1F2AA 4CDEB 3OVXA 3O1GA 1CVZA 1MEMA 1U9VA 1ME3A 1YVBA 1CB5A 4MZSA 2ATOA 3IHPA 4DMYA 2HD5A 3F75A 3MORA 3O0UA 1K3BB 2H7JA 4PP2E 4YYQA 1Q6KA 2FRAA 4N79A 3BOWA 3P5WA 3N4CA 2YJCA 3E1ZB 1F29A 1PE6A 2DCAA 2DCBA 3H8BA 2DCDA 1KHQA 2E02A 3D6SA 1NLJA 1U9QX 2XU1A 1PIPA 2DC6A 1PPOA 1ITOA 3F5VA 3QJ3A 2PREA 3I3TA 2GHUA 4OELA 4I05A 1MIRA 1Y4HA 1BP4A 2JQGR 4YYRA 1GMYA 4QRVA 3IEJA 1PPPA 8PCHA 4QH6A 1VSNA 2Y6EA 1W5RA 3P5UA 4YYSA 1QXPA 4AXMA 1YALA 6PADA 1NB5A 2Y5BA 3KW9A 2AU1A 2VHFA 2E00A 4GUZA 1CPJA 4BPVA 3OF8A 2VHSA 1XKGA 4YYVA 2DJGB 3BPFA 2E03A 1ATKA 1ME4A 3N3KA 1MEGA 5CVOB 1MDWA 1EWPA 5JA7A 3I06A 1TLOA 2E01A 3H89A 5EF4A 4AXLA 2NQIA 3H7DA 4PP1A 1GX3A 1PPNA 3CH3X 4YVAA 4PI3A 1THEA 4FIPA 1KFUL 1CJLA 3K8UA 1KXRA 3WXGA 1PCIA 2F1GA 1POPA 2JQFR 2IPPB 3K24A 1F2CA 2FT2A 2GFOA 2PBHA 1BQIA 3H6SA 3IMAA 3PNRA 1AYUA 3OISA 1VJVA 3LTWA 4CDFB 1CSBB 4BS5A 2AYNA 2YJ9A 4WA6A 3AI8A 1NB3A 1YK7A 3N3GA 4XUIA 5CVNB 1W6FA 1HUCB 2DC8A 1KHPA 2ACTA 2HXZA 2B1NA 4I04A 1SNKA 3KSEA 5PADA 2VFCA 1GLOA 1STFE 2DZZA 1E2TA 1X9YA 1AECA 1EWMA 2R9MA 3KFQA 2DC9A 2R6NA 3QSDA 4YYUA 3IV2A 2OP3A 4B55A 4Q8GA 4W5CA 1U9XA 1DEUA 3QT4A 5A24A 4RY2A 2B1MA 2R9OA 1M6DA 2BSZA 4N4ZA 2WBFX 2F7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQP A;  2R9N A;  3BCN A;  4W5B A;  2AUZ A;  5J94 A;  4N8W A;  3RVV A;  9PAP A;  2DJF B;  1MS6 A;  4X6J A;  2HH5 A;  2C0Y A;  1ZIV A;  2NQG A;  3BPM A;  4K7C A;  2CIO A;  3WXF A;  3OF9 A;  3K9M A;  1EWL A;  2YJB A;  1NL6 A;  1FH0 A;  1U9W A;  4FK5 A;  1PAD A;  2FTD A;  1TL9 A;  1U5I A;  1AYV A;  2G6D A;  3S3Q A;  3V6E A;  5F02 A;  3NHE A;  1A6R A;  4XR7 A;  5CHV A;  3PBH A;  3U8E A;  1AYW A;  1GEC E;  2ARY A;  1PXV A;  2FUD A;  2DCC A;  2FO5 A;  3CH2 X;  3LFY A;  3V6C A;  1Y08 A;  3TNX A;  1NQC A;  2BDL A;  1CV8 A;  1AU3 A;  4QBB A;  1EWO A;  2FRQ A;  3ERV A;  2P86 A;  4CZW A;  5CVM A;  2PAD A;  4MZO A;  1ZCM A;  4QRX A;  1GCB A;  4YYW A;  1IWD A;  1KFX L;  4I07 A;  4P6G A;  4QRG A;  3HD3 A;  2DC7 A;  1AIM A;  3MHS A;  4G54 A;  4KLB A;  1TU6 A;  2OUL A;  2YJ8 A;  3ZUA A;  2AIM A;  1YK8 A;  3HHI A;  2AVW A;  3IOQ A;  4CDC B;  3DF0 A;  1CS8 A;  3B79 A;  3BWK A;  3CBJ A;  4CDD B;  4ZUX U;  2AUX A;  2DZY A;  2OZ2 A;  1QOL A;  1CTE A;  1BGO A;  1QMY A;  1PBH A;  1F2B A;  2BDZ A;  3RVX A;  4FJC A;  4BS6 A;  2G8J A;  2P7U A;  3BC3 A;  4OEM A;  1YT7 A;  3P5V A;  4PAD A;  2FQ9 A;  2IBI A;  3CBK A;  2XU4 A;  3PDF A;  4MSX A;  3OVZ A;  3PW3 A;  3HHA A;  2PNS A;  4BQV A;  3S3R A;  1AU4 A;  2XU5 A;  3GCB A;  2YJ2 A;  3MHH A;  5K16 A;  7PCK A;  3IUT A;  2R9C A;  1BY8 A;  4X6I A;  4P6E A;  1SP4 B;  1ICF A;  5CHT A;  3KKU A;  4BSQ A;  3M99 A;  4HWY A;  3H8C A;  1NPZ A;  5JH3 A;  3LXS A;  5FPW A;  4YV8 A;  1MHW A;  3HWN A;  2O6X A;  4X6H A;  2NQA A;  4W4U A;  2P0R A;  3KWB X;  3KX1 A;  1S4V A;  1EF7 A;  2CB5 A;  3WXE A;  2G8E A;  3RVW A;  3KWZ A;  2G7Y A;  2FYE A;  1AU2 A;  2AYO A;  3P5X A;  1CQD A;  4DMX A;  2XU3 A;  2AS8 A;  3MTN A;  1AU0 A;  3USV A;  5EGW A;  2NQD B;  3C9E A;  1QDQ A;  2R9F A;  2HHN A;  1PPD A;  1O0E A;  4Q8H A;  1DF0 A;  1F2A A;  4CDE B;  3OVX A;  3O1G A;  1CVZ A;  1MEM A;  1U9V A;  1ME3 A;  1YVB A;  1CB5 A;  4MZS A;  2ATO A;  3IHP A;  4DMY A;  2HD5 A;  3F75 A;  3MOR A;  3O0U A;  1K3B B;  2H7J A;  4PP2 E;  4YYQ A;  1Q6K A;  2FRA A;  4N79 A;  3BOW A;  3P5W A;  3N4C A;  2YJC A;  3E1Z B;  1F29 A;  1PE6 A;  2DCA A;  2DCB A;  3H8B A;  2DCD A;  1KHQ A;  2E02 A;  3D6S A;  1NLJ A;  1U9Q X;  2XU1 A;  1PIP A;  2DC6 A;  1PPO A;  1ITO A;  3F5V A;  3QJ3 A;  2PRE A;  3I3T A;  2GHU A;  4OEL A;  4I05 A;  1MIR A;  1Y4H A;  1BP4 A;  2JQG R;  4YYR A;  1GMY A;  4QRV A;  3IEJ A;  1PPP A;  8PCH A;  4QH6 A;  1VSN A;  2Y6E A;  3P5U A;  4YYS A;  1QXP A;  4AXM A;  1YAL A;  6PAD A;  1NB5 A;  2Y5B A;  3KW9 A;  2AU1 A;  2VHF A;  2E00 A;  1CPJ A;  4BPV A;  3OF8 A;  2VHS A;  1XKG A;  4YYV A;  2DJG B;  3BPF A;  2E03 A;  1ATK A;  1ME4 A;  3N3K A;  1MEG A;  5CVO B;  1MDW A;  1EWP A;  5JA7 A;  3I06 A;  1TLO A;  2E01 A;  3H89 A;  5EF4 A;  4AXL A;  2NQI A;  3H7D A;  4PP1 A;  3CH3 X;  1PPN A;  4YVA A;  4PI3 A;  1THE A;  4FIP A;  1KFU L;  1CJL A;  3K8U A;  1KXR A;  3WXG A;  1PCI A;  2F1G A;  1POP A;  2JQF R;  2IPP B;  3K24 A;  1F2C A;  2FT2 A;  2GFO A;  2PBH A;  1BQI A;  3H6S A;  3IMA A;  3PNR A;  1AYU A;  3OIS A;  1VJV A;  4CDF B;  1CSB B;  4BS5 A;  2AYN A;  2YJ9 A;  4WA6 A;  3AI8 A;  1NB3 A;  1YK7 A;  3N3G A;  4XUI A;  5CVN B;  1HUC B;  2DC8 A;  1KHP A;  2ACT A;  2HXZ A;  2B1N A;  4I04 A;  1SNK A;  3KSE A;  5PAD A;  1GLO A;  1STF E;  2DZZ A;  1X9Y A;  1AEC A;  1EWM A;  2R9M A;  3KFQ A;  2DC9 A;  2R6N A;  3QSD A;  4YYU A;  3IV2 A;  2OP3 A;  4Q8G A;  4W5C A;  1U9X A;  1DEU A;  3QT4 A;  5A24 A;  4RY2 A;  2B1M A;  2R9O A;  1M6D A;  4N4Z A;  2WBF X;  2F7D A; 
#chains in the Genus database with same CATH topology
 3MTV A;  1JQP A;  2R9N A;  3BCN A;  4W5B A;  2AUZ A;  5J94 A;  1PVJ A;  4N8W A;  3RVV A;  9PAP A;  2DJF B;  1MS6 A;  4X6J A;  4OVZ B;  2HH5 A;  2C0Y A;  1ZIV A;  2NQG A;  3BPM A;  2Z84 A;  4K7C A;  4BOP A;  4D8I A;  2CIO A;  3WXF A;  3OF9 A;  3K9M A;  1EWL A;  1YZB A;  2YJB A;  1NL6 A;  1FH0 A;  1U9W A;  4FK5 A;  1PAD A;  2FTD A;  1TL9 A;  1U5I A;  4P16 A;  1AYV A;  2G6D A;  3S3Q A;  3V6E A;  3BY4 A;  5F02 A;  3NHE A;  1A6R A;  4XR7 A;  5CHV A;  3ZNH A;  3PBH A;  3U8E A;  1AYW A;  1GEC E;  2ARY A;  4OVZ A;  2BU3 A;  1PXV A;  3MJ5 A;  2FUD A;  2DCC A;  2FO5 A;  3CH2 X;  3LFY A;  3V6C A;  1Y08 A;  3TNX A;  1NQC A;  2BDL A;  1CV8 A;  1AU3 A;  2JRI A;  4QBB A;  1EWO A;  2FRQ A;  3ERV A;  4OW0 A;  2P86 A;  4CZW A;  3IFU A;  5CVM A;  2PAD A;  4RKX A;  4MZO A;  3TMP A;  1ZCM A;  4QRX A;  1GCB A;  2DOS A;  4YYW A;  1IWD A;  1KFX L;  4I07 A;  2FE8 A;  4P6G A;  4QRG A;  3HD3 A;  2DC7 A;  1AIM A;  4PT5 A;  3MHS A;  4G54 A;  4KLB A;  1TU6 A;  2OUL A;  2YJ8 A;  3ZUA A;  2AIM A;  1YK8 A;  4D8E A;  4D8B A;  3HHI A;  2AVW A;  3IOQ A;  4CDC B;  3DF0 A;  1CS8 A;  3B79 A;  3BWK A;  3CBJ A;  4CDD B;  4ZUX U;  2AUX A;  2DZY A;  2OZ2 A;  4BOS A;  1QOL A;  1CTE A;  1BGO A;  1QMY A;  1PBH A;  4XZX A;  1F2B A;  2BDZ A;  3RVX A;  4FJC A;  3PRM A;  4ZTB A;  4BS6 A;  2G8J A;  2P7U A;  3BC3 A;  4OEM A;  4R3D A;  1YT7 A;  3P5V A;  1UKF A;  4PAD A;  2FQ9 A;  2IBI A;  3CBK A;  2XU4 A;  3PDF A;  3OQC A;  3PHU A;  3OVZ A;  4MSX A;  3PW3 A;  3HHA A;  3MP2 A;  2PNS A;  4BQV A;  3S3R A;  2J7Q C;  2J7Q A;  4BOU A;  1AU4 A;  2XU5 A;  3GCB A;  2YJ2 A;  3MHH A;  5K16 A;  7PCK A;  3E9S A;  3IUT A;  2R9C A;  1BY8 A;  4X6I A;  4P6E A;  1SP4 B;  1ICF A;  5CHT A;  4IP3 A;  3KKU A;  4BSQ A;  3M99 A;  4HWY A;  3H8C A;  1NPZ A;  5JH3 A;  3LXS A;  5FPW A;  4YV8 A;  1MHW A;  2JTC A;  3HWN A;  2O6X A;  4X6H A;  2NQA A;  4W4U A;  2P0R A;  3KWB X;  3KX1 A;  1S4V A;  1EF7 A;  2CB5 A;  3WXE A;  2G8E A;  4IUM A;  3RVW A;  3KWZ A;  2G7Y A;  2FYE A;  4M0W A;  1AU2 A;  2AYO A;  3P5X A;  1CQD A;  4DMX A;  2XU3 A;  2AS8 A;  3MTN A;  1AU0 A;  3USV A;  5EGW A;  2NQD B;  5EZS A;  3C9E A;  1QDQ A;  2R9F A;  2HHN A;  3O65 A;  1PPD A;  1O0E A;  4Q8H A;  1DF0 A;  1F2A A;  4CDE B;  3OVX A;  3O1G A;  1CVZ A;  1MEM A;  1U9V A;  1ME3 A;  2AGA A;  4HXD B;  1YVB A;  1CB5 A;  4MZS A;  2ATO A;  3BB7 A;  3IHP A;  4DMY A;  2HD5 A;  3F75 A;  3MOR A;  3O0U A;  2HWK A;  1K3B B;  2H7J A;  3PRP A;  2BTW A;  4PP2 E;  3W30 A;  4YYQ A;  5KO3 A;  1Q6K A;  2FRA A;  4N79 A;  3BOW A;  3P5W A;  3N4C A;  2YJC A;  3E1Z B;  3PHX A;  1F29 A;  1PE6 A;  2DCA A;  2DCB A;  3H8B A;  2DCD A;  1KHQ A;  2E02 A;  3D6S A;  1NLJ A;  1U9Q X;  2XU1 A;  1PIP A;  4BOQ A;  5EZQ A;  2DC6 A;  1PPO A;  1ITO A;  3F5V A;  3QJ3 A;  2PRE A;  4WUR A;  3B21 A;  3I3T A;  2GHU A;  4OEL A;  4I05 A;  1MIR A;  1Y4H A;  4REZ A;  1BP4 A;  2JQG R;  4YYR A;  1GMY A;  4QRV A;  3IEJ A;  4MM3 B;  1DKI A;  1PPP A;  8PCH A;  4QH6 A;  1VSN A;  2Y6E A;  3P5U A;  4YYS A;  1QXP A;  4AXM A;  1YAL A;  6PAD A;  1NB5 A;  2Y5B A;  3KW9 A;  2AU1 A;  2VHF A;  4MI7 A;  2E00 A;  1CPJ A;  4BOZ A;  4BPV A;  3OF8 A;  2VHS A;  1XKG A;  4YYV A;  2DJG B;  3BPF A;  5E6J A;  2E03 A;  3TRK A;  4GUA A;  1ATK A;  1ME4 A;  2UZJ A;  3W31 A;  3N3K A;  1MEG A;  5CVO B;  1MDW A;  1EWP A;  5JA7 A;  3I06 A;  1TLO A;  2E01 A;  3H89 A;  5EF4 A;  4AXL A;  2NQI A;  3H7D A;  4PP1 A;  3CH3 X;  1PPN A;  4YVA A;  4PI3 A;  1THE A;  4FIP A;  1KFU L;  1CJL A;  3K8U A;  1KXR A;  3WXG A;  1PCI A;  2BTW B;  2F1G A;  1POP A;  2JQF R;  2IPP B;  3K24 A;  1F2C A;  2FT2 A;  3PHW A;  2GFO A;  2PBH A;  1BQI A;  3H6S A;  3IMA A;  3PNR A;  1AYU A;  3OIS A;  1VJV A;  4CDF B;  1CSB B;  5JZE A;  3PSE A;  4BS5 A;  2AYN A;  3PT2 A;  2YJ9 A;  4WA6 A;  3AI8 A;  1NB3 A;  1YK7 A;  3N3G A;  4RNA A;  4XUI A;  5CVN B;  1HUC B;  2DC8 A;  1KHP A;  2ACT A;  2HXZ A;  2B1N A;  4I04 A;  4RF0 A;  1SNK A;  3KSE A;  5PAD A;  1GLO A;  1STF E;  2DZZ A;  3C0R A;  1X9Y A;  1AEC A;  1EWM A;  2R9M A;  3KFQ A;  2DC9 A;  2R6N A;  4A5U A;  3QSD A;  4YYU A;  3IV2 A;  2OP3 A;  4Q8G A;  4W5C A;  1U9X A;  1DEU A;  3QT4 A;  5A24 A;  4RY2 A;  2B1M A;  4RF1 A;  2R9O A;  3BBA A;  1M6D A;  3RNV A;  4N4Z A;  2WBF X;  2F7D A; 
#chains in the Genus database with same CATH homology
 2VFB A;  1JQP A;  2R9N A;  3BCN A;  4W5B A;  2AUZ A;  5J94 A;  4N8W A;  3RVV A;  9PAP A;  2DJF B;  1MS6 A;  4X6J A;  2HH5 A;  2C0Y A;  1ZIV A;  2NQG A;  3BPM A;  4K7C A;  2CIO A;  3WXF A;  3OF9 A;  3K9M A;  1EWL A;  2YJB A;  1NL6 A;  1FH0 A;  1U9W A;  4FK5 A;  1PAD A;  2FTD A;  1TL9 A;  1U5I A;  1AYV A;  2G6D A;  3S3Q A;  3V6E A;  5F02 A;  3NHE A;  1A6R A;  4XR7 A;  5CHV A;  3PBH A;  3U8E A;  1AYW A;  1GEC E;  2ARY A;  1PXV A;  2FUD A;  2DCC A;  2FO5 A;  3CH2 X;  3LFY A;  3V6C A;  1Y08 A;  3TNX A;  1NQC A;  1W4T A;  2BDL A;  1CV8 A;  1AU3 A;  4QBB A;  1EWO A;  2FRQ A;  3ERV A;  2P86 A;  4CZW A;  3D9W A;  5CVM A;  2PAD A;  4MZO A;  1ZCM A;  4QRX A;  1GCB A;  4YYW A;  1IWD A;  1KFX L;  4I07 A;  4P6G A;  4QRG A;  3HD3 A;  2DC7 A;  1AIM A;  3MHS A;  4G54 A;  4KLB A;  1TU6 A;  2OUL A;  2YJ8 A;  4BGF A;  3ZUA A;  2AIM A;  1YK8 A;  4NV8 A;  3HHI A;  2AVW A;  3IOQ A;  4CDC B;  3DF0 A;  1CS8 A;  3B79 A;  3BWK A;  3CBJ A;  4CDD B;  4ZUX U;  2AUX A;  2DZY A;  2OZ2 A;  1QOL A;  1CTE A;  1BGO A;  1QMY A;  1PBH A;  1F2B A;  2BDZ A;  3RVX A;  4FJC A;  4BS6 A;  2G8J A;  2P7U A;  3BC3 A;  4OEM A;  1YT7 A;  3P5V A;  4PAD A;  2FQ9 A;  2IBI A;  3CBK A;  2XU4 A;  3PDF A;  4MSX A;  3OVZ A;  3PW3 A;  3HHA A;  2PNS A;  4BQV A;  3S3R A;  1AU4 A;  2XU5 A;  3GCB A;  2YJ2 A;  3MHH A;  5K16 A;  7PCK A;  3IUT A;  2R9C A;  1BY8 A;  4X6I A;  4P6E A;  1SP4 B;  1ICF A;  5CHT A;  3KKU A;  4BSQ A;  3M99 A;  4HWY A;  3H8C A;  1NPZ A;  5JH3 A;  3LXS A;  4NV7 A;  5FPW A;  4YV8 A;  1MHW A;  3HWN A;  2O6X A;  4X6H A;  2NQA A;  4W4U A;  2P0R A;  3KWB X;  3KX1 A;  1S4V A;  1EF7 A;  2CB5 A;  3WXE A;  2G8E A;  3RVW A;  3KWZ A;  2G7Y A;  2FYE A;  1AU2 A;  2AYO A;  3P5X A;  1CQD A;  4DMX A;  2XU3 A;  2AS8 A;  3MTN A;  1AU0 A;  3USV A;  5EGW A;  4C5P A;  2NQD B;  3C9E A;  1QDQ A;  2R9F A;  2HHN A;  1PPD A;  1O0E A;  4Q8H A;  1DF0 A;  1F2A A;  4CDE B;  3OVX A;  3O1G A;  1CVZ A;  1MEM A;  1U9V A;  1ME3 A;  1YVB A;  1CB5 A;  4MZS A;  2ATO A;  3IHP A;  4DMY A;  2HD5 A;  3F75 A;  3MOR A;  3O0U A;  1K3B B;  2H7J A;  4PP2 E;  4YYQ A;  1Q6K A;  2FRA A;  4N79 A;  3BOW A;  3P5W A;  3N4C A;  2YJC A;  3E1Z B;  1F29 A;  1PE6 A;  2DCA A;  2DCB A;  3H8B A;  2DCD A;  1KHQ A;  2E02 A;  3D6S A;  1NLJ A;  1U9Q X;  2XU1 A;  1PIP A;  2DC6 A;  1PPO A;  1ITO A;  3F5V A;  3QJ3 A;  2PRE A;  3I3T A;  2GHU A;  4OEL A;  4I05 A;  1MIR A;  1Y4H A;  1BP4 A;  2JQG R;  4YYR A;  1GMY A;  4QRV A;  3IEJ A;  1PPP A;  8PCH A;  4QH6 A;  1VSN A;  2Y6E A;  1W5R A;  3P5U A;  4YYS A;  1QXP A;  4AXM A;  1YAL A;  6PAD A;  1NB5 A;  2Y5B A;  3KW9 A;  2AU1 A;  2VHF A;  2E00 A;  4GUZ A;  1CPJ A;  4BPV A;  3OF8 A;  2VHS A;  1XKG A;  4YYV A;  2DJG B;  3BPF A;  2E03 A;  1ATK A;  1ME4 A;  3N3K A;  1MEG A;  5CVO B;  1MDW A;  1EWP A;  5JA7 A;  3I06 A;  1TLO A;  2E01 A;  3H89 A;  5EF4 A;  4AXL A;  2NQI A;  3H7D A;  4PP1 A;  1GX3 A;  1PPN A;  3CH3 X;  4YVA A;  4PI3 A;  1THE A;  4FIP A;  1KFU L;  1CJL A;  3K8U A;  1KXR A;  3WXG A;  1PCI A;  2F1G A;  1POP A;  2JQF R;  2IPP B;  3K24 A;  1F2C A;  2FT2 A;  2GFO A;  2PBH A;  1BQI A;  3H6S A;  3IMA A;  3PNR A;  1AYU A;  3OIS A;  1VJV A;  3LTW A;  4CDF B;  1CSB B;  4BS5 A;  2AYN A;  2YJ9 A;  4WA6 A;  3AI8 A;  1NB3 A;  1YK7 A;  3N3G A;  4XUI A;  5CVN B;  1W6F A;  1HUC B;  2DC8 A;  1KHP A;  2ACT A;  2HXZ A;  2B1N A;  4I04 A;  1SNK A;  3KSE A;  5PAD A;  2VFC A;  1GLO A;  1STF E;  2DZZ A;  1E2T A;  1X9Y A;  1AEC A;  1EWM A;  2R9M A;  3KFQ A;  2DC9 A;  2R6N A;  3QSD A;  4YYU A;  3IV2 A;  2OP3 A;  4B55 A;  4Q8G A;  4W5C A;  1U9X A;  1DEU A;  3QT4 A;  5A24 A;  4RY2 A;  2B1M A;  2R9O A;  1M6D A;  2BSZ A;  4N4Z A;  2WBF X;  2F7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...